US20130102034A1 - Modified nucleosides, nucleotides, and nucleic acids, and uses thereof - Google Patents
Modified nucleosides, nucleotides, and nucleic acids, and uses thereof Download PDFInfo
- Publication number
- US20130102034A1 US20130102034A1 US13/481,127 US201213481127A US2013102034A1 US 20130102034 A1 US20130102034 A1 US 20130102034A1 US 201213481127 A US201213481127 A US 201213481127A US 2013102034 A1 US2013102034 A1 US 2013102034A1
- Authority
- US
- United States
- Prior art keywords
- nucleic acid
- alkyl
- compound
- nucleotide
- formula
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 258
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 230
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 230
- 125000003729 nucleotide group Chemical group 0.000 title claims abstract description 185
- 239000002773 nucleotide Substances 0.000 title claims abstract description 132
- 125000003835 nucleoside group Chemical group 0.000 title abstract description 27
- 238000000034 method Methods 0.000 claims abstract description 90
- 239000000203 mixture Substances 0.000 claims description 114
- 150000001875 compounds Chemical class 0.000 claims description 101
- 108090000623 proteins and genes Proteins 0.000 claims description 93
- 102000004169 proteins and genes Human genes 0.000 claims description 81
- 230000027455 binding Effects 0.000 claims description 60
- 229920002477 rna polymer Polymers 0.000 claims description 46
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 claims description 42
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 claims description 42
- 125000004169 (C1-C6) alkyl group Chemical group 0.000 claims description 39
- 229910052760 oxygen Inorganic materials 0.000 claims description 39
- 229910052717 sulfur Inorganic materials 0.000 claims description 39
- 230000004048 modification Effects 0.000 claims description 35
- 238000012986 modification Methods 0.000 claims description 35
- 125000003837 (C1-C20) alkyl group Chemical group 0.000 claims description 33
- 230000014616 translation Effects 0.000 claims description 31
- 125000005843 halogen group Chemical group 0.000 claims description 29
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 claims description 28
- 125000003342 alkenyl group Chemical group 0.000 claims description 28
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 26
- 230000015788 innate immune response Effects 0.000 claims description 26
- 229920001223 polyethylene glycol Polymers 0.000 claims description 25
- 229910003827 NRaRb Inorganic materials 0.000 claims description 24
- 125000000304 alkynyl group Chemical group 0.000 claims description 24
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 claims description 24
- 229910052799 carbon Inorganic materials 0.000 claims description 23
- 238000007385 chemical modification Methods 0.000 claims description 23
- 238000006243 chemical reaction Methods 0.000 claims description 22
- 230000003247 decreasing effect Effects 0.000 claims description 22
- 125000003358 C2-C20 alkenyl group Chemical group 0.000 claims description 21
- 239000002202 Polyethylene glycol Substances 0.000 claims description 21
- 229910052757 nitrogen Inorganic materials 0.000 claims description 21
- 229940104302 cytosine Drugs 0.000 claims description 20
- 229940035893 uracil Drugs 0.000 claims description 20
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 claims description 18
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 claims description 18
- 230000001413 cellular effect Effects 0.000 claims description 18
- 125000006649 (C2-C20) alkynyl group Chemical group 0.000 claims description 17
- 230000014509 gene expression Effects 0.000 claims description 16
- 125000003827 glycol group Chemical group 0.000 claims description 16
- 125000004429 atom Chemical group 0.000 claims description 15
- 239000002299 complementary DNA Substances 0.000 claims description 14
- 230000001965 increasing effect Effects 0.000 claims description 14
- 229940029575 guanosine Drugs 0.000 claims description 13
- 229930024421 Adenine Natural products 0.000 claims description 12
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 claims description 12
- 229960000643 adenine Drugs 0.000 claims description 12
- 230000028327 secretion Effects 0.000 claims description 12
- 125000003118 aryl group Chemical group 0.000 claims description 11
- 125000004432 carbon atom Chemical group C* 0.000 claims description 11
- 239000002126 C01EB10 - Adenosine Substances 0.000 claims description 10
- 229960005305 adenosine Drugs 0.000 claims description 10
- 125000003860 C1-C20 alkoxy group Chemical group 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 9
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 9
- 125000001424 substituent group Chemical group 0.000 claims description 9
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 claims description 8
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 claims description 8
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 claims description 8
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 claims description 8
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 claims description 8
- 125000004001 thioalkyl group Chemical group 0.000 claims description 8
- 102000004127 Cytokines Human genes 0.000 claims description 7
- 108090000695 Cytokines Proteins 0.000 claims description 7
- 101710163270 Nuclease Proteins 0.000 claims description 7
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 claims description 7
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 7
- 235000000346 sugar Nutrition 0.000 claims description 6
- 108010054017 Granulocyte Colony-Stimulating Factor Receptors Proteins 0.000 claims description 5
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 claims description 5
- 229910017711 NHRa Inorganic materials 0.000 claims description 5
- 102000002689 Toll-like receptor Human genes 0.000 claims description 5
- 108020000411 Toll-like receptor Proteins 0.000 claims description 5
- 150000001412 amines Chemical class 0.000 claims description 5
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 5
- 230000001939 inductive effect Effects 0.000 claims description 5
- 230000000770 proinflammatory effect Effects 0.000 claims description 5
- 108020003175 receptors Proteins 0.000 claims description 5
- 102000005962 receptors Human genes 0.000 claims description 5
- 102100037435 Antiviral innate immune response receptor RIG-I Human genes 0.000 claims description 4
- 101000952099 Homo sapiens Antiviral innate immune response receptor RIG-I Proteins 0.000 claims description 4
- 101001082073 Homo sapiens Interferon-induced helicase C domain-containing protein 1 Proteins 0.000 claims description 4
- 102100027353 Interferon-induced helicase C domain-containing protein 1 Human genes 0.000 claims description 4
- 230000004913 activation Effects 0.000 claims description 4
- 125000001309 chloro group Chemical group Cl* 0.000 claims description 4
- 125000001153 fluoro group Chemical group F* 0.000 claims description 4
- 230000006698 induction Effects 0.000 claims description 4
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 claims description 3
- 230000002194 synthesizing effect Effects 0.000 claims description 3
- 230000035479 physiological effects, processes and functions Effects 0.000 claims description 2
- 125000000041 C6-C10 aryl group Chemical group 0.000 claims 6
- 125000004191 (C1-C6) alkoxy group Chemical group 0.000 claims 4
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 claims 2
- 230000008859 change Effects 0.000 claims 2
- 230000006800 cellular catabolic process Effects 0.000 claims 1
- 230000018448 secretion by cell Effects 0.000 claims 1
- 210000004027 cell Anatomy 0.000 description 124
- 210000002510 keratinocyte Anatomy 0.000 description 67
- 235000018102 proteins Nutrition 0.000 description 65
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 59
- 108090000765 processed proteins & peptides Proteins 0.000 description 48
- 102000004196 processed proteins & peptides Human genes 0.000 description 47
- 108020004999 messenger RNA Proteins 0.000 description 44
- 229920001184 polypeptide Polymers 0.000 description 42
- 241000282414 Homo sapiens Species 0.000 description 40
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 37
- -1 viral nucleic acids Chemical class 0.000 description 33
- 201000010099 disease Diseases 0.000 description 32
- 239000004480 active ingredient Substances 0.000 description 29
- 239000003814 drug Substances 0.000 description 29
- 239000002904 solvent Substances 0.000 description 28
- 208000035475 disorder Diseases 0.000 description 27
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 26
- 239000008194 pharmaceutical composition Substances 0.000 description 26
- 229940096913 pseudoisocytidine Drugs 0.000 description 25
- 238000002965 ELISA Methods 0.000 description 24
- 239000002777 nucleoside Substances 0.000 description 24
- 150000003833 nucleoside derivatives Chemical class 0.000 description 23
- UVBYMVOUBXYSFV-XUTVFYLZSA-N 1-methylpseudouridine Chemical compound O=C1NC(=O)N(C)C=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 UVBYMVOUBXYSFV-XUTVFYLZSA-N 0.000 description 22
- MPDKOGQMQLSNOF-GBNDHIKLSA-N 2-amino-5-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1h-pyrimidin-6-one Chemical compound O=C1NC(N)=NC=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 MPDKOGQMQLSNOF-GBNDHIKLSA-N 0.000 description 22
- 238000009472 formulation Methods 0.000 description 22
- 238000000338 in vitro Methods 0.000 description 22
- 238000001890 transfection Methods 0.000 description 22
- 230000000694 effects Effects 0.000 description 21
- 0 [1*][V]1=[U][W](C(C)(C)C)C(=C)n([4*])c1[2*].[2*]C1=NC(=O)C(C(C)(C)C)CN1[3*].[3*]N1C=C(C(C)(C)C)C(=O)NC1=O Chemical compound [1*][V]1=[U][W](C(C)(C)C)C(=C)n([4*])c1[2*].[2*]C1=NC(=O)C(C(C)(C)C)CN1[3*].[3*]N1C=C(C(C)(C)C)C(=O)NC1=O 0.000 description 20
- 239000003795 chemical substances by application Substances 0.000 description 20
- 239000000546 pharmaceutical excipient Substances 0.000 description 19
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 18
- 229930185560 Pseudouridine Natural products 0.000 description 18
- PTJWIQPHWPFNBW-UHFFFAOYSA-N Pseudouridine C Natural products OC1C(O)C(CO)OC1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-UHFFFAOYSA-N 0.000 description 18
- WGDUUQDYDIIBKT-UHFFFAOYSA-N beta-Pseudouridine Natural products OC1OC(CN2C=CC(=O)NC2=O)C(O)C1O WGDUUQDYDIIBKT-UHFFFAOYSA-N 0.000 description 18
- PTJWIQPHWPFNBW-GBNDHIKLSA-N pseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=O PTJWIQPHWPFNBW-GBNDHIKLSA-N 0.000 description 18
- 108020004414 DNA Proteins 0.000 description 17
- 102000053602 DNA Human genes 0.000 description 17
- 235000002639 sodium chloride Nutrition 0.000 description 17
- 239000000126 substance Substances 0.000 description 17
- RKSLVDIXBGWPIS-UAKXSSHOSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidine-2,4-dione Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 RKSLVDIXBGWPIS-UAKXSSHOSA-N 0.000 description 16
- 241001465754 Metazoa Species 0.000 description 16
- 239000000047 product Substances 0.000 description 16
- 230000000069 prophylactic effect Effects 0.000 description 16
- DWRXFEITVBNRMK-JXOAFFINSA-N ribothymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 DWRXFEITVBNRMK-JXOAFFINSA-N 0.000 description 16
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 15
- 238000003384 imaging method Methods 0.000 description 15
- 239000000843 powder Substances 0.000 description 15
- 239000003755 preservative agent Substances 0.000 description 15
- 239000000243 solution Substances 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- 238000013518 transcription Methods 0.000 description 15
- ZAYHVCMSTBRABG-UHFFFAOYSA-N 5-Methylcytidine Natural products O=C1N=C(N)C(C)=CN1C1C(O)C(O)C(CO)O1 ZAYHVCMSTBRABG-UHFFFAOYSA-N 0.000 description 14
- ZAYHVCMSTBRABG-JXOAFFINSA-N 5-methylcytidine Chemical compound O=C1N=C(N)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ZAYHVCMSTBRABG-JXOAFFINSA-N 0.000 description 14
- 230000002829 reductive effect Effects 0.000 description 14
- 150000003839 salts Chemical class 0.000 description 14
- 238000003786 synthesis reaction Methods 0.000 description 14
- 230000035897 transcription Effects 0.000 description 13
- 230000015572 biosynthetic process Effects 0.000 description 12
- 238000003501 co-culture Methods 0.000 description 12
- 229940079593 drug Drugs 0.000 description 11
- 235000019441 ethanol Nutrition 0.000 description 11
- 238000001727 in vivo Methods 0.000 description 11
- 239000002245 particle Substances 0.000 description 11
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 11
- QXDXBKZJFLRLCM-UAKXSSHOSA-N 5-hydroxyuridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(O)=C1 QXDXBKZJFLRLCM-UAKXSSHOSA-N 0.000 description 10
- 241000282412 Homo Species 0.000 description 10
- 229920002472 Starch Polymers 0.000 description 10
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 10
- 239000002253 acid Substances 0.000 description 10
- 125000000217 alkyl group Chemical group 0.000 description 10
- 230000002441 reversible effect Effects 0.000 description 10
- 235000019698 starch Nutrition 0.000 description 10
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 9
- 239000004615 ingredient Substances 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 210000001167 myeloblast Anatomy 0.000 description 9
- 239000003921 oil Substances 0.000 description 9
- 235000019198 oils Nutrition 0.000 description 9
- 238000002360 preparation method Methods 0.000 description 9
- 229940032147 starch Drugs 0.000 description 9
- 239000008107 starch Substances 0.000 description 9
- 239000000725 suspension Substances 0.000 description 9
- 238000013519 translation Methods 0.000 description 9
- 229940045145 uridine Drugs 0.000 description 9
- 239000003981 vehicle Substances 0.000 description 9
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 8
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 8
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 8
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 8
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 230000004952 protein activity Effects 0.000 description 8
- 238000003757 reverse transcription PCR Methods 0.000 description 8
- 102000012605 Cystic Fibrosis Transmembrane Conductance Regulator Human genes 0.000 description 7
- 108010079245 Cystic Fibrosis Transmembrane Conductance Regulator Proteins 0.000 description 7
- 238000008157 ELISA kit Methods 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 150000001413 amino acids Chemical group 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 230000015556 catabolic process Effects 0.000 description 7
- 238000006731 degradation reaction Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 230000035772 mutation Effects 0.000 description 7
- 239000000651 prodrug Substances 0.000 description 7
- 229940002612 prodrug Drugs 0.000 description 7
- 150000003230 pyrimidines Chemical class 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- LQQGJDJXUSAEMZ-UAKXSSHOSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-iodopyrimidin-2-one Chemical compound C1=C(I)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LQQGJDJXUSAEMZ-UAKXSSHOSA-N 0.000 description 6
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 6
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 6
- 102100026720 Interferon beta Human genes 0.000 description 6
- 108090000467 Interferon-beta Proteins 0.000 description 6
- 102000014150 Interferons Human genes 0.000 description 6
- 108010050904 Interferons Proteins 0.000 description 6
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 6
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 6
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 6
- 238000002835 absorbance Methods 0.000 description 6
- 235000010443 alginic acid Nutrition 0.000 description 6
- 229920000615 alginic acid Polymers 0.000 description 6
- 230000030833 cell death Effects 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 239000003995 emulsifying agent Substances 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 230000014759 maintenance of location Effects 0.000 description 6
- 238000004806 packaging method and process Methods 0.000 description 6
- 102000040430 polynucleotide Human genes 0.000 description 6
- 108091033319 polynucleotide Proteins 0.000 description 6
- 239000002157 polynucleotide Substances 0.000 description 6
- 239000003380 propellant Substances 0.000 description 6
- 125000006239 protecting group Chemical group 0.000 description 6
- 239000000376 reactant Substances 0.000 description 6
- 235000019333 sodium laurylsulphate Nutrition 0.000 description 6
- 239000007787 solid Substances 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 5
- 101800001779 2'-O-methyltransferase Proteins 0.000 description 5
- JRYMOPZHXMVHTA-DAGMQNCNSA-N 2-amino-7-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1h-pyrrolo[2,3-d]pyrimidin-4-one Chemical compound C1=CC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O JRYMOPZHXMVHTA-DAGMQNCNSA-N 0.000 description 5
- RHFUOMFWUGWKKO-XVFCMESISA-N 2-thiocytidine Chemical compound S=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RHFUOMFWUGWKKO-XVFCMESISA-N 0.000 description 5
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 5
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 5
- 102000008186 Collagen Human genes 0.000 description 5
- 108010035532 Collagen Proteins 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 5
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 5
- 229930010555 Inosine Natural products 0.000 description 5
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 5
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 5
- VQAYFKKCNSOZKM-IOSLPCCCSA-N N(6)-methyladenosine Chemical compound C1=NC=2C(NC)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VQAYFKKCNSOZKM-IOSLPCCCSA-N 0.000 description 5
- VQAYFKKCNSOZKM-UHFFFAOYSA-N NSC 29409 Natural products C1=NC=2C(NC)=NC=NC=2N1C1OC(CO)C(O)C1O VQAYFKKCNSOZKM-UHFFFAOYSA-N 0.000 description 5
- 206010028980 Neoplasm Diseases 0.000 description 5
- 229930006000 Sucrose Natural products 0.000 description 5
- 108091023040 Transcription factor Proteins 0.000 description 5
- 102000040945 Transcription factor Human genes 0.000 description 5
- 239000011543 agarose gel Substances 0.000 description 5
- 230000004071 biological effect Effects 0.000 description 5
- 238000009835 boiling Methods 0.000 description 5
- 239000006172 buffering agent Substances 0.000 description 5
- 229920001436 collagen Polymers 0.000 description 5
- 235000014113 dietary fatty acids Nutrition 0.000 description 5
- ZPTBLXKRQACLCR-XVFCMESISA-N dihydrouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)CC1 ZPTBLXKRQACLCR-XVFCMESISA-N 0.000 description 5
- 239000003085 diluting agent Substances 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 229960004756 ethanol Drugs 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 229930195729 fatty acid Natural products 0.000 description 5
- 239000000194 fatty acid Substances 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 210000005260 human cell Anatomy 0.000 description 5
- 229960003786 inosine Drugs 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 239000008101 lactose Substances 0.000 description 5
- 210000000265 leukocyte Anatomy 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 5
- 229920000642 polymer Polymers 0.000 description 5
- RHFUOMFWUGWKKO-UHFFFAOYSA-N s2C Natural products S=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 RHFUOMFWUGWKKO-UHFFFAOYSA-N 0.000 description 5
- 239000007858 starting material Substances 0.000 description 5
- 239000005720 sucrose Substances 0.000 description 5
- 239000013589 supplement Substances 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 238000011282 treatment Methods 0.000 description 5
- 239000001993 wax Substances 0.000 description 5
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 4
- GFYLSDSUCHVORB-IOSLPCCCSA-N 1-methyladenosine Chemical compound C1=NC=2C(=N)N(C)C=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O GFYLSDSUCHVORB-IOSLPCCCSA-N 0.000 description 4
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 4
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 4
- PEHVGBZKEYRQSX-UHFFFAOYSA-N 7-deaza-adenine Chemical compound NC1=NC=NC2=C1C=CN2 PEHVGBZKEYRQSX-UHFFFAOYSA-N 0.000 description 4
- HCGHYQLFMPXSDU-UHFFFAOYSA-N 7-methyladenine Chemical compound C1=NC(N)=C2N(C)C=NC2=N1 HCGHYQLFMPXSDU-UHFFFAOYSA-N 0.000 description 4
- HCAJQHYUCKICQH-VPENINKCSA-N 8-Oxo-7,8-dihydro-2'-deoxyguanosine Chemical compound C1=2NC(N)=NC(=O)C=2NC(=O)N1[C@H]1C[C@H](O)[C@@H](CO)O1 HCAJQHYUCKICQH-VPENINKCSA-N 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 4
- 201000003883 Cystic fibrosis Diseases 0.000 description 4
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 4
- 238000008214 LDL Cholesterol Methods 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 4
- 108091034057 RNA (poly(A)) Proteins 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- 229920002125 Sokalan® Polymers 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 230000001594 aberrant effect Effects 0.000 description 4
- 230000002378 acidificating effect Effects 0.000 description 4
- 239000000783 alginic acid Substances 0.000 description 4
- 229960001126 alginic acid Drugs 0.000 description 4
- 150000004781 alginic acids Chemical class 0.000 description 4
- 239000002585 base Substances 0.000 description 4
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 4
- 239000011230 binding agent Substances 0.000 description 4
- 229910000019 calcium carbonate Inorganic materials 0.000 description 4
- 229960003563 calcium carbonate Drugs 0.000 description 4
- 235000010216 calcium carbonate Nutrition 0.000 description 4
- 201000011510 cancer Diseases 0.000 description 4
- 239000006143 cell culture medium Substances 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 4
- 235000012000 cholesterol Nutrition 0.000 description 4
- 238000010511 deprotection reaction Methods 0.000 description 4
- 238000010575 fractional recrystallization Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 230000030279 gene silencing Effects 0.000 description 4
- 230000012010 growth Effects 0.000 description 4
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 229940079322 interferon Drugs 0.000 description 4
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 4
- 239000000314 lubricant Substances 0.000 description 4
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 4
- 229920000136 polysorbate Polymers 0.000 description 4
- 230000004224 protection Effects 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000006722 reduction reaction Methods 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- 239000004055 small Interfering RNA Substances 0.000 description 4
- 239000004094 surface-active agent Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 4
- BJEPYKJPYRNKOW-REOHCLBHSA-N (S)-malic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O BJEPYKJPYRNKOW-REOHCLBHSA-N 0.000 description 3
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 3
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 3
- UTAIYTHAJQNQDW-KQYNXXCUSA-N 1-methylguanosine Chemical compound C1=NC=2C(=O)N(C)C(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O UTAIYTHAJQNQDW-KQYNXXCUSA-N 0.000 description 3
- ZLOIGESWDJYCTF-UHFFFAOYSA-N 4-Thiouridine Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-UHFFFAOYSA-N 0.000 description 3
- ZLOIGESWDJYCTF-XVFCMESISA-N 4-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=S)C=C1 ZLOIGESWDJYCTF-XVFCMESISA-N 0.000 description 3
- OZQDLJNDRVBCST-SHUUEZRQSA-N 5-amino-2-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1,2,4-triazin-3-one Chemical compound O=C1N=C(N)C=NN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 OZQDLJNDRVBCST-SHUUEZRQSA-N 0.000 description 3
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 3
- MSSXOMSJDRHRMC-UHFFFAOYSA-N 9H-purine-2,6-diamine Chemical compound NC1=NC(N)=C2NC=NC2=N1 MSSXOMSJDRHRMC-UHFFFAOYSA-N 0.000 description 3
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 3
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 3
- 241000271566 Aves Species 0.000 description 3
- ABUSROAEXSJVQZ-UHFFFAOYSA-N BC1OC(CCP(=C)(C)CC)C(CP(=C)(C)CC)C1C Chemical compound BC1OC(CCP(=C)(C)CC)C(CP(=C)(C)CC)C1C ABUSROAEXSJVQZ-UHFFFAOYSA-N 0.000 description 3
- RQIYFFRSHDLGAY-UHFFFAOYSA-N BC1OC(CCP(=C)(CC)CC(C)(C)C)C(CP(=C)(CC)CC(C)(C)C)C1C Chemical compound BC1OC(CCP(=C)(CC)CC(C)(C)C)C(CP(=C)(CC)CC(C)(C)C)C1C RQIYFFRSHDLGAY-UHFFFAOYSA-N 0.000 description 3
- 241000282472 Canis lupus familiaris Species 0.000 description 3
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 3
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 241000282326 Felis catus Species 0.000 description 3
- 241000710198 Foot-and-mouth disease virus Species 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- 108010007622 LDL Lipoproteins Proteins 0.000 description 3
- 102000007330 LDL Lipoproteins Human genes 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 108060004795 Methyltransferase Proteins 0.000 description 3
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 3
- IERHLVCPSMICTF-UHFFFAOYSA-L NC1=NC(=O)N(C2OC(COP(=O)([O-])[O-])C(O)C2O)C=C1 Chemical compound NC1=NC(=O)N(C2OC(COP(=O)([O-])[O-])C(O)C2O)C=C1 IERHLVCPSMICTF-UHFFFAOYSA-L 0.000 description 3
- RQFCJASXJCIDSX-UHFFFAOYSA-L NC1=NC2=C(N=CN2C2OC(COP(=O)([O-])[O-])C(O)C2O)C(=O)N1 Chemical compound NC1=NC2=C(N=CN2C2OC(COP(=O)([O-])[O-])C(O)C2O)C(=O)N1 RQFCJASXJCIDSX-UHFFFAOYSA-L 0.000 description 3
- UDMBCSSLTHHNCD-UHFFFAOYSA-L NC1=NC=NC2=C1N=CN2C1OC(COP(=O)([O-])[O-])C(O)C1O Chemical compound NC1=NC=NC2=C1N=CN2C1OC(COP(=O)([O-])[O-])C(O)C1O UDMBCSSLTHHNCD-UHFFFAOYSA-L 0.000 description 3
- DJJCXFVJDGTHFX-UHFFFAOYSA-L O=C1C=CN(C2OC(COP(=O)([O-])[O-])C(O)C2O)C(=O)N1 Chemical compound O=C1C=CN(C2OC(COP(=O)([O-])[O-])C(O)C2O)C(=O)N1 DJJCXFVJDGTHFX-UHFFFAOYSA-L 0.000 description 3
- 108700026244 Open Reading Frames Proteins 0.000 description 3
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 3
- 108020004459 Small interfering RNA Proteins 0.000 description 3
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- VJHCJDRQFCCTHL-UHFFFAOYSA-N acetic acid 2,3,4,5,6-pentahydroxyhexanal Chemical compound CC(O)=O.OCC(O)C(O)C(O)C(O)C=O VJHCJDRQFCCTHL-UHFFFAOYSA-N 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 239000008272 agar Substances 0.000 description 3
- 229940023476 agar Drugs 0.000 description 3
- 235000010419 agar Nutrition 0.000 description 3
- 238000000246 agarose gel electrophoresis Methods 0.000 description 3
- BJEPYKJPYRNKOW-UHFFFAOYSA-N alpha-hydroxysuccinic acid Natural products OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 3
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 239000000440 bentonite Substances 0.000 description 3
- 229910000278 bentonite Inorganic materials 0.000 description 3
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 239000001768 carboxy methyl cellulose Substances 0.000 description 3
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 3
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 3
- 229940105329 carboxymethylcellulose Drugs 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 238000001516 cell proliferation assay Methods 0.000 description 3
- 230000003833 cell viability Effects 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 235000019868 cocoa butter Nutrition 0.000 description 3
- 229940110456 cocoa butter Drugs 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 229940099112 cornstarch Drugs 0.000 description 3
- 239000006071 cream Substances 0.000 description 3
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 3
- 231100000135 cytotoxicity Toxicity 0.000 description 3
- 230000002939 deleterious effect Effects 0.000 description 3
- 210000004207 dermis Anatomy 0.000 description 3
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 3
- 239000002270 dispersing agent Substances 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 235000011187 glycerol Nutrition 0.000 description 3
- BXWNKGSJHAJOGX-UHFFFAOYSA-N hexadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCO BXWNKGSJHAJOGX-UHFFFAOYSA-N 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 239000003701 inert diluent Substances 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 239000000543 intermediate Substances 0.000 description 3
- 230000004807 localization Effects 0.000 description 3
- 239000006210 lotion Substances 0.000 description 3
- 239000001630 malic acid Substances 0.000 description 3
- 235000011090 malic acid Nutrition 0.000 description 3
- 229940099690 malic acid Drugs 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 229920000609 methyl cellulose Polymers 0.000 description 3
- 238000007069 methylation reaction Methods 0.000 description 3
- 239000001923 methylcellulose Substances 0.000 description 3
- 235000010981 methylcellulose Nutrition 0.000 description 3
- 108091070501 miRNA Proteins 0.000 description 3
- 239000002679 microRNA Substances 0.000 description 3
- 231100000252 nontoxic Toxicity 0.000 description 3
- 230000003000 nontoxic effect Effects 0.000 description 3
- 239000002674 ointment Substances 0.000 description 3
- 150000007524 organic acids Chemical class 0.000 description 3
- 239000006187 pill Substances 0.000 description 3
- 239000008389 polyethoxylated castor oil Substances 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000002685 pulmonary effect Effects 0.000 description 3
- 150000003212 purines Chemical class 0.000 description 3
- 229910000029 sodium carbonate Inorganic materials 0.000 description 3
- 235000017550 sodium carbonate Nutrition 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000007909 solid dosage form Substances 0.000 description 3
- 239000008247 solid mixture Substances 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 235000002906 tartaric acid Nutrition 0.000 description 3
- 239000011975 tartaric acid Substances 0.000 description 3
- 229960001367 tartaric acid Drugs 0.000 description 3
- 238000011200 topical administration Methods 0.000 description 3
- 230000000699 topical effect Effects 0.000 description 3
- HDZZVAMISRMYHH-KCGFPETGSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O HDZZVAMISRMYHH-KCGFPETGSA-N 0.000 description 3
- 108010027510 vaccinia virus capping enzyme Proteins 0.000 description 3
- 239000013598 vector Substances 0.000 description 3
- 239000000080 wetting agent Substances 0.000 description 3
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 3
- QBYIENPQHBMVBV-HFEGYEGKSA-N (2R)-2-hydroxy-2-phenylacetic acid Chemical compound O[C@@H](C(O)=O)c1ccccc1.O[C@@H](C(O)=O)c1ccccc1 QBYIENPQHBMVBV-HFEGYEGKSA-N 0.000 description 2
- YZSZLBRBVWAXFW-LNYQSQCFSA-N (2R,3R,4S,5R)-2-(2-amino-6-hydroxy-6-methoxy-3H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound COC1(O)NC(N)=NC2=C1N=CN2[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O YZSZLBRBVWAXFW-LNYQSQCFSA-N 0.000 description 2
- DNISEZBAYYIQFB-PHDIDXHHSA-N (2r,3r)-2,3-diacetyloxybutanedioic acid Chemical compound CC(=O)O[C@@H](C(O)=O)[C@H](C(O)=O)OC(C)=O DNISEZBAYYIQFB-PHDIDXHHSA-N 0.000 description 2
- IXOXBSCIXZEQEQ-KQYNXXCUSA-N (2r,3r,4s,5r)-2-(2-amino-6-methoxypurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound C1=NC=2C(OC)=NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O IXOXBSCIXZEQEQ-KQYNXXCUSA-N 0.000 description 2
- KYJLJOJCMUFWDY-UUOKFMHZSA-N (2r,3r,4s,5r)-2-(6-amino-8-azidopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol Chemical compound [N-]=[N+]=NC1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O KYJLJOJCMUFWDY-UUOKFMHZSA-N 0.000 description 2
- MYUOTPIQBPUQQU-CKTDUXNWSA-N (2s,3r)-2-amino-n-[[9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-methylsulfanylpurin-6-yl]carbamoyl]-3-hydroxybutanamide Chemical compound C12=NC(SC)=NC(NC(=O)NC(=O)[C@@H](N)[C@@H](C)O)=C2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O MYUOTPIQBPUQQU-CKTDUXNWSA-N 0.000 description 2
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 2
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 description 2
- OYTVCAGSWWRUII-DWJKKKFUSA-N 1-Methyl-1-deazapseudouridine Chemical compound CC1C=C(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O OYTVCAGSWWRUII-DWJKKKFUSA-N 0.000 description 2
- MIXBUOXRHTZHKR-XUTVFYLZSA-N 1-Methylpseudoisocytidine Chemical compound CN1C=C(C(=O)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O MIXBUOXRHTZHKR-XUTVFYLZSA-N 0.000 description 2
- KYEKLQMDNZPEFU-KVTDHHQDSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1,3,5-triazine-2,4-dione Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)N=C1 KYEKLQMDNZPEFU-KVTDHHQDSA-N 0.000 description 2
- UTQUILVPBZEHTK-ZOQUXTDFSA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3-methylpyrimidine-2,4-dione Chemical compound O=C1N(C)C(=O)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 UTQUILVPBZEHTK-ZOQUXTDFSA-N 0.000 description 2
- QLOCVMVCRJOTTM-TURQNECASA-N 1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-prop-1-ynylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)C(C#CC)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 QLOCVMVCRJOTTM-TURQNECASA-N 0.000 description 2
- GUNOEKASBVILNS-UHFFFAOYSA-N 1-methyl-1-deaza-pseudoisocytidine Chemical compound CC(C=C1C(C2O)OC(CO)C2O)=C(N)NC1=O GUNOEKASBVILNS-UHFFFAOYSA-N 0.000 description 2
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 2
- WJNGQIYEQLPJMN-IOSLPCCCSA-N 1-methylinosine Chemical compound C1=NC=2C(=O)N(C)C=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WJNGQIYEQLPJMN-IOSLPCCCSA-N 0.000 description 2
- UVBYMVOUBXYSFV-UHFFFAOYSA-N 1-methylpseudouridine Natural products O=C1NC(=O)N(C)C=C1C1C(O)C(O)C(CO)O1 UVBYMVOUBXYSFV-UHFFFAOYSA-N 0.000 description 2
- UZYQSNQJLWTICD-UHFFFAOYSA-N 2-(n-benzoylanilino)-2,2-dinitroacetic acid Chemical compound C=1C=CC=CC=1N(C(C(=O)O)([N+]([O-])=O)[N+]([O-])=O)C(=O)C1=CC=CC=C1 UZYQSNQJLWTICD-UHFFFAOYSA-N 0.000 description 2
- JCNGYIGHEUKAHK-DWJKKKFUSA-N 2-Thio-1-methyl-1-deazapseudouridine Chemical compound CC1C=C(C(=O)NC1=S)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O JCNGYIGHEUKAHK-DWJKKKFUSA-N 0.000 description 2
- BVLGKOVALHRKNM-XUTVFYLZSA-N 2-Thio-1-methylpseudouridine Chemical compound CN1C=C(C(=O)NC1=S)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O BVLGKOVALHRKNM-XUTVFYLZSA-N 0.000 description 2
- CWXIOHYALLRNSZ-JWMKEVCDSA-N 2-Thiodihydropseudouridine Chemical compound C1C(C(=O)NC(=S)N1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O CWXIOHYALLRNSZ-JWMKEVCDSA-N 0.000 description 2
- NUBJGTNGKODGGX-YYNOVJQHSA-N 2-[5-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2,4-dioxopyrimidin-1-yl]acetic acid Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CN(CC(O)=O)C(=O)NC1=O NUBJGTNGKODGGX-YYNOVJQHSA-N 0.000 description 2
- VJKJOPUEUOTEBX-TURQNECASA-N 2-[[1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2,4-dioxopyrimidin-5-yl]methylamino]ethanesulfonic acid Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(CNCCS(O)(=O)=O)=C1 VJKJOPUEUOTEBX-TURQNECASA-N 0.000 description 2
- LCKIHCRZXREOJU-KYXWUPHJSA-N 2-[[5-[(2S,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2,4-dioxopyrimidin-1-yl]methylamino]ethanesulfonic acid Chemical compound C(NCCS(=O)(=O)O)N1C=C([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C(NC1=O)=O LCKIHCRZXREOJU-KYXWUPHJSA-N 0.000 description 2
- OTDJAMXESTUWLO-UUOKFMHZSA-N 2-amino-9-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)-2-oxolanyl]-3H-purine-6-thione Chemical compound C12=NC(N)=NC(S)=C2N=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OTDJAMXESTUWLO-UUOKFMHZSA-N 0.000 description 2
- IBKZHHCJWDWGAJ-FJGDRVTGSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1-methylpurine-6-thione Chemical compound C1=NC=2C(=S)N(C)C(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O IBKZHHCJWDWGAJ-FJGDRVTGSA-N 0.000 description 2
- HPKQEMIXSLRGJU-UUOKFMHZSA-N 2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-7-methyl-3h-purine-6,8-dione Chemical compound O=C1N(C)C(C(NC(N)=N2)=O)=C2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O HPKQEMIXSLRGJU-UUOKFMHZSA-N 0.000 description 2
- PBFLIOAJBULBHI-JJNLEZRASA-N 2-amino-n-[[9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]purin-6-yl]carbamoyl]acetamide Chemical compound C1=NC=2C(NC(=O)NC(=O)CN)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O PBFLIOAJBULBHI-JJNLEZRASA-N 0.000 description 2
- MWBWWFOAEOYUST-UHFFFAOYSA-N 2-aminopurine Chemical compound NC1=NC=C2N=CNC2=N1 MWBWWFOAEOYUST-UHFFFAOYSA-N 0.000 description 2
- KMGUEILFFWDGFV-UHFFFAOYSA-N 2-benzoyl-2-benzoyloxy-3-hydroxybutanedioic acid Chemical compound C=1C=CC=CC=1C(=O)C(C(C(O)=O)O)(C(O)=O)OC(=O)C1=CC=CC=C1 KMGUEILFFWDGFV-UHFFFAOYSA-N 0.000 description 2
- RLZMYTZDQAVNIN-ZOQUXTDFSA-N 2-methoxy-4-thio-uridine Chemical compound COC1=NC(=S)C=CN1[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O RLZMYTZDQAVNIN-ZOQUXTDFSA-N 0.000 description 2
- QCPQCJVQJKOKMS-VLSMUFELSA-N 2-methoxy-5-methyl-cytidine Chemical compound CC(C(N)=N1)=CN([C@@H]([C@@H]2O)O[C@H](CO)[C@H]2O)C1OC QCPQCJVQJKOKMS-VLSMUFELSA-N 0.000 description 2
- TUDKBZAMOFJOSO-UHFFFAOYSA-N 2-methoxy-7h-purin-6-amine Chemical compound COC1=NC(N)=C2NC=NC2=N1 TUDKBZAMOFJOSO-UHFFFAOYSA-N 0.000 description 2
- STISOQJGVFEOFJ-MEVVYUPBSA-N 2-methoxy-cytidine Chemical compound COC(N([C@@H]([C@@H]1O)O[C@H](CO)[C@H]1O)C=C1)N=C1N STISOQJGVFEOFJ-MEVVYUPBSA-N 0.000 description 2
- WBVPJIKOWUQTSD-ZOQUXTDFSA-N 2-methoxyuridine Chemical compound COC1=NC(=O)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 WBVPJIKOWUQTSD-ZOQUXTDFSA-N 0.000 description 2
- FXGXEFXCWDTSQK-UHFFFAOYSA-N 2-methylsulfanyl-7h-purin-6-amine Chemical compound CSC1=NC(N)=C2NC=NC2=N1 FXGXEFXCWDTSQK-UHFFFAOYSA-N 0.000 description 2
- QEWSGVMSLPHELX-UHFFFAOYSA-N 2-methylthio-N6-(cis-hydroxyisopentenyl) adenosine Chemical compound C12=NC(SC)=NC(NCC=C(C)CO)=C2N=CN1C1OC(CO)C(O)C1O QEWSGVMSLPHELX-UHFFFAOYSA-N 0.000 description 2
- JUMHLCXWYQVTLL-KVTDHHQDSA-N 2-thio-5-aza-uridine Chemical compound [C@@H]1([C@H](O)[C@H](O)[C@@H](CO)O1)N1C(=S)NC(=O)N=C1 JUMHLCXWYQVTLL-KVTDHHQDSA-N 0.000 description 2
- VRVXMIJPUBNPGH-XVFCMESISA-N 2-thio-dihydrouridine Chemical compound OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)N1CCC(=O)NC1=S VRVXMIJPUBNPGH-XVFCMESISA-N 0.000 description 2
- ZVGONGHIVBJXFC-WCTZXXKLSA-N 2-thio-zebularine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)N=CC=C1 ZVGONGHIVBJXFC-WCTZXXKLSA-N 0.000 description 2
- GJTBSTBJLVYKAU-XVFCMESISA-N 2-thiouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)NC(=O)C=C1 GJTBSTBJLVYKAU-XVFCMESISA-N 0.000 description 2
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 description 2
- 108020005345 3' Untranslated Regions Proteins 0.000 description 2
- RDPUKVRQKWBSPK-UHFFFAOYSA-N 3-Methylcytidine Natural products O=C1N(C)C(=N)C=CN1C1C(O)C(O)C(CO)O1 RDPUKVRQKWBSPK-UHFFFAOYSA-N 0.000 description 2
- UTQUILVPBZEHTK-UHFFFAOYSA-N 3-Methyluridine Natural products O=C1N(C)C(=O)C=CN1C1C(O)C(O)C(CO)O1 UTQUILVPBZEHTK-UHFFFAOYSA-N 0.000 description 2
- GCNYJWODKQPZDE-TURQNECASA-N 3-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-6-methyl-7h-pyrrolo[2,3-d]pyrimidin-2-one Chemical compound O=C1NC2=NC(C)=CC2=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O GCNYJWODKQPZDE-TURQNECASA-N 0.000 description 2
- RDPUKVRQKWBSPK-ZOQUXTDFSA-N 3-methylcytidine Chemical compound O=C1N(C)C(=N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RDPUKVRQKWBSPK-ZOQUXTDFSA-N 0.000 description 2
- ZSIINYPBPQCZKU-BQNZPOLKSA-O 4-Methoxy-1-methylpseudoisocytidine Chemical compound C[N+](CC1[C@H]([C@H]2O)O[C@@H](CO)[C@@H]2O)=C(N)N=C1OC ZSIINYPBPQCZKU-BQNZPOLKSA-O 0.000 description 2
- FGFVODMBKZRMMW-XUTVFYLZSA-N 4-Methoxy-2-thiopseudouridine Chemical compound COC1=C(C=NC(=S)N1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O FGFVODMBKZRMMW-XUTVFYLZSA-N 0.000 description 2
- HOCJTJWYMOSXMU-XUTVFYLZSA-N 4-Methoxypseudouridine Chemical compound COC1=C(C=NC(=O)N1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O HOCJTJWYMOSXMU-XUTVFYLZSA-N 0.000 description 2
- VTGBLFNEDHVUQA-XUTVFYLZSA-N 4-Thio-1-methyl-pseudouridine Chemical compound S=C1NC(=O)N(C)C=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 VTGBLFNEDHVUQA-XUTVFYLZSA-N 0.000 description 2
- DMUQOPXCCOBPID-XUTVFYLZSA-N 4-Thio-1-methylpseudoisocytidine Chemical compound CN1C=C(C(=S)N=C1N)[C@H]2[C@@H]([C@@H]([C@H](O2)CO)O)O DMUQOPXCCOBPID-XUTVFYLZSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- OCMSXKMNYAHJMU-JXOAFFINSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-oxopyrimidine-5-carbaldehyde Chemical compound C1=C(C=O)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 OCMSXKMNYAHJMU-JXOAFFINSA-N 0.000 description 2
- OZHIJZYBTCTDQC-JXOAFFINSA-N 4-amino-1-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidine-2-thione Chemical compound S=C1N=C(N)C(C)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 OZHIJZYBTCTDQC-JXOAFFINSA-N 0.000 description 2
- CFKMVGJGLGKFKI-UHFFFAOYSA-N 4-chloro-m-cresol Chemical compound CC1=CC(O)=CC=C1Cl CFKMVGJGLGKFKI-UHFFFAOYSA-N 0.000 description 2
- HIQIXEFWDLTDED-UHFFFAOYSA-N 4-hydroxy-1-piperidin-4-ylpyrrolidin-2-one Chemical compound O=C1CC(O)CN1C1CCNCC1 HIQIXEFWDLTDED-UHFFFAOYSA-N 0.000 description 2
- GCNTZFIIOFTKIY-UHFFFAOYSA-N 4-hydroxypyridine Chemical compound OC1=CC=NC=C1 GCNTZFIIOFTKIY-UHFFFAOYSA-N 0.000 description 2
- LOICBOXHPCURMU-UHFFFAOYSA-N 4-methoxy-pseudoisocytidine Chemical compound COC1NC(N)=NC=C1C(C1O)OC(CO)C1O LOICBOXHPCURMU-UHFFFAOYSA-N 0.000 description 2
- FIWQPTRUVGSKOD-UHFFFAOYSA-N 4-thio-1-methyl-1-deaza-pseudoisocytidine Chemical compound CC(C=C1C(C2O)OC(CO)C2O)=C(N)NC1=S FIWQPTRUVGSKOD-UHFFFAOYSA-N 0.000 description 2
- SJVVKUMXGIKAAI-UHFFFAOYSA-N 4-thio-pseudoisocytidine Chemical compound NC(N1)=NC=C(C(C2O)OC(CO)C2O)C1=S SJVVKUMXGIKAAI-UHFFFAOYSA-N 0.000 description 2
- NSPMIYGKQJPBQR-UHFFFAOYSA-N 4H-1,2,4-triazole Chemical compound C=1N=CNN=1 NSPMIYGKQJPBQR-UHFFFAOYSA-N 0.000 description 2
- FAWQJBLSWXIJLA-VPCXQMTMSA-N 5-(carboxymethyl)uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(CC(O)=O)=C1 FAWQJBLSWXIJLA-VPCXQMTMSA-N 0.000 description 2
- NMUSYJAQQFHJEW-UHFFFAOYSA-N 5-Azacytidine Natural products O=C1N=C(N)N=CN1C1C(O)C(O)C(CO)O1 NMUSYJAQQFHJEW-UHFFFAOYSA-N 0.000 description 2
- NFEXJLMYXXIWPI-JXOAFFINSA-N 5-Hydroxymethylcytidine Chemical compound C1=C(CO)C(N)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NFEXJLMYXXIWPI-JXOAFFINSA-N 0.000 description 2
- ITGWEVGJUSMCEA-KYXWUPHJSA-N 5-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-1-prop-1-ynylpyrimidine-2,4-dione Chemical compound O=C1NC(=O)N(C#CC)C=C1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 ITGWEVGJUSMCEA-KYXWUPHJSA-N 0.000 description 2
- DDHOXEOVAJVODV-GBNDHIKLSA-N 5-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-sulfanylidene-1h-pyrimidin-4-one Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=S)NC1=O DDHOXEOVAJVODV-GBNDHIKLSA-N 0.000 description 2
- BNAWMJKJLNJZFU-GBNDHIKLSA-N 5-[(2s,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-4-sulfanylidene-1h-pyrimidin-2-one Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1=CNC(=O)NC1=S BNAWMJKJLNJZFU-GBNDHIKLSA-N 0.000 description 2
- XUNBIDXYAUXNKD-DBRKOABJSA-N 5-aza-2-thio-zebularine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=S)N=CN=C1 XUNBIDXYAUXNKD-DBRKOABJSA-N 0.000 description 2
- OSLBPVOJTCDNEF-DBRKOABJSA-N 5-aza-zebularine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)N=CN=C1 OSLBPVOJTCDNEF-DBRKOABJSA-N 0.000 description 2
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 2
- RPQQZHJQUBDHHG-FNCVBFRFSA-N 5-methyl-zebularine Chemical compound C1=C(C)C=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 RPQQZHJQUBDHHG-FNCVBFRFSA-N 0.000 description 2
- USVMJSALORZVDV-UHFFFAOYSA-N 6-(gamma,gamma-dimethylallylamino)purine riboside Natural products C1=NC=2C(NCC=C(C)C)=NC=NC=2N1C1OC(CO)C(O)C1O USVMJSALORZVDV-UHFFFAOYSA-N 0.000 description 2
- ZKBQDFAWXLTYKS-UHFFFAOYSA-N 6-Chloro-1H-purine Chemical compound ClC1=NC=NC2=C1NC=N2 ZKBQDFAWXLTYKS-UHFFFAOYSA-N 0.000 description 2
- OZTOEARQSSIFOG-MWKIOEHESA-N 6-Thio-7-deaza-8-azaguanosine Chemical compound Nc1nc(=S)c2cnn([C@@H]3O[C@H](CO)[C@@H](O)[C@H]3O)c2[nH]1 OZTOEARQSSIFOG-MWKIOEHESA-N 0.000 description 2
- RYYIULNRIVUMTQ-UHFFFAOYSA-N 6-chloroguanine Chemical compound NC1=NC(Cl)=C2N=CNC2=N1 RYYIULNRIVUMTQ-UHFFFAOYSA-N 0.000 description 2
- CBNRZZNSRJQZNT-IOSLPCCCSA-O 6-thio-7-deaza-guanosine Chemical compound CC1=C[NH+]([C@@H]([C@@H]2O)O[C@H](CO)[C@H]2O)C(NC(N)=N2)=C1C2=S CBNRZZNSRJQZNT-IOSLPCCCSA-O 0.000 description 2
- RFHIWBUKNJIBSE-KQYNXXCUSA-O 6-thio-7-methyl-guanosine Chemical compound C1=2NC(N)=NC(=S)C=2N(C)C=[N+]1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O RFHIWBUKNJIBSE-KQYNXXCUSA-O 0.000 description 2
- MJJUWOIBPREHRU-MWKIOEHESA-N 7-Deaza-8-azaguanosine Chemical compound NC=1NC(C2=C(N=1)N(N=C2)[C@H]1[C@H](O)[C@H](O)[C@H](O1)CO)=O MJJUWOIBPREHRU-MWKIOEHESA-N 0.000 description 2
- ISSMDAFGDCTNDV-UHFFFAOYSA-N 7-deaza-2,6-diaminopurine Chemical compound NC1=NC(N)=C2NC=CC2=N1 ISSMDAFGDCTNDV-UHFFFAOYSA-N 0.000 description 2
- YVVMIGRXQRPSIY-UHFFFAOYSA-N 7-deaza-2-aminopurine Chemical compound N1C(N)=NC=C2C=CN=C21 YVVMIGRXQRPSIY-UHFFFAOYSA-N 0.000 description 2
- ZTAWTRPFJHKMRU-UHFFFAOYSA-N 7-deaza-8-aza-2,6-diaminopurine Chemical compound NC1=NC(N)=C2NN=CC2=N1 ZTAWTRPFJHKMRU-UHFFFAOYSA-N 0.000 description 2
- SMXRCJBCWRHDJE-UHFFFAOYSA-N 7-deaza-8-aza-2-aminopurine Chemical compound NC1=NC=C2C=NNC2=N1 SMXRCJBCWRHDJE-UHFFFAOYSA-N 0.000 description 2
- LHCPRYRLDOSKHK-UHFFFAOYSA-N 7-deaza-8-aza-adenine Chemical compound NC1=NC=NC2=C1C=NN2 LHCPRYRLDOSKHK-UHFFFAOYSA-N 0.000 description 2
- OGHAROSJZRTIOK-KQYNXXCUSA-O 7-methylguanosine Chemical compound C1=2N=C(N)NC(=O)C=2[N+](C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OGHAROSJZRTIOK-KQYNXXCUSA-O 0.000 description 2
- VJNXUFOTKNTNPG-IOSLPCCCSA-O 7-methylinosine Chemical compound C1=2NC=NC(=O)C=2N(C)C=[N+]1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VJNXUFOTKNTNPG-IOSLPCCCSA-O 0.000 description 2
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 description 2
- ABXGJJVKZAAEDH-IOSLPCCCSA-N 9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-(dimethylamino)-3h-purine-6-thione Chemical compound C1=NC=2C(=S)NC(N(C)C)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O ABXGJJVKZAAEDH-IOSLPCCCSA-N 0.000 description 2
- ADPMAYFIIFNDMT-KQYNXXCUSA-N 9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-(methylamino)-3h-purine-6-thione Chemical compound C1=NC=2C(=S)NC(NC)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O ADPMAYFIIFNDMT-KQYNXXCUSA-N 0.000 description 2
- 244000215068 Acacia senegal Species 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- 239000005995 Aluminium silicate Substances 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- 241000272517 Anseriformes Species 0.000 description 2
- 244000105624 Arachis hypogaea Species 0.000 description 2
- 235000010777 Arachis hypogaea Nutrition 0.000 description 2
- DHBWSKYJHXMJCV-UHFFFAOYSA-N BC1OC(CCP(=C)(CC)CP(=C)(CC)CP(=C)(C)CC)C(C)C1C Chemical compound BC1OC(CCP(=C)(CC)CP(=C)(CC)CP(=C)(C)CC)C(C)C1C DHBWSKYJHXMJCV-UHFFFAOYSA-N 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 235000004977 Brassica sinapistrum Nutrition 0.000 description 2
- QFOHBWFCKVYLES-UHFFFAOYSA-N Butylparaben Chemical compound CCCCOC(=O)C1=CC=C(O)C=C1 QFOHBWFCKVYLES-UHFFFAOYSA-N 0.000 description 2
- WEYFJAKXBYPFPO-UHFFFAOYSA-N C=P(C)(CCC1OC(C)C(O)C1CP(=C)(C)CC(C)(C)C)CC(C)(C)C Chemical compound C=P(C)(CCC1OC(C)C(O)C1CP(=C)(C)CC(C)(C)C)CC(C)(C)C WEYFJAKXBYPFPO-UHFFFAOYSA-N 0.000 description 2
- 101710167800 Capsid assembly scaffolding protein Proteins 0.000 description 2
- 241000710777 Classical swine fever virus Species 0.000 description 2
- 241000710127 Cricket paralysis virus Species 0.000 description 2
- 229920002785 Croscarmellose sodium Polymers 0.000 description 2
- 235000019739 Dicalciumphosphate Nutrition 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- YKWUPFSEFXSGRT-JWMKEVCDSA-N Dihydropseudouridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1C1C(=O)NC(=O)NC1 YKWUPFSEFXSGRT-JWMKEVCDSA-N 0.000 description 2
- 108010016626 Dipeptides Proteins 0.000 description 2
- 241000710188 Encephalomyocarditis virus Species 0.000 description 2
- 241000991587 Enterovirus C Species 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- GLZPCOQZEFWAFX-UHFFFAOYSA-N Geraniol Chemical compound CC(C)=CCCC(C)=CCO GLZPCOQZEFWAFX-UHFFFAOYSA-N 0.000 description 2
- 241000711557 Hepacivirus Species 0.000 description 2
- 239000004705 High-molecular-weight polyethylene Substances 0.000 description 2
- 101001054334 Homo sapiens Interferon beta Proteins 0.000 description 2
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 2
- 208000031226 Hyperlipidaemia Diseases 0.000 description 2
- 238000004566 IR spectroscopy Methods 0.000 description 2
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 2
- 240000003183 Manihot esculenta Species 0.000 description 2
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 2
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- RSPURTUNRHNVGF-IOSLPCCCSA-N N(2),N(2)-dimethylguanosine Chemical compound C1=NC=2C(=O)NC(N(C)C)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O RSPURTUNRHNVGF-IOSLPCCCSA-N 0.000 description 2
- SLEHROROQDYRAW-KQYNXXCUSA-N N(2)-methylguanosine Chemical compound C1=NC=2C(=O)NC(NC)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O SLEHROROQDYRAW-KQYNXXCUSA-N 0.000 description 2
- NIDVTARKFBZMOT-PEBGCTIMSA-N N(4)-acetylcytidine Chemical compound O=C1N=C(NC(=O)C)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NIDVTARKFBZMOT-PEBGCTIMSA-N 0.000 description 2
- WVGPGNPCZPYCLK-WOUKDFQISA-N N(6),N(6)-dimethyladenosine Chemical compound C1=NC=2C(N(C)C)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O WVGPGNPCZPYCLK-WOUKDFQISA-N 0.000 description 2
- USVMJSALORZVDV-SDBHATRESA-N N(6)-(Delta(2)-isopentenyl)adenosine Chemical compound C1=NC=2C(NCC=C(C)C)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O USVMJSALORZVDV-SDBHATRESA-N 0.000 description 2
- WVGPGNPCZPYCLK-UHFFFAOYSA-N N-Dimethyladenosine Natural products C1=NC=2C(N(C)C)=NC=NC=2N1C1OC(CO)C(O)C1O WVGPGNPCZPYCLK-UHFFFAOYSA-N 0.000 description 2
- UNUYMBPXEFMLNW-DWVDDHQFSA-N N-[(9-beta-D-ribofuranosylpurin-6-yl)carbamoyl]threonine Chemical compound C1=NC=2C(NC(=O)N[C@@H]([C@H](O)C)C(O)=O)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O UNUYMBPXEFMLNW-DWVDDHQFSA-N 0.000 description 2
- LZCNWAXLJWBRJE-ZOQUXTDFSA-N N4-Methylcytidine Chemical compound O=C1N=C(NC)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 LZCNWAXLJWBRJE-ZOQUXTDFSA-N 0.000 description 2
- GOSWTRUMMSCNCW-UHFFFAOYSA-N N6-(cis-hydroxyisopentenyl)adenosine Chemical compound C1=NC=2C(NCC=C(CO)C)=NC=NC=2N1C1OC(CO)C(O)C1O GOSWTRUMMSCNCW-UHFFFAOYSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- XMIFBEZRFMTGRL-TURQNECASA-N OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cc(CNCCS(O)(=O)=O)c(=O)[nH]c1=S Chemical compound OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cc(CNCCS(O)(=O)=O)c(=O)[nH]c1=S XMIFBEZRFMTGRL-TURQNECASA-N 0.000 description 2
- 240000007817 Olea europaea Species 0.000 description 2
- 239000005642 Oleic acid Substances 0.000 description 2
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 108091007412 Piwi-interacting RNA Proteins 0.000 description 2
- 101710124239 Poly(A) polymerase Proteins 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 101710130420 Probable capsid assembly scaffolding protein Proteins 0.000 description 2
- ZTHYODDOHIVTJV-UHFFFAOYSA-N Propyl gallate Chemical compound CCCOC(=O)C1=CC(O)=C(O)C(O)=C1 ZTHYODDOHIVTJV-UHFFFAOYSA-N 0.000 description 2
- IWYDHOAUDWTVEP-UHFFFAOYSA-N R-2-phenyl-2-hydroxyacetic acid Natural products OC(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-N 0.000 description 2
- 108091030071 RNAI Proteins 0.000 description 2
- 235000004443 Ricinus communis Nutrition 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 101710204410 Scaffold protein Proteins 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 108020003224 Small Nucleolar RNA Proteins 0.000 description 2
- 102000042773 Small Nucleolar RNA Human genes 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 2
- 102100032889 Sortilin Human genes 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 108020004566 Transfer RNA Proteins 0.000 description 2
- 239000007984 Tris EDTA buffer Substances 0.000 description 2
- 108091023045 Untranslated Region Proteins 0.000 description 2
- 108010062497 VLDL Lipoproteins Proteins 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- JCZSFCLRSONYLH-UHFFFAOYSA-N Wyosine Natural products N=1C(C)=CN(C(C=2N=C3)=O)C=1N(C)C=2N3C1OC(CO)C(O)C1O JCZSFCLRSONYLH-UHFFFAOYSA-N 0.000 description 2
- 240000008042 Zea mays Species 0.000 description 2
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 2
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 2
- FHHZHGZBHYYWTG-INFSMZHSSA-N [(2r,3s,4r,5r)-5-(2-amino-7-methyl-6-oxo-3h-purin-9-ium-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl [[[(2r,3s,4r,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl] phosphate Chemical compound N1C(N)=NC(=O)C2=C1[N+]([C@H]1[C@@H]([C@H](O)[C@@H](COP([O-])(=O)OP(O)(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](O)[C@@H](O3)N3C4=C(C(N=C(N)N4)=O)N=C3)O)O1)O)=CN2C FHHZHGZBHYYWTG-INFSMZHSSA-N 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 150000003838 adenosines Chemical class 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 125000003545 alkoxy group Chemical group 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 2
- 235000012211 aluminium silicate Nutrition 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000000843 anti-fungal effect Effects 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 229940121375 antifungal agent Drugs 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 235000006708 antioxidants Nutrition 0.000 description 2
- 229940027983 antiseptic and disinfectant quaternary ammonium compound Drugs 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 229960005070 ascorbic acid Drugs 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 229960002756 azacitidine Drugs 0.000 description 2
- 229960000686 benzalkonium chloride Drugs 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 2
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 235000019437 butane-1,3-diol Nutrition 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 2
- CJZGTCYPCWQAJB-UHFFFAOYSA-L calcium stearate Chemical compound [Ca+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O CJZGTCYPCWQAJB-UHFFFAOYSA-L 0.000 description 2
- 235000013539 calcium stearate Nutrition 0.000 description 2
- 239000008116 calcium stearate Substances 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical class C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 239000004359 castor oil Substances 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229960002798 cetrimide Drugs 0.000 description 2
- 229960000541 cetyl alcohol Drugs 0.000 description 2
- 229960001927 cetylpyridinium chloride Drugs 0.000 description 2
- NFCRBQADEGXVDL-UHFFFAOYSA-M cetylpyridinium chloride monohydrate Chemical compound O.[Cl-].CCCCCCCCCCCCCCCC[N+]1=CC=CC=C1 NFCRBQADEGXVDL-UHFFFAOYSA-M 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- 229960004926 chlorobutanol Drugs 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 239000000470 constituent Substances 0.000 description 2
- 235000005822 corn Nutrition 0.000 description 2
- 239000001767 crosslinked sodium carboxy methyl cellulose Substances 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000003013 cytotoxicity Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 239000000032 diagnostic agent Substances 0.000 description 2
- NEFBYIFKOOEVPA-UHFFFAOYSA-K dicalcium phosphate Chemical compound [Ca+2].[Ca+2].[O-]P([O-])([O-])=O NEFBYIFKOOEVPA-UHFFFAOYSA-K 0.000 description 2
- 235000019700 dicalcium phosphate Nutrition 0.000 description 2
- 229910000390 dicalcium phosphate Inorganic materials 0.000 description 2
- 229940038472 dicalcium phosphate Drugs 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- SMVRDGHCVNAOIN-UHFFFAOYSA-L disodium;1-dodecoxydodecane;sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O.CCCCCCCCCCCCOCCCCCCCCCCCC SMVRDGHCVNAOIN-UHFFFAOYSA-L 0.000 description 2
- 239000006196 drop Substances 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 229960001484 edetic acid Drugs 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000012156 elution solvent Substances 0.000 description 2
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 2
- MMXKVMNBHPAILY-UHFFFAOYSA-N ethyl laurate Chemical compound CCCCCCCCCCCC(=O)OCC MMXKVMNBHPAILY-UHFFFAOYSA-N 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 239000003889 eye drop Substances 0.000 description 2
- 229940012356 eye drops Drugs 0.000 description 2
- 238000007710 freezing Methods 0.000 description 2
- 230000008014 freezing Effects 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 210000001035 gastrointestinal tract Anatomy 0.000 description 2
- 239000007903 gelatin capsule Substances 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 239000003979 granulating agent Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 229960000890 hydrocortisone Drugs 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 2
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 239000007972 injectable composition Substances 0.000 description 2
- 229940047124 interferons Drugs 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 description 2
- NLYAJNPCOHFWQQ-UHFFFAOYSA-N kaolin Chemical compound O.O.O=[Al]O[Si](=O)O[Si](=O)O[Al]=O NLYAJNPCOHFWQQ-UHFFFAOYSA-N 0.000 description 2
- 235000014655 lactic acid Nutrition 0.000 description 2
- 239000004310 lactic acid Substances 0.000 description 2
- 239000003446 ligand Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000008297 liquid dosage form Substances 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 235000019359 magnesium stearate Nutrition 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 229960002510 mandelic acid Drugs 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 2
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 2
- 229960002216 methylparaben Drugs 0.000 description 2
- 239000004530 micro-emulsion Substances 0.000 description 2
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 2
- 239000008108 microcrystalline cellulose Substances 0.000 description 2
- 229940016286 microcrystalline cellulose Drugs 0.000 description 2
- 150000007522 mineralic acids Chemical class 0.000 description 2
- 208000010125 myocardial infarction Diseases 0.000 description 2
- 239000000346 nonvolatile oil Substances 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 235000014571 nuts Nutrition 0.000 description 2
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 2
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 2
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 2
- 229940055577 oleyl alcohol Drugs 0.000 description 2
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 2
- 238000002515 oligonucleotide synthesis Methods 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000002304 perfume Substances 0.000 description 2
- 229960003742 phenol Drugs 0.000 description 2
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 2
- 229940067107 phenylethyl alcohol Drugs 0.000 description 2
- SCVFZCLFOSHCOH-UHFFFAOYSA-M potassium acetate Chemical compound [K+].CC([O-])=O SCVFZCLFOSHCOH-UHFFFAOYSA-M 0.000 description 2
- RWPGFSMJFRPDDP-UHFFFAOYSA-L potassium metabisulfite Chemical compound [K+].[K+].[O-]S(=O)S([O-])(=O)=O RWPGFSMJFRPDDP-UHFFFAOYSA-L 0.000 description 2
- 229940043349 potassium metabisulfite Drugs 0.000 description 2
- 235000010263 potassium metabisulphite Nutrition 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 235000019260 propionic acid Nutrition 0.000 description 2
- 229960004063 propylene glycol Drugs 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 150000003856 quaternary ammonium compounds Chemical class 0.000 description 2
- 239000011541 reaction mixture Substances 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000002342 ribonucleoside Substances 0.000 description 2
- 238000009738 saturating Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 150000004760 silicates Chemical class 0.000 description 2
- RMAQACBXLXPBSY-UHFFFAOYSA-N silicic acid Chemical compound O[Si](O)(O)O RMAQACBXLXPBSY-UHFFFAOYSA-N 0.000 description 2
- 235000012239 silicon dioxide Nutrition 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 235000010413 sodium alginate Nutrition 0.000 description 2
- 239000000661 sodium alginate Substances 0.000 description 2
- 229940005550 sodium alginate Drugs 0.000 description 2
- WXMKPNITSTVMEF-UHFFFAOYSA-M sodium benzoate Chemical compound [Na+].[O-]C(=O)C1=CC=CC=C1 WXMKPNITSTVMEF-UHFFFAOYSA-M 0.000 description 2
- 235000010234 sodium benzoate Nutrition 0.000 description 2
- 239000004299 sodium benzoate Substances 0.000 description 2
- 229940001607 sodium bisulfite Drugs 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 235000011083 sodium citrates Nutrition 0.000 description 2
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 2
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 2
- 229940001584 sodium metabisulfite Drugs 0.000 description 2
- 235000010262 sodium metabisulphite Nutrition 0.000 description 2
- 239000001488 sodium phosphate Substances 0.000 description 2
- 229910000162 sodium phosphate Inorganic materials 0.000 description 2
- 235000011008 sodium phosphates Nutrition 0.000 description 2
- 229920003109 sodium starch glycolate Polymers 0.000 description 2
- 229940079832 sodium starch glycolate Drugs 0.000 description 2
- 239000008109 sodium starch glycolate Substances 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 235000010199 sorbic acid Nutrition 0.000 description 2
- 239000004334 sorbic acid Substances 0.000 description 2
- 229940075582 sorbic acid Drugs 0.000 description 2
- 108010014657 sortilin Proteins 0.000 description 2
- 238000002798 spectrophotometry method Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 2
- 229940104230 thymidine Drugs 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 210000003412 trans-golgi network Anatomy 0.000 description 2
- 229960000575 trastuzumab Drugs 0.000 description 2
- URAYPUMNDPQOKB-UHFFFAOYSA-N triacetin Chemical compound CC(=O)OCC(OC(C)=O)COC(C)=O URAYPUMNDPQOKB-UHFFFAOYSA-N 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 2
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 2
- 238000002211 ultraviolet spectrum Methods 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- QAOHCFGKCWTBGC-QHOAOGIMSA-N wybutosine Chemical compound C1=NC=2C(=O)N3C(CC[C@H](NC(=O)OC)C(=O)OC)=C(C)N=C3N(C)C=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O QAOHCFGKCWTBGC-QHOAOGIMSA-N 0.000 description 2
- QAOHCFGKCWTBGC-UHFFFAOYSA-N wybutosine Natural products C1=NC=2C(=O)N3C(CCC(NC(=O)OC)C(=O)OC)=C(C)N=C3N(C)C=2N1C1OC(CO)C(O)C1O QAOHCFGKCWTBGC-UHFFFAOYSA-N 0.000 description 2
- JCZSFCLRSONYLH-QYVSTXNMSA-N wyosin Chemical compound N=1C(C)=CN(C(C=2N=C3)=O)C=1N(C)C=2N3[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O JCZSFCLRSONYLH-QYVSTXNMSA-N 0.000 description 2
- RPQZTTQVRYEKCR-WCTZXXKLSA-N zebularine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)N=CC=C1 RPQZTTQVRYEKCR-WCTZXXKLSA-N 0.000 description 2
- FTLYMKDSHNWQKD-UHFFFAOYSA-N (2,4,5-trichlorophenyl)boronic acid Chemical compound OB(O)C1=CC(Cl)=C(Cl)C=C1Cl FTLYMKDSHNWQKD-UHFFFAOYSA-N 0.000 description 1
- MJYQFWSXKFLTAY-OVEQLNGDSA-N (2r,3r)-2,3-bis[(4-hydroxy-3-methoxyphenyl)methyl]butane-1,4-diol;(2r,3r,4s,5s,6r)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O.C1=C(O)C(OC)=CC(C[C@@H](CO)[C@H](CO)CC=2C=C(OC)C(O)=CC=2)=C1 MJYQFWSXKFLTAY-OVEQLNGDSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- ICLYJLBTOGPLMC-KVVVOXFISA-N (z)-octadec-9-enoate;tris(2-hydroxyethyl)azanium Chemical compound OCCN(CCO)CCO.CCCCCCCC\C=C/CCCCCCCC(O)=O ICLYJLBTOGPLMC-KVVVOXFISA-N 0.000 description 1
- ZORQXIQZAOLNGE-UHFFFAOYSA-N 1,1-difluorocyclohexane Chemical compound FC1(F)CCCCC1 ZORQXIQZAOLNGE-UHFFFAOYSA-N 0.000 description 1
- QMMJWQMCMRUYTG-UHFFFAOYSA-N 1,2,4,5-tetrachloro-3-(trifluoromethyl)benzene Chemical compound FC(F)(F)C1=C(Cl)C(Cl)=CC(Cl)=C1Cl QMMJWQMCMRUYTG-UHFFFAOYSA-N 0.000 description 1
- DTOUUUZOYKYHEP-UHFFFAOYSA-N 1,3-bis(2-ethylhexyl)-5-methyl-1,3-diazinan-5-amine Chemical compound CCCCC(CC)CN1CN(CC(CC)CCCC)CC(C)(N)C1 DTOUUUZOYKYHEP-UHFFFAOYSA-N 0.000 description 1
- 229940058015 1,3-butylene glycol Drugs 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-UHFFFAOYSA-N 13-cis retinol Natural products OCC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-UHFFFAOYSA-N 0.000 description 1
- QWENRTYMTSOGBR-UHFFFAOYSA-N 1H-1,2,3-Triazole Chemical compound C=1C=NNN=1 QWENRTYMTSOGBR-UHFFFAOYSA-N 0.000 description 1
- RAXXELZNTBOGNW-UHFFFAOYSA-N 1H-imidazole Chemical compound C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 1
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Natural products C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 description 1
- LFHLEABTNIQIQO-UHFFFAOYSA-N 1H-isoindole Chemical compound C1=CC=C2CN=CC2=C1 LFHLEABTNIQIQO-UHFFFAOYSA-N 0.000 description 1
- 239000000263 2,3-dihydroxypropyl (Z)-octadec-9-enoate Substances 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- WGIMXKDCVCTHGW-UHFFFAOYSA-N 2-(2-hydroxyethoxy)ethyl dodecanoate Chemical compound CCCCCCCCCCCC(=O)OCCOCCO WGIMXKDCVCTHGW-UHFFFAOYSA-N 0.000 description 1
- FKOKUHFZNIUSLW-UHFFFAOYSA-N 2-Hydroxypropyl stearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(C)O FKOKUHFZNIUSLW-UHFFFAOYSA-N 0.000 description 1
- RFVNOJDQRGSOEL-UHFFFAOYSA-N 2-hydroxyethyl octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCO RFVNOJDQRGSOEL-UHFFFAOYSA-N 0.000 description 1
- QTWJRLJHJPIABL-UHFFFAOYSA-N 2-methylphenol;3-methylphenol;4-methylphenol Chemical compound CC1=CC=C(O)C=C1.CC1=CC=CC(O)=C1.CC1=CC=CC=C1O QTWJRLJHJPIABL-UHFFFAOYSA-N 0.000 description 1
- LEACJMVNYZDSKR-UHFFFAOYSA-N 2-octyldodecan-1-ol Chemical compound CCCCCCCCCCC(CO)CCCCCCCC LEACJMVNYZDSKR-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- VHMICKWLTGFITH-UHFFFAOYSA-N 2H-isoindole Chemical compound C1=CC=CC2=CNC=C21 VHMICKWLTGFITH-UHFFFAOYSA-N 0.000 description 1
- UBLAMKHIFZBBSS-UHFFFAOYSA-N 3-Methylbutyl pentanoate Chemical compound CCCCC(=O)OCCC(C)C UBLAMKHIFZBBSS-UHFFFAOYSA-N 0.000 description 1
- RZRNAYUHWVFMIP-GDCKJWNLSA-N 3-oleoyl-sn-glycerol Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@H](O)CO RZRNAYUHWVFMIP-GDCKJWNLSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- JYSJUWVOWAGOFY-SHWORQQCSA-N 4-amino-1-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-methylpyrimidin-2-one 9-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-2-iminopurine-6,8-dione Chemical compound CC=1C(=NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)N.O=C1N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C2=NC(=NC(C2=N1)=O)N JYSJUWVOWAGOFY-SHWORQQCSA-N 0.000 description 1
- OSDLLIBGSJNGJE-UHFFFAOYSA-N 4-chloro-3,5-dimethylphenol Chemical compound CC1=CC(O)=CC(C)=C1Cl OSDLLIBGSJNGJE-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- CQEGIDNFEVEMOS-UHFFFAOYSA-N 6-chloro-7h-purine;7h-purine Chemical compound C1=NC=C2NC=NC2=N1.ClC1=NC=NC2=C1NC=N2 CQEGIDNFEVEMOS-UHFFFAOYSA-N 0.000 description 1
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 1
- GJCOSYZMQJWQCA-UHFFFAOYSA-N 9H-xanthene Chemical compound C1=CC=C2CC3=CC=CC=C3OC2=C1 GJCOSYZMQJWQCA-UHFFFAOYSA-N 0.000 description 1
- 108091006112 ATPases Proteins 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical group OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 208000030090 Acute Disease Diseases 0.000 description 1
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 1
- 240000006054 Agastache cana Species 0.000 description 1
- 235000006667 Aleurites moluccana Nutrition 0.000 description 1
- 244000136475 Aleurites moluccana Species 0.000 description 1
- 244000144725 Amygdalus communis Species 0.000 description 1
- 235000011437 Amygdalus communis Nutrition 0.000 description 1
- 244000144730 Amygdalus persica Species 0.000 description 1
- 108010085443 Anserine Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 235000003276 Apios tuberosa Nutrition 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 235000017060 Arachis glabrata Nutrition 0.000 description 1
- 235000018262 Arachis monticola Nutrition 0.000 description 1
- 235000010744 Arachis villosulicarpa Nutrition 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 208000023275 Autoimmune disease Diseases 0.000 description 1
- LPHRLWWUNKOSTN-UHFFFAOYSA-N BC1OC(CCP(=C)(C)C)C(CP(=C)(C)C)C1O Chemical compound BC1OC(CCP(=C)(C)C)C(CP(=C)(C)C)C1O LPHRLWWUNKOSTN-UHFFFAOYSA-N 0.000 description 1
- GYLRZLYTGODGJK-UHFFFAOYSA-N BC1OC(CCP(=C)(C)CP(=C)(C)CP(=C)(C)C)C(C)C1O Chemical compound BC1OC(CCP(=C)(C)CP(=C)(C)CP(=C)(C)C)C(C)C1O GYLRZLYTGODGJK-UHFFFAOYSA-N 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- 229930185605 Bisphenol Natural products 0.000 description 1
- 235000007689 Borago officinalis Nutrition 0.000 description 1
- 240000004355 Borago officinalis Species 0.000 description 1
- 235000014698 Brassica juncea var multisecta Nutrition 0.000 description 1
- 240000002791 Brassica napus Species 0.000 description 1
- 235000006008 Brassica napus var napus Nutrition 0.000 description 1
- 235000006618 Brassica rapa subsp oleifera Nutrition 0.000 description 1
- 244000188595 Brassica sinapistrum Species 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 235000004936 Bromus mango Nutrition 0.000 description 1
- LVDKZNITIUWNER-UHFFFAOYSA-N Bronopol Chemical compound OCC(Br)(CO)[N+]([O-])=O LVDKZNITIUWNER-UHFFFAOYSA-N 0.000 description 1
- 239000004255 Butylated hydroxyanisole Substances 0.000 description 1
- 239000004322 Butylated hydroxytoluene Substances 0.000 description 1
- NLZUEZXRPGMBCV-UHFFFAOYSA-N Butylhydroxytoluene Chemical compound CC1=CC(C(C)(C)C)=C(O)C(C(C)(C)C)=C1 NLZUEZXRPGMBCV-UHFFFAOYSA-N 0.000 description 1
- HXBSCNFNGQVEAK-UHFFFAOYSA-N C.C=C1N=C(N)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C=NN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C2NC(C)=CC2=CN1C1OC(CCP(=C)(C)C)C(O)C1O Chemical compound C.C=C1N=C(N)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C=NN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C2NC(C)=CC2=CN1C1OC(CCP(=C)(C)C)C(O)C1O HXBSCNFNGQVEAK-UHFFFAOYSA-N 0.000 description 1
- QSVLMFQMXHUYKK-UHFFFAOYSA-N C.C=C1N=C(N)C(C)=CN1C1OC(COP(=O)(O)O)C(O)C1O.NC1=NC(=O)N(C2OC(COP(=O)(O)O)C(O)C2O)C=C1I Chemical compound C.C=C1N=C(N)C(C)=CN1C1OC(COP(=O)(O)O)C(O)C1O.NC1=NC(=O)N(C2OC(COP(=O)(O)O)C(O)C2O)C=C1I QSVLMFQMXHUYKK-UHFFFAOYSA-N 0.000 description 1
- VQWXAWMRLMPIMW-UHFFFAOYSA-N C.C=C1NC(=O)C(I)=CN1C1OC(COP(=O)(O)O)C(O)C1O.CC1=CN(C2OC(COP(=O)(O)O)C(O)C2O)C(=O)NC1=O Chemical compound C.C=C1NC(=O)C(I)=CN1C1OC(COP(=O)(O)O)C(O)C1O.CC1=CN(C2OC(COP(=O)(O)O)C(O)C2O)C(=O)NC1=O VQWXAWMRLMPIMW-UHFFFAOYSA-N 0.000 description 1
- OCJQZVWXYQBDCW-UHFFFAOYSA-N C.C=C1NC(=O)C=NN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N(C)C=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=S)C=CN1C1OC(CCP(=C)(C)C)C(O)C1O Chemical compound C.C=C1NC(=O)C=NN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N(C)C=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=S)C=CN1C1OC(CCP(=C)(C)C)C(O)C1O OCJQZVWXYQBDCW-UHFFFAOYSA-N 0.000 description 1
- SNKHEWHQDPAQMQ-UHFFFAOYSA-N C.C=C1NC(=O)N(C)C=C1C1OC(COP(=O)(O)O)C(O)C1O.O=C1NC=C(C2OC(COP(=O)(O)O)C(O)C2O)C(=O)N1 Chemical compound C.C=C1NC(=O)N(C)C=C1C1OC(COP(=O)(O)O)C(O)C1O.O=C1NC=C(C2OC(COP(=O)(O)O)C(O)C2O)C(=O)N1 SNKHEWHQDPAQMQ-UHFFFAOYSA-N 0.000 description 1
- VWPNQMMVXZMQKS-UHFFFAOYSA-N C=C1N=C(N)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C2NC(C)=CC2=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N=CC1C1OC(CCP(=C)(C)C)C(O)C1O Chemical compound C=C1N=C(N)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C(N)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1N=C2NC(C)=CC2=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N=CC1C1OC(CCP(=C)(C)C)C(O)C1O VWPNQMMVXZMQKS-UHFFFAOYSA-N 0.000 description 1
- BDUNJMNOHBWANN-UHFFFAOYSA-N C=C1N=C2NC(C)=CC2=CN1C1OC(COP(=O)(O)O)C(O)C1O Chemical compound C=C1N=C2NC(C)=CC2=CN1C1OC(COP(=O)(O)O)C(O)C1O BDUNJMNOHBWANN-UHFFFAOYSA-N 0.000 description 1
- FEAHJCFLIKGZBZ-WPYDVODASA-N C=C1NC(=O)C(/C=C/CN)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(O)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)CCN1C1OC(CCP(=C)(C)C)C(O)C1O Chemical compound C=C1NC(=O)C(/C=C/CN)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(O)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)CCN1C1OC(CCP(=C)(C)C)C(O)C1O FEAHJCFLIKGZBZ-WPYDVODASA-N 0.000 description 1
- BVGJHBPMNHSEBL-UHFFFAOYSA-N C=C1NC(=O)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N(C)C=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O Chemical compound C=C1NC(=O)C(C)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)C(I)=CN1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)N(C)C=C1C1OC(CCP(=C)(C)C)C(O)C1O.C=C1NC(=O)NC=C1C1OC(CCP(=C)(C)C)C(O)C1O BVGJHBPMNHSEBL-UHFFFAOYSA-N 0.000 description 1
- QQZCDUTYKVVELH-UHFFFAOYSA-N C=P(C)(C)CC1C(CCP(=C)(C)CP(=C)(C)C)OC(C)C1O Chemical compound C=P(C)(C)CC1C(CCP(=C)(C)CP(=C)(C)C)OC(C)C1O QQZCDUTYKVVELH-UHFFFAOYSA-N 0.000 description 1
- GYBVFKTVRYXWBS-UHFFFAOYSA-N C=P(C)(C)CC1C(CCP(=C)(C)CP(=C)(C)CP(=C)(C)C)OC(C)C1O Chemical compound C=P(C)(C)CC1C(CCP(=C)(C)CP(=C)(C)CP(=C)(C)C)OC(C)C1O GYBVFKTVRYXWBS-UHFFFAOYSA-N 0.000 description 1
- FKUSDFWTBVIQIC-UHFFFAOYSA-N C=P(C)(C)CCC1OC(C)C(O)C1CP(=C)(C)C Chemical compound C=P(C)(C)CCC1OC(C)C(O)C1CP(=C)(C)C FKUSDFWTBVIQIC-UHFFFAOYSA-N 0.000 description 1
- RWUDKPLOXPJFJM-UHFFFAOYSA-N C=P(C)(CC)CC1C(CCP(=C)(CC)CP(=C)(C)CC)OC(C)C1C Chemical compound C=P(C)(CC)CC1C(CCP(=C)(CC)CP(=C)(C)CC)OC(C)C1C RWUDKPLOXPJFJM-UHFFFAOYSA-N 0.000 description 1
- XEHWHJMHULKUCC-UHFFFAOYSA-N C=P(C)(CC)CC1C(CCP(=C)(CC)CP(=C)(CC)CP(=C)(C)CC)OC(C)C1C Chemical compound C=P(C)(CC)CC1C(CCP(=C)(CC)CP(=C)(CC)CP(=C)(C)CC)OC(C)C1C XEHWHJMHULKUCC-UHFFFAOYSA-N 0.000 description 1
- WOFLYSPZYKDTJK-UHFFFAOYSA-N C=P(C)(CC)CCC1OC(C)C(C)C1CP(=C)(C)CC Chemical compound C=P(C)(CC)CCC1OC(C)C(C)C1CP(=C)(C)CC WOFLYSPZYKDTJK-UHFFFAOYSA-N 0.000 description 1
- GRKGNOLPAFWNKW-BLVAWDSKSA-N CC=1C(=NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)N.CN1C(C=2N=CN([C@H]3[C@H](O)[C@H](O)[C@@H](CO)O3)C2N=C1)=N Chemical compound CC=1C(=NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)N.CN1C(C=2N=CN([C@H]3[C@H](O)[C@H](O)[C@@H](CO)O3)C2N=C1)=N GRKGNOLPAFWNKW-BLVAWDSKSA-N 0.000 description 1
- 101100294756 Caenorhabditis elegans ntp-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 239000001736 Calcium glycerylphosphate Substances 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- QRYRORQUOLYVBU-VBKZILBWSA-N Carnosic acid Natural products CC([C@@H]1CC2)(C)CCC[C@]1(C(O)=O)C1=C2C=C(C(C)C)C(O)=C1O QRYRORQUOLYVBU-VBKZILBWSA-N 0.000 description 1
- 108010087806 Carnosine Proteins 0.000 description 1
- 235000003255 Carthamus tinctorius Nutrition 0.000 description 1
- 244000020518 Carthamus tinctorius Species 0.000 description 1
- 235000005747 Carum carvi Nutrition 0.000 description 1
- 240000000467 Carum carvi Species 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 235000009024 Ceanothus sanguineus Nutrition 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 241000206575 Chondrus crispus Species 0.000 description 1
- 244000223760 Cinnamomum zeylanicum Species 0.000 description 1
- 241000132536 Cirsium Species 0.000 description 1
- YASYEJJMZJALEJ-UHFFFAOYSA-N Citric acid monohydrate Chemical compound O.OC(=O)CC(O)(C(O)=O)CC(O)=O YASYEJJMZJALEJ-UHFFFAOYSA-N 0.000 description 1
- 241000207199 Citrus Species 0.000 description 1
- 235000005979 Citrus limon Nutrition 0.000 description 1
- 244000131522 Citrus pyriformis Species 0.000 description 1
- 235000013162 Cocos nucifera Nutrition 0.000 description 1
- 244000060011 Cocos nucifera Species 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 235000010919 Copernicia prunifera Nutrition 0.000 description 1
- 244000180278 Copernicia prunifera Species 0.000 description 1
- 240000009226 Corylus americana Species 0.000 description 1
- 235000001543 Corylus americana Nutrition 0.000 description 1
- 235000007466 Corylus avellana Nutrition 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 241000938605 Crocodylia Species 0.000 description 1
- 240000001980 Cucurbita pepo Species 0.000 description 1
- 235000009852 Cucurbita pepo Nutrition 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- ZAKOWWREFLAJOT-CEFNRUSXSA-N D-alpha-tocopherylacetate Chemical compound CC(=O)OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C ZAKOWWREFLAJOT-CEFNRUSXSA-N 0.000 description 1
- ZZZCUOFIHGPKAK-UHFFFAOYSA-N D-erythro-ascorbic acid Natural products OCC1OC(=O)C(O)=C1O ZZZCUOFIHGPKAK-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 1
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 101710096438 DNA-binding protein Proteins 0.000 description 1
- XMSXQFUHVRWGNA-UHFFFAOYSA-N Decamethylcyclopentasiloxane Chemical compound C[Si]1(C)O[Si](C)(C)O[Si](C)(C)O[Si](C)(C)O[Si](C)(C)O1 XMSXQFUHVRWGNA-UHFFFAOYSA-N 0.000 description 1
- 239000004287 Dehydroacetic acid Substances 0.000 description 1
- 108091027757 Deoxyribozyme Proteins 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 241000271571 Dromaius novaehollandiae Species 0.000 description 1
- ZGTMUACCHSMWAC-UHFFFAOYSA-L EDTA disodium salt (anhydrous) Chemical compound [Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC(O)=O)CC([O-])=O ZGTMUACCHSMWAC-UHFFFAOYSA-L 0.000 description 1
- QZKRHPLGUJDVAR-UHFFFAOYSA-K EDTA trisodium salt Chemical compound [Na+].[Na+].[Na+].OC(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O QZKRHPLGUJDVAR-UHFFFAOYSA-K 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 102000002322 Egg Proteins Human genes 0.000 description 1
- 108010000912 Egg Proteins Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 239000001856 Ethyl cellulose Substances 0.000 description 1
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 1
- FPVVYTCTZKCSOJ-UHFFFAOYSA-N Ethylene glycol distearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCCOC(=O)CCCCCCCCCCCCCCCCC FPVVYTCTZKCSOJ-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 244000004281 Eucalyptus maculata Species 0.000 description 1
- 239000004606 Fillers/Extenders Substances 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- 239000005792 Geraniol Substances 0.000 description 1
- GLZPCOQZEFWAFX-YFHOEESVSA-N Geraniol Natural products CC(C)=CCC\C(C)=C/CO GLZPCOQZEFWAFX-YFHOEESVSA-N 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 1
- 229920002907 Guar gum Polymers 0.000 description 1
- 244000020551 Helianthus annuus Species 0.000 description 1
- 235000003222 Helianthus annuus Nutrition 0.000 description 1
- 102100027685 Hemoglobin subunit alpha Human genes 0.000 description 1
- 108091005902 Hemoglobin subunit alpha Proteins 0.000 description 1
- 108010034791 Heterochromatin Proteins 0.000 description 1
- SQUHHTBVTRBESD-UHFFFAOYSA-N Hexa-Ac-myo-Inositol Natural products CC(=O)OC1C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C(OC(C)=O)C1OC(C)=O SQUHHTBVTRBESD-UHFFFAOYSA-N 0.000 description 1
- 240000000950 Hippophae rhamnoides Species 0.000 description 1
- 235000003145 Hippophae rhamnoides Nutrition 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 101000800483 Homo sapiens Toll-like receptor 8 Proteins 0.000 description 1
- 241000384508 Hoplostethus atlanticus Species 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 235000010650 Hyssopus officinalis Nutrition 0.000 description 1
- 101150017040 I gene Proteins 0.000 description 1
- UYMPGMATNGXPEG-UOBYYGRMSA-N IC=1C(=NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)N.N(=[N+]=[N-])C=1N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C=2N=CN=C(C2N1)N.CC=1C(NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)=O Chemical compound IC=1C(=NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)N.N(=[N+]=[N-])C=1N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C=2N=CN=C(C2N1)N.CC=1C(NC(N([C@H]2[C@H](O)[C@H](O)[C@@H](CO)O2)C1)=O)=O UYMPGMATNGXPEG-UOBYYGRMSA-N 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- IMQLKJBTEOYOSI-GPIVLXJGSA-N Inositol-hexakisphosphate Chemical compound OP(O)(=O)O[C@H]1[C@H](OP(O)(O)=O)[C@@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@H](OP(O)(O)=O)[C@@H]1OP(O)(O)=O IMQLKJBTEOYOSI-GPIVLXJGSA-N 0.000 description 1
- 108010019437 Janus Kinase 2 Proteins 0.000 description 1
- 240000007049 Juglans regia Species 0.000 description 1
- 235000009496 Juglans regia Nutrition 0.000 description 1
- SLRNWACWRVGMKD-UHFFFAOYSA-N L-anserine Natural products CN1C=NC(CC(NC(=O)CCN)C(O)=O)=C1 SLRNWACWRVGMKD-UHFFFAOYSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 108010028554 LDL Cholesterol Proteins 0.000 description 1
- 241000218652 Larix Species 0.000 description 1
- 235000005590 Larix decidua Nutrition 0.000 description 1
- 244000165082 Lavanda vera Species 0.000 description 1
- 235000010663 Lavandula angustifolia Nutrition 0.000 description 1
- 241000408747 Lepomis gibbosus Species 0.000 description 1
- 240000003553 Leptospermum scoparium Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241001072282 Limnanthes Species 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 235000012854 Litsea cubeba Nutrition 0.000 description 1
- 240000002262 Litsea cubeba Species 0.000 description 1
- 235000015459 Lycium barbarum Nutrition 0.000 description 1
- 240000000982 Malva neglecta Species 0.000 description 1
- 235000000060 Malva neglecta Nutrition 0.000 description 1
- 235000014826 Mangifera indica Nutrition 0.000 description 1
- 240000007228 Mangifera indica Species 0.000 description 1
- 208000026139 Memory disease Diseases 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 244000179970 Monarda didyma Species 0.000 description 1
- 235000010672 Monarda didyma Nutrition 0.000 description 1
- 229920000715 Mucilage Polymers 0.000 description 1
- 208000014767 Myeloproliferative disease Diseases 0.000 description 1
- 235000009421 Myristica fragrans Nutrition 0.000 description 1
- 244000270834 Myristica fragrans Species 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 1
- CQOVPNPJLQNMDC-UHFFFAOYSA-N N-beta-alanyl-L-histidine Natural products NCCC(=O)NC(C(O)=O)CC1=CN=CN1 CQOVPNPJLQNMDC-UHFFFAOYSA-N 0.000 description 1
- 241000772415 Neovison vison Species 0.000 description 1
- 108020004485 Nonsense Codon Proteins 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 241000219925 Oenothera Species 0.000 description 1
- 235000004496 Oenothera biennis Nutrition 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 208000001388 Opportunistic Infections Diseases 0.000 description 1
- 235000014643 Orbignya martiana Nutrition 0.000 description 1
- 244000021150 Orbignya martiana Species 0.000 description 1
- 240000007594 Oryza sativa Species 0.000 description 1
- 235000007164 Oryza sativa Nutrition 0.000 description 1
- 235000008753 Papaver somniferum Nutrition 0.000 description 1
- 244000025272 Persea americana Species 0.000 description 1
- 235000008673 Persea americana Nutrition 0.000 description 1
- 241000286209 Phasianidae Species 0.000 description 1
- IMQLKJBTEOYOSI-UHFFFAOYSA-N Phytic acid Natural products OP(O)(=O)OC1C(OP(O)(O)=O)C(OP(O)(O)=O)C(OP(O)(O)=O)C(OP(O)(O)=O)C1OP(O)(O)=O IMQLKJBTEOYOSI-UHFFFAOYSA-N 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 229920001214 Polysorbate 60 Polymers 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- HLCFGWHYROZGBI-JJKGCWMISA-M Potassium gluconate Chemical compound [K+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O HLCFGWHYROZGBI-JJKGCWMISA-M 0.000 description 1
- 241000210053 Potentilla elegans Species 0.000 description 1
- 235000009827 Prunus armeniaca Nutrition 0.000 description 1
- 244000018633 Prunus armeniaca Species 0.000 description 1
- 235000006040 Prunus persica var persica Nutrition 0.000 description 1
- WTKZEGDFNFYCGP-UHFFFAOYSA-N Pyrazole Chemical compound C=1C=NNC=1 WTKZEGDFNFYCGP-UHFFFAOYSA-N 0.000 description 1
- 108020005073 RNA Cap Analogs Proteins 0.000 description 1
- 230000026279 RNA modification Effects 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 244000178231 Rosmarinus officinalis Species 0.000 description 1
- 240000000513 Santalum album Species 0.000 description 1
- 235000008632 Santalum album Nutrition 0.000 description 1
- 206010040047 Sepsis Diseases 0.000 description 1
- 235000003434 Sesamum indicum Nutrition 0.000 description 1
- 244000040738 Sesamum orientale Species 0.000 description 1
- 244000044822 Simmondsia californica Species 0.000 description 1
- 235000004433 Simmondsia californica Nutrition 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- BCKXLBQYZLBQEK-KVVVOXFISA-M Sodium oleate Chemical compound [Na+].CCCCCCCC\C=C/CCCCCCCC([O-])=O BCKXLBQYZLBQEK-KVVVOXFISA-M 0.000 description 1
- 235000002595 Solanum tuberosum Nutrition 0.000 description 1
- 244000061456 Solanum tuberosum Species 0.000 description 1
- IYFATESGLOUGBX-YVNJGZBMSA-N Sorbitan monopalmitate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O IYFATESGLOUGBX-YVNJGZBMSA-N 0.000 description 1
- HVUMOYIDDBPOLL-XWVZOOPGSA-N Sorbitan monostearate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O HVUMOYIDDBPOLL-XWVZOOPGSA-N 0.000 description 1
- 235000009184 Spondias indica Nutrition 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- SSZBUIDZHHWXNJ-UHFFFAOYSA-N Stearinsaeure-hexadecylester Natural products CCCCCCCCCCCCCCCCCC(=O)OCCCCCCCCCCCCCCCC SSZBUIDZHHWXNJ-UHFFFAOYSA-N 0.000 description 1
- 208000006011 Stroke Diseases 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 235000007769 Vetiveria zizanioides Nutrition 0.000 description 1
- 244000284012 Vetiveria zizanioides Species 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- FPIPGXGPPPQFEQ-BOOMUCAASA-N Vitamin A Natural products OC/C=C(/C)\C=C\C=C(\C)/C=C/C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-BOOMUCAASA-N 0.000 description 1
- 229930003268 Vitamin C Natural products 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- 235000018936 Vitellaria paradoxa Nutrition 0.000 description 1
- 241001135917 Vitellaria paradoxa Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- IJCWFDPJFXGQBN-RYNSOKOISA-N [(2R)-2-[(2R,3R,4S)-4-hydroxy-3-octadecanoyloxyoxolan-2-yl]-2-octadecanoyloxyethyl] octadecanoate Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@@H](OC(=O)CCCCCCCCCCCCCCCCC)[C@H]1OC[C@H](O)[C@H]1OC(=O)CCCCCCCCCCCCCCCCC IJCWFDPJFXGQBN-RYNSOKOISA-N 0.000 description 1
- 239000001089 [(2R)-oxolan-2-yl]methanol Substances 0.000 description 1
- YKTSYUJCYHOUJP-UHFFFAOYSA-N [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] Chemical compound [O--].[Al+3].[Al+3].[O-][Si]([O-])([O-])[O-] YKTSYUJCYHOUJP-UHFFFAOYSA-N 0.000 description 1
- 239000002250 absorbent Substances 0.000 description 1
- 230000002745 absorbent Effects 0.000 description 1
- 239000003655 absorption accelerator Substances 0.000 description 1
- 238000000862 absorption spectrum Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 229960000583 acetic acid Drugs 0.000 description 1
- 235000011054 acetic acid Nutrition 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 239000003513 alkali Substances 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- OENHQHLEOONYIE-UKMVMLAPSA-N all-trans beta-carotene Natural products CC=1CCCC(C)(C)C=1/C=C/C(/C)=C/C=C/C(/C)=C/C=C/C=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C OENHQHLEOONYIE-UKMVMLAPSA-N 0.000 description 1
- FPIPGXGPPPQFEQ-OVSJKPMPSA-N all-trans-retinol Chemical compound OC\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C FPIPGXGPPPQFEQ-OVSJKPMPSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 235000020224 almond Nutrition 0.000 description 1
- 229940087168 alpha tocopherol Drugs 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229940024545 aluminum hydroxide Drugs 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- 229960001040 ammonium chloride Drugs 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 239000003945 anionic surfactant Substances 0.000 description 1
- 239000000420 anogeissus latifolia wall. gum Substances 0.000 description 1
- MYYIAHXIVFADCU-QMMMGPOBSA-N anserine Chemical compound CN1C=NC=C1C[C@H](NC(=O)CC[NH3+])C([O-])=O MYYIAHXIVFADCU-QMMMGPOBSA-N 0.000 description 1
- 125000002178 anthracenyl group Chemical group C1(=CC=CC2=CC3=CC=CC=C3C=C12)* 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- BTFJIXJJCSYFAL-UHFFFAOYSA-N arachidyl alcohol Natural products CCCCCCCCCCCCCCCCCCCCO BTFJIXJJCSYFAL-UHFFFAOYSA-N 0.000 description 1
- 150000004945 aromatic hydrocarbons Chemical class 0.000 description 1
- 238000000889 atomisation Methods 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 235000001053 badasse Nutrition 0.000 description 1
- 210000004082 barrier epithelial cell Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 229960004365 benzoic acid Drugs 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- 239000011648 beta-carotene Substances 0.000 description 1
- 235000013734 beta-carotene Nutrition 0.000 description 1
- TUPZEYHYWIEDIH-WAIFQNFQSA-N beta-carotene Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C)C=CC=C(/C)C=CC2=CCCCC2(C)C TUPZEYHYWIEDIH-WAIFQNFQSA-N 0.000 description 1
- WHGYBXFWUBPSRW-FOUAGVGXSA-N beta-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO WHGYBXFWUBPSRW-FOUAGVGXSA-N 0.000 description 1
- 229960002747 betacarotene Drugs 0.000 description 1
- 238000004166 bioassay Methods 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- IISBACLAFKSPIT-UHFFFAOYSA-N bisphenol A Chemical compound C=1C=C(O)C=CC=1C(C)(C)C1=CC=C(O)C=C1 IISBACLAFKSPIT-UHFFFAOYSA-N 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 210000001218 blood-brain barrier Anatomy 0.000 description 1
- 230000036760 body temperature Effects 0.000 description 1
- 125000001246 bromo group Chemical group Br* 0.000 description 1
- 229960003168 bronopol Drugs 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000019282 butylated hydroxyanisole Nutrition 0.000 description 1
- CZBZUDVBLSSABA-UHFFFAOYSA-N butylated hydroxyanisole Chemical compound COC1=CC=C(O)C(C(C)(C)C)=C1.COC1=CC=C(O)C=C1C(C)(C)C CZBZUDVBLSSABA-UHFFFAOYSA-N 0.000 description 1
- 229940043253 butylated hydroxyanisole Drugs 0.000 description 1
- 235000010354 butylated hydroxytoluene Nutrition 0.000 description 1
- 229940095259 butylated hydroxytoluene Drugs 0.000 description 1
- 229940067596 butylparaben Drugs 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229960005069 calcium Drugs 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 229960002713 calcium chloride Drugs 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- FNAQSUUGMSOBHW-UHFFFAOYSA-H calcium citrate Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O FNAQSUUGMSOBHW-UHFFFAOYSA-H 0.000 description 1
- 239000001354 calcium citrate Substances 0.000 description 1
- 229960004256 calcium citrate Drugs 0.000 description 1
- 229960002283 calcium glubionate Drugs 0.000 description 1
- 229940078512 calcium gluceptate Drugs 0.000 description 1
- 235000013927 calcium gluconate Nutrition 0.000 description 1
- 239000004227 calcium gluconate Substances 0.000 description 1
- 229960004494 calcium gluconate Drugs 0.000 description 1
- UHHRFSOMMCWGSO-UHFFFAOYSA-L calcium glycerophosphate Chemical compound [Ca+2].OCC(CO)OP([O-])([O-])=O UHHRFSOMMCWGSO-UHFFFAOYSA-L 0.000 description 1
- 229940095618 calcium glycerophosphate Drugs 0.000 description 1
- 235000019299 calcium glycerylphosphate Nutrition 0.000 description 1
- MKJXYGKVIBWPFZ-UHFFFAOYSA-L calcium lactate Chemical compound [Ca+2].CC(O)C([O-])=O.CC(O)C([O-])=O MKJXYGKVIBWPFZ-UHFFFAOYSA-L 0.000 description 1
- 239000001527 calcium lactate Substances 0.000 description 1
- 235000011086 calcium lactate Nutrition 0.000 description 1
- 229960002401 calcium lactate Drugs 0.000 description 1
- 229940078480 calcium levulinate Drugs 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 235000011132 calcium sulphate Nutrition 0.000 description 1
- FATUQANACHZLRT-XBQZYUPDSA-L calcium;(2r,3r,4s,5r,6r)-2,3,4,5,6,7-hexahydroxyheptanoate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C([O-])=O FATUQANACHZLRT-XBQZYUPDSA-L 0.000 description 1
- OKRXSXDSNLJCRS-NLOQLBMISA-L calcium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;(2r,3r,4r,5r)-2,3,5,6-tetrahydroxy-4-[(2s,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanoate;hydrate Chemical compound O.[Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O.[O-]C(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O OKRXSXDSNLJCRS-NLOQLBMISA-L 0.000 description 1
- NEEHYRZPVYRGPP-UHFFFAOYSA-L calcium;2,3,4,5,6-pentahydroxyhexanoate Chemical compound [Ca+2].OCC(O)C(O)C(O)C(O)C([O-])=O.OCC(O)C(O)C(O)C(O)C([O-])=O NEEHYRZPVYRGPP-UHFFFAOYSA-L 0.000 description 1
- 125000002680 canonical nucleotide group Chemical group 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 229940096529 carboxypolymethylene Drugs 0.000 description 1
- 229940044199 carnosine Drugs 0.000 description 1
- CQOVPNPJLQNMDC-ZETCQYMHSA-N carnosine Chemical compound [NH3+]CCC(=O)N[C@H](C([O-])=O)CC1=CNC=N1 CQOVPNPJLQNMDC-ZETCQYMHSA-N 0.000 description 1
- 235000010418 carrageenan Nutrition 0.000 description 1
- 239000000679 carrageenan Substances 0.000 description 1
- 229920001525 carrageenan Polymers 0.000 description 1
- 229940113118 carrageenan Drugs 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 235000019438 castor oil Nutrition 0.000 description 1
- 239000003729 cation exchange resin Substances 0.000 description 1
- 229940023913 cation exchange resins Drugs 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000005889 cellular cytotoxicity Effects 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229960000800 cetrimonium bromide Drugs 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 229960002242 chlorocresol Drugs 0.000 description 1
- 229960005443 chloroxylenol Drugs 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 235000017803 cinnamon Nutrition 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 229960004106 citric acid Drugs 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229960002303 citric acid monohydrate Drugs 0.000 description 1
- 235000020971 citrus fruits Nutrition 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000003759 clinical diagnosis Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 235000019516 cod Nutrition 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004590 computer program Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 235000012343 cottonseed oil Nutrition 0.000 description 1
- 229930003836 cresol Natural products 0.000 description 1
- 229940013361 cresol Drugs 0.000 description 1
- 229960005168 croscarmellose Drugs 0.000 description 1
- 229960000913 crospovidone Drugs 0.000 description 1
- 235000010947 crosslinked sodium carboxy methyl cellulose Nutrition 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 229940097362 cyclodextrins Drugs 0.000 description 1
- HCAJEUSONLESMK-UHFFFAOYSA-N cyclohexylsulfamic acid Chemical compound OS(=O)(=O)NC1CCCCC1 HCAJEUSONLESMK-UHFFFAOYSA-N 0.000 description 1
- 229940086555 cyclomethicone Drugs 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 235000019258 dehydroacetic acid Nutrition 0.000 description 1
- 229940061632 dehydroacetic acid Drugs 0.000 description 1
- PGRHXDWITVMQBC-UHFFFAOYSA-N dehydroacetic acid Natural products CC(=O)C1C(=O)OC(C)=CC1=O PGRHXDWITVMQBC-UHFFFAOYSA-N 0.000 description 1
- JEQRBTDTEKWZBW-UHFFFAOYSA-N dehydroacetic acid Chemical compound CC(=O)C1=C(O)OC(C)=CC1=O JEQRBTDTEKWZBW-UHFFFAOYSA-N 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 229940111685 dibasic potassium phosphate Drugs 0.000 description 1
- 229940061607 dibasic sodium phosphate Drugs 0.000 description 1
- CGMRCMMOCQYHAD-UHFFFAOYSA-J dicalcium hydroxide phosphate Chemical compound [OH-].[Ca++].[Ca++].[O-]P([O-])([O-])=O CGMRCMMOCQYHAD-UHFFFAOYSA-J 0.000 description 1
- 229940095079 dicalcium phosphate anhydrous Drugs 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 229940008099 dimethicone Drugs 0.000 description 1
- 239000004205 dimethyl polysiloxane Substances 0.000 description 1
- 235000013870 dimethyl polysiloxane Nutrition 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 235000019329 dioctyl sodium sulphosuccinate Nutrition 0.000 description 1
- ZPWVASYFFYYZEW-UHFFFAOYSA-L dipotassium hydrogen phosphate Chemical compound [K+].[K+].OP([O-])([O-])=O ZPWVASYFFYYZEW-UHFFFAOYSA-L 0.000 description 1
- KCIDZIIHRGYJAE-YGFYJFDDSA-L dipotassium;[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl] phosphate Chemical compound [K+].[K+].OC[C@H]1O[C@H](OP([O-])([O-])=O)[C@H](O)[C@@H](O)[C@H]1O KCIDZIIHRGYJAE-YGFYJFDDSA-L 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- WSDISUOETYTPRL-UHFFFAOYSA-N dmdm hydantoin Chemical compound CC1(C)N(CO)C(=O)N(CO)C1=O WSDISUOETYTPRL-UHFFFAOYSA-N 0.000 description 1
- 229960000878 docusate sodium Drugs 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000009510 drug design Methods 0.000 description 1
- 239000003221 ear drop Substances 0.000 description 1
- 229940047652 ear drops Drugs 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 235000013345 egg yolk Nutrition 0.000 description 1
- 210000002969 egg yolk Anatomy 0.000 description 1
- 230000005518 electrochemistry Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 230000001804 emulsifying effect Effects 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000002702 enteric coating Substances 0.000 description 1
- 238000009505 enteric coating Methods 0.000 description 1
- 230000004890 epithelial barrier function Effects 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229940093499 ethyl acetate Drugs 0.000 description 1
- 235000019325 ethyl cellulose Nutrition 0.000 description 1
- 229920001249 ethyl cellulose Polymers 0.000 description 1
- 229960001617 ethyl hydroxybenzoate Drugs 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 235000010228 ethyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004403 ethyl p-hydroxybenzoate Substances 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- NUVBSKCKDOMJSU-UHFFFAOYSA-N ethylparaben Chemical compound CCOC(=O)C1=CC=C(O)C=C1 NUVBSKCKDOMJSU-UHFFFAOYSA-N 0.000 description 1
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 235000019688 fish Nutrition 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000004426 flaxseed Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 229960002598 fumaric acid Drugs 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 208000016361 genetic disease Diseases 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 229940113087 geraniol Drugs 0.000 description 1
- 235000012208 gluconic acid Nutrition 0.000 description 1
- 229950006191 gluconic acid Drugs 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 1
- 229960005150 glycerol Drugs 0.000 description 1
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 1
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 1
- 125000003976 glyceryl group Chemical group [H]C([*])([H])C(O[H])([H])C(O[H])([H])[H] 0.000 description 1
- 229940075507 glyceryl monostearate Drugs 0.000 description 1
- 239000001087 glyceryl triacetate Substances 0.000 description 1
- 235000013773 glyceryl triacetate Nutrition 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 229940087559 grape seed Drugs 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- LHGVFZTZFXWLCP-UHFFFAOYSA-N guaiacol Chemical class COC1=CC=CC=C1O LHGVFZTZFXWLCP-UHFFFAOYSA-N 0.000 description 1
- 235000010417 guar gum Nutrition 0.000 description 1
- 239000000665 guar gum Substances 0.000 description 1
- 229960002154 guar gum Drugs 0.000 description 1
- 235000019314 gum ghatti Nutrition 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 229910052736 halogen Inorganic materials 0.000 description 1
- 150000002367 halogens Chemical class 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000004458 heterochromatin Anatomy 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- 229960004867 hexetidine Drugs 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 239000010903 husk Substances 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 150000002430 hydrocarbons Chemical group 0.000 description 1
- 239000008172 hydrogenated vegetable oil Substances 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- ZCTXEAQXZGPWFG-UHFFFAOYSA-N imidurea Chemical compound O=C1NC(=O)N(CO)C1NC(=O)NCNC(=O)NC1C(=O)NC(=O)N1CO ZCTXEAQXZGPWFG-UHFFFAOYSA-N 0.000 description 1
- 229940113174 imidurea Drugs 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 125000003392 indanyl group Chemical group C1(CCC2=CC=CC=C12)* 0.000 description 1
- 125000003454 indenyl group Chemical group C1(C=CC2=CC=CC=C12)* 0.000 description 1
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- CDAISMWEOUEBRE-GPIVLXJGSA-N inositol Chemical compound O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](O)[C@@H]1O CDAISMWEOUEBRE-GPIVLXJGSA-N 0.000 description 1
- 229960000367 inositol Drugs 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 230000002601 intratumoral effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 125000002346 iodo group Chemical group I* 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003253 isopropoxy group Chemical group [H]C([H])([H])C([H])(O*)C([H])([H])[H] 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 229940090046 jet injector Drugs 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000000832 lactitol Substances 0.000 description 1
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 description 1
- 235000010448 lactitol Nutrition 0.000 description 1
- 229960003451 lactitol Drugs 0.000 description 1
- 244000056931 lavandin Species 0.000 description 1
- 235000009606 lavandin Nutrition 0.000 description 1
- 239000001102 lavandula vera Substances 0.000 description 1
- 235000018219 lavender Nutrition 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 235000005772 leucine Nutrition 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000000865 liniment Substances 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 210000005228 liver tissue Anatomy 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- VTHJTEIRLNZDEV-UHFFFAOYSA-L magnesium dihydroxide Chemical compound [OH-].[OH-].[Mg+2] VTHJTEIRLNZDEV-UHFFFAOYSA-L 0.000 description 1
- 239000000347 magnesium hydroxide Substances 0.000 description 1
- 229910001862 magnesium hydroxide Inorganic materials 0.000 description 1
- 229960000816 magnesium hydroxide Drugs 0.000 description 1
- 229940037627 magnesium lauryl sulfate Drugs 0.000 description 1
- HBNDBUATLJAUQM-UHFFFAOYSA-L magnesium;dodecyl sulfate Chemical compound [Mg+2].CCCCCCCCCCCCOS([O-])(=O)=O.CCCCCCCCCCCCOS([O-])(=O)=O HBNDBUATLJAUQM-UHFFFAOYSA-L 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000031852 maintenance of location in cell Effects 0.000 description 1
- 238000013178 mathematical model Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 235000013379 molasses Nutrition 0.000 description 1
- 239000001788 mono and diglycerides of fatty acids Substances 0.000 description 1
- 229940111688 monobasic potassium phosphate Drugs 0.000 description 1
- 229940045641 monobasic sodium phosphate Drugs 0.000 description 1
- 125000002950 monocyclic group Chemical group 0.000 description 1
- RZRNAYUHWVFMIP-UHFFFAOYSA-N monoelaidin Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC(O)CO RZRNAYUHWVFMIP-UHFFFAOYSA-N 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 235000019799 monosodium phosphate Nutrition 0.000 description 1
- 229910000403 monosodium phosphate Inorganic materials 0.000 description 1
- PJUIMOJAAPLTRJ-UHFFFAOYSA-N monothioglycerol Chemical compound OCC(O)CS PJUIMOJAAPLTRJ-UHFFFAOYSA-N 0.000 description 1
- DUWWHGPELOTTOE-UHFFFAOYSA-N n-(5-chloro-2,4-dimethoxyphenyl)-3-oxobutanamide Chemical compound COC1=CC(OC)=C(NC(=O)CC(C)=O)C=C1Cl DUWWHGPELOTTOE-UHFFFAOYSA-N 0.000 description 1
- SYSQUGFVNFXIIT-UHFFFAOYSA-N n-[4-(1,3-benzoxazol-2-yl)phenyl]-4-nitrobenzenesulfonamide Chemical class C1=CC([N+](=O)[O-])=CC=C1S(=O)(=O)NC1=CC=C(C=2OC3=CC=CC=C3N=2)C=C1 SYSQUGFVNFXIIT-UHFFFAOYSA-N 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- GOQYKNQRPGWPLP-UHFFFAOYSA-N n-heptadecyl alcohol Natural products CCCCCCCCCCCCCCCCCO GOQYKNQRPGWPLP-UHFFFAOYSA-N 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003506 n-propoxy group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])O* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 229940097496 nasal spray Drugs 0.000 description 1
- 239000007922 nasal spray Substances 0.000 description 1
- 238000002663 nebulization Methods 0.000 description 1
- 125000001971 neopentyl group Chemical group [H]C([*])([H])C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 231100000344 non-irritating Toxicity 0.000 description 1
- 239000012457 nonaqueous media Substances 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000001702 nutmeg Substances 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- KSCKTBJJRVPGKM-UHFFFAOYSA-N octan-1-olate;titanium(4+) Chemical compound [Ti+4].CCCCCCCC[O-].CCCCCCCC[O-].CCCCCCCC[O-].CCCCCCCC[O-] KSCKTBJJRVPGKM-UHFFFAOYSA-N 0.000 description 1
- 229960002969 oleic acid Drugs 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 229940041678 oral spray Drugs 0.000 description 1
- 239000000668 oral spray Substances 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 235000020232 peanut Nutrition 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 150000002972 pentoses Chemical class 0.000 description 1
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 125000001792 phenanthrenyl group Chemical group C1(=CC=CC=2C3=CC=CC=C3C=CC12)* 0.000 description 1
- 150000002989 phenols Chemical class 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- PDTFCHSETJBPTR-UHFFFAOYSA-N phenylmercuric nitrate Chemical compound [O-][N+](=O)O[Hg]C1=CC=CC=C1 PDTFCHSETJBPTR-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 229960004838 phosphoric acid Drugs 0.000 description 1
- 235000011007 phosphoric acid Nutrition 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical group 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000000467 phytic acid Substances 0.000 description 1
- 229940068041 phytic acid Drugs 0.000 description 1
- 235000002949 phytic acid Nutrition 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229920000435 poly(dimethylsiloxane) Polymers 0.000 description 1
- 239000004584 polyacrylic acid Substances 0.000 description 1
- 125000003367 polycyclic group Chemical group 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 229920000259 polyoxyethylene lauryl ether Polymers 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068965 polysorbates Drugs 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229940068984 polyvinyl alcohol Drugs 0.000 description 1
- 235000013809 polyvinylpolypyrrolidone Nutrition 0.000 description 1
- 229920000523 polyvinylpolypyrrolidone Polymers 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 210000003240 portal vein Anatomy 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229960003975 potassium Drugs 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 235000007686 potassium Nutrition 0.000 description 1
- 235000011056 potassium acetate Nutrition 0.000 description 1
- 229960004109 potassium acetate Drugs 0.000 description 1
- XAEFZNCEHLXOMS-UHFFFAOYSA-M potassium benzoate Chemical compound [K+].[O-]C(=O)C1=CC=CC=C1 XAEFZNCEHLXOMS-UHFFFAOYSA-M 0.000 description 1
- 235000010235 potassium benzoate Nutrition 0.000 description 1
- 239000004300 potassium benzoate Substances 0.000 description 1
- 229940103091 potassium benzoate Drugs 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 239000004224 potassium gluconate Substances 0.000 description 1
- 235000013926 potassium gluconate Nutrition 0.000 description 1
- 229960003189 potassium gluconate Drugs 0.000 description 1
- 229940096992 potassium oleate Drugs 0.000 description 1
- 229940093916 potassium phosphate Drugs 0.000 description 1
- 229910000160 potassium phosphate Inorganic materials 0.000 description 1
- 235000011009 potassium phosphates Nutrition 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- BHZRJJOHZFYXTO-UHFFFAOYSA-L potassium sulfite Chemical compound [K+].[K+].[O-]S([O-])=O BHZRJJOHZFYXTO-UHFFFAOYSA-L 0.000 description 1
- 235000019252 potassium sulphite Nutrition 0.000 description 1
- MLICVSDCCDDWMD-KVVVOXFISA-M potassium;(z)-octadec-9-enoate Chemical compound [K+].CCCCCCCC\C=C/CCCCCCCC([O-])=O MLICVSDCCDDWMD-KVVVOXFISA-M 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229920003124 powdered cellulose Polymers 0.000 description 1
- 235000019814 powdered cellulose Nutrition 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 125000004368 propenyl group Chemical group C(=CC)* 0.000 description 1
- 229940095574 propionic acid Drugs 0.000 description 1
- 239000000473 propyl gallate Substances 0.000 description 1
- 235000010388 propyl gallate Nutrition 0.000 description 1
- 229940075579 propyl gallate Drugs 0.000 description 1
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229940093625 propylene glycol monostearate Drugs 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 125000002568 propynyl group Chemical group [*]C#CC([H])([H])[H] 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000005588 protonation Effects 0.000 description 1
- 235000020236 pumpkin seed Nutrition 0.000 description 1
- 125000000714 pyrimidinyl group Chemical group 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 210000000664 rectum Anatomy 0.000 description 1
- 230000037425 regulation of transcription Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 239000003340 retarding agent Substances 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 235000009566 rice Nutrition 0.000 description 1
- 229940085605 saccharin sodium Drugs 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- CDAISMWEOUEBRE-UHFFFAOYSA-N scyllo-inosotol Natural products OC1C(O)C(O)C(O)C(O)C1O CDAISMWEOUEBRE-UHFFFAOYSA-N 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 229940057910 shea butter Drugs 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000377 silicon dioxide Substances 0.000 description 1
- 229920002545 silicone oil Polymers 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 235000010378 sodium ascorbate Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 1
- 229960005055 sodium ascorbate Drugs 0.000 description 1
- 229960003885 sodium benzoate Drugs 0.000 description 1
- AJPJDKMHJJGVTQ-UHFFFAOYSA-M sodium dihydrogen phosphate Chemical compound [Na+].OP(O)([O-])=O AJPJDKMHJJGVTQ-UHFFFAOYSA-M 0.000 description 1
- APSBXTVYXVQYAB-UHFFFAOYSA-M sodium docusate Chemical compound [Na+].CCCCC(CC)COC(=O)CC(S([O-])(=O)=O)C(=O)OCC(CC)CCCC APSBXTVYXVQYAB-UHFFFAOYSA-M 0.000 description 1
- 229940037001 sodium edetate Drugs 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- JXKPEJDQGNYQSM-UHFFFAOYSA-M sodium propionate Chemical compound [Na+].CCC([O-])=O JXKPEJDQGNYQSM-UHFFFAOYSA-M 0.000 description 1
- 235000010334 sodium propionate Nutrition 0.000 description 1
- 239000004324 sodium propionate Substances 0.000 description 1
- 229960003212 sodium propionate Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 235000011069 sorbitan monooleate Nutrition 0.000 description 1
- 239000001593 sorbitan monooleate Substances 0.000 description 1
- 229940035049 sorbitan monooleate Drugs 0.000 description 1
- 235000011071 sorbitan monopalmitate Nutrition 0.000 description 1
- 239000001570 sorbitan monopalmitate Substances 0.000 description 1
- 229940031953 sorbitan monopalmitate Drugs 0.000 description 1
- 235000011076 sorbitan monostearate Nutrition 0.000 description 1
- 239000001587 sorbitan monostearate Substances 0.000 description 1
- 229940035048 sorbitan monostearate Drugs 0.000 description 1
- 235000011078 sorbitan tristearate Nutrition 0.000 description 1
- 239000001589 sorbitan tristearate Substances 0.000 description 1
- 229960004129 sorbitan tristearate Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 230000003595 spectral effect Effects 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 229940012831 stearyl alcohol Drugs 0.000 description 1
- 230000000707 stereoselective effect Effects 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 239000003206 sterilizing agent Substances 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 210000000434 stratum corneum Anatomy 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- BSYVTEYKTMYBMK-UHFFFAOYSA-N tetrahydrofurfuryl alcohol Chemical compound OCC1CCCO1 BSYVTEYKTMYBMK-UHFFFAOYSA-N 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 229960000984 tocofersolan Drugs 0.000 description 1
- 235000010384 tocopherol Nutrition 0.000 description 1
- 229930003799 tocopherol Natural products 0.000 description 1
- 239000011732 tocopherol Substances 0.000 description 1
- 229960001295 tocopherol Drugs 0.000 description 1
- 229940042585 tocopherol acetate Drugs 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960002622 triacetin Drugs 0.000 description 1
- 235000013337 tricalcium citrate Nutrition 0.000 description 1
- 235000019731 tricalcium phosphate Nutrition 0.000 description 1
- LADGBHLMCUINGV-UHFFFAOYSA-N tricaprin Chemical compound CCCCCCCCCC(=O)OCC(OC(=O)CCCCCCCCC)COC(=O)CCCCCCCCC LADGBHLMCUINGV-UHFFFAOYSA-N 0.000 description 1
- 229940117013 triethanolamine oleate Drugs 0.000 description 1
- VLPFTAMPNXLGLX-UHFFFAOYSA-N trioctanoin Chemical compound CCCCCCCC(=O)OCC(OC(=O)CCCCCCC)COC(=O)CCCCCCC VLPFTAMPNXLGLX-UHFFFAOYSA-N 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 229960005066 trisodium edetate Drugs 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 230000006453 vascular barrier function Effects 0.000 description 1
- 239000010679 vetiver oil Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 239000011719 vitamin A Substances 0.000 description 1
- 235000019155 vitamin A Nutrition 0.000 description 1
- 235000019154 vitamin C Nutrition 0.000 description 1
- 239000011718 vitamin C Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 229940045997 vitamin a Drugs 0.000 description 1
- 239000000341 volatile oil Substances 0.000 description 1
- 235000020234 walnut Nutrition 0.000 description 1
- 239000008170 walnut oil Substances 0.000 description 1
- 239000010497 wheat germ oil Substances 0.000 description 1
- 239000002023 wood Substances 0.000 description 1
- 210000002268 wool Anatomy 0.000 description 1
- 230000003936 working memory Effects 0.000 description 1
- 229920001285 xanthan gum Polymers 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- UHVMMEOXYDMDKI-JKYCWFKZSA-L zinc;1-(5-cyanopyridin-2-yl)-3-[(1s,2s)-2-(6-fluoro-2-hydroxy-3-propanoylphenyl)cyclopropyl]urea;diacetate Chemical compound [Zn+2].CC([O-])=O.CC([O-])=O.CCC(=O)C1=CC=C(F)C([C@H]2[C@H](C2)NC(=O)NC=2N=CC(=CC=2)C#N)=C1O UHVMMEOXYDMDKI-JKYCWFKZSA-L 0.000 description 1
- 235000004835 α-tocopherol Nutrition 0.000 description 1
- 239000002076 α-tocopherol Substances 0.000 description 1
- OENHQHLEOONYIE-JLTXGRSLSA-N β-Carotene Chemical compound CC=1CCCC(C)(C)C=1\C=C\C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C OENHQHLEOONYIE-JLTXGRSLSA-N 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
- A61K48/0066—Manipulation of the nucleic acid to modify its expression pattern, e.g. enhance its duration of expression, achieved by the presence of particular introns in the delivered nucleic acid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H19/00—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof
- C07H19/02—Compounds containing a hetero ring sharing one ring hetero atom with a saccharide radical; Nucleosides; Mononucleotides; Anhydro-derivatives thereof sharing nitrogen
- C07H19/04—Heterocyclic radicals containing only nitrogen atoms as ring hetero atom
- C07H19/06—Pyrimidine radicals
- C07H19/10—Pyrimidine radicals with the saccharide radical esterified by phosphoric or polyphosphoric acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07H—SUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
- C07H21/00—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
- C07H21/02—Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1136—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/67—General methods for enhancing the expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/558—Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody
- G01N33/559—Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody through a gel, e.g. Ouchterlony technique
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/33—Chemical structure of the base
- C12N2310/334—Modified C
- C12N2310/3341—5-Methylcytosine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/33—Chemical structure of the base
- C12N2310/335—Modified T or U
Definitions
- RNAs are synthesized from four basic ribonucleotides: ATP, CTP, UTP and GTP, but may contain post-transcriptionally modified nucleotides. Further, approximately one hundred different nucleoside modifications have been identified in RNA (Rozenski, J, Crain, P, and McCloskey, J. (1999). The RNA Modification Database: 1999 update. Nucl Acids Res 27: 196-197). The role of nucleoside modifications on the immuno-stimulatory potential, stability, and on the translation efficiency of RNA, and the consequent benefits to this for enhancing protein expression and producing therapeutics however, is unclear.
- heterologous deoxyribonucleic acid (DNA) introduced into a cell can be inherited by daughter cells (whether or not the heterologous DNA has integrated into the chromosome) or by offspring. Introduced DNA can integrate into host cell genomic DNA at some frequency, resulting in alterations and/or damage to the host cell genomic DNA.
- multiple steps must occur before a protein is made. Once inside the cell, DNA must be transported into the nucleus where it is transcribed into RNA. The RNA transcribed from DNA must then enter the cytoplasm where it is translated into protein. This need for multiple processing steps creates lag times before the generation of a protein of interest. Further, it is difficult to obtain DNA expression in cells; frequently DNA enters cells but is not expressed or not expressed at reasonable rates or concentrations. This can be a particular problem when DNA is introduced into cells such as primary cells or modified cell lines.
- modified nucleosides modified nucleotides, and modified nucleic acids which can exhibit a reduced innate immune response when introduced into a population of cells, both in vivo and ex vivo.
- these modified nucleosides, modified nucleotides, and modified nucleic acids described herein can disrupt binding of a major groove interacting partner with the nucleic acid. Because of the reduced immunogenicity and the decrease in major groove interactions, these modified nucleosides, modified nucleotides, and modified nucleic acids can be more efficient during protein production than, e.g., unmodified nucleic acids.
- the present disclosure provides compounds comprising nucleotides that can disrupt binding of a major groove binding partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to the major groove binding partner.
- the present disclosure further provides nucleic acid sequences of at least two nucleotides comprising a compound of Formula I-d:
- compositions comprising at least one compound of Formula I.
- the present disclosure further provides pharmaceutical compositions comprising a compound of Formula I.
- the present disclosure further provides methods of preparing nucleic acid sequences of at least two nucleotides of a compound of Formula I-d.
- the present disclosure further provides methods of amplifying nucleic acid sequences of at least two nucleotides of a compound of Formula I-d.
- kits comprising a compound of Formula I.
- FIGS. 1A and 1B depict images of non-denaturing agarose gels of each in vitro-transcribed modified RNA.
- FIGS. 2A and 2B depict images of an Enzyme-linked immunosorbent assay (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) of in vitro transfected Human Keratinocyte cells with each indicated modRNA encoding human G-CSF and the line indicates a saturating level of maximum detectable limit of secreted G-CSF in the assay.
- ELISA Enzyme-linked immunosorbent assay
- G-CSF Granulocyte-Colony Stimulating Factor
- FIGS. 3A-N depict line graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) secreted from in vitro-transfected Human Keratinocyte cells at different time points with each indicated human G-CSF-encoding modRNA at the indicated doses.
- the line indicates a saturating level of maximum detectable limit of secreted G-CSF in the assay.
- FIGS. 4A and 4B depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for endogenous cellular human Tumor Necrosis Factor- ⁇ (TNF- ⁇ ) secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses.
- ELISA Enzyme-linked immunosorbent assays
- FIGS. 4C and 4D depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for endogenous cellular human Interferon- ⁇ (IFN- ⁇ ) secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses.
- ELISA Enzyme-linked immunosorbent assays
- FIGS. 4E and 4F depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses.
- ELISA Enzyme-linked immunosorbent assays
- FIG. 5A is a table showing results from an Enzyme-linked immunosorbent assay (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells sampled from individual wells in a co-culture 24-well tissue culture plate 42 hours post-transfection with 750 ng of each indicated hu-G-CSF-encoding modRNA.
- ELISA Enzyme-linked immunosorbent assay
- FIG. 5B depicts an image of an agarose gel of RT-PCR hu-G-CSF modRNA products from co-culture cell extracts 42 hours post-transfection of the human keratinocyte feeder layer with hu-G-CSG modRNA and the un-transfected Kasumi-1 and KG-1 insert culture cells.
- FIGS. 5C and 5D depict graphs of results from a hu-G-CSF-modRNA-induced cell proliferation assay of Kasumi-1 ( FIG. 5C ) and KG-1 ( FIG. 5D ) cells normalized to untransfected cells.
- Hu-G-CSF modRNA identity transfected into human keratinocyte feeder cells is indicated.
- FIGS. 6A-L depict graphs of the UV absorbance spectra for exemplary modRNA molecules that incorporate the indicated modified nucleotide.
- the present disclosure provides, inter alia, modified nucleosides, modified nucleotides, and modified nucleic acids that exhibit a reduced innate immune response when introduced into a population of cells.
- the modified nucleosides, modified nucleotides, and modified nucleic acids can be chemically modified on the major groove face, thereby disrupting major groove binding partner interactions, which cause innate immune responses.
- exogenous unmodified nucleic acids particularly viral nucleic acids
- IFN interferon
- RNA ribonucleic acid
- nucleic acids characterized by integration into a target cell are generally imprecise in their expression levels, deleteriously transferable to progeny and neighbor cells, and suffer from the substantial risk of causing mutation.
- nucleic acids encoding useful polypeptides capable of modulating a cell's function and/or activity are provided herein in part, and methods of making and using these nucleic acids and polypeptides. As described herein, these nucleic acids are capable of reducing the innate immune activity of a population of cells into which they are introduced, thus increasing the efficiency of protein production in that cell population. Further, one or more additional advantageous activities and/or properties of the nucleic acids and proteins of the present disclosure are described.
- modified nucleosides, modified nucleotides, and modified nucleic acids described herein can be modified on the major groove face. These major groove modifications can allow for alterations, e.g. a decrease, in the interaction of the modified nucleosides, modified nucleotides, and modified nucleic acids with a binding groove partner.
- the present disclosure provides compounds comprising a nucleotide that can disrupts binding of a major groove interacting, e.g. binding, partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to major groove interacting, e.g. binding, partners.
- the present disclosure provides compounds comprising a nucleotide that contains chemical modifications, wherein the nucleotide can have altered binding to major groove interacting, e.g. binding, partners.
- the chemical modifications are located on the major groove face of the nucleobase, and wherein the chemical modifications can include replacing or substituting an atom of a pyrimidine nucleobase with an amine, an SH, an alkyl (e.g., methyl or ethyl), or a halo (e.g., chloro or fluoro).
- the chemical modifications can be located on the major groove face of the nucleobase, and wherein the chemical modification can include replacing or substituting an atom of a pyrimidine nucleobase with an amine, an SH, a methyl or ethyl, or a chloro or fluoro.
- the chemical modifications can be located on the sugar moiety of the nucleotide.
- the chemical modifications can be located on the phosphate backbone of the nucleotide.
- the chemical modifications can alter the electrochemistry on the major groove face of the nucleotide.
- the present disclosure provides nucleotides that contain chemical modifications, wherein the nucleotide reduces the cellular innate immune response, as compared to the cellular innate immune induced by a corresponding unmodified nucleic acid.
- the present disclosure provides nucleic acid sequences comprising at least two nucleotides, the nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove interacting partner with the nucleic acid sequence, wherein the nucleotide has decreased binding affinity to the major groove binding partner.
- compositions comprising a compound as described herein.
- the composition is a reaction mixture.
- the composition is a pharmaceutical composition.
- the composition is a cell culture.
- compositions further comprise an RNA polymerase and a cDNA template.
- compositions further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- the present disclosure provides for methods of synthesizing a pharmaceutical nucleic acid, comprising providing a complementary deoxyribonucleic acid (cDNA) that encodes a pharmaceutical protein of interest; selecting a nucleotide that is known to disrupt a binding of a major groove binding partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to the major groove binding partner; and contacting the provided cDNA and the selected nucleotide with an RNA polymerase, under conditions such that the pharmaceutical nucleic acid is synthesized.
- cDNA complementary deoxyribonucleic acid
- the pharmaceutical nucleic acid is a ribonucleic acid (RNA).
- the present disclosure provides for methods of making a pharmaceutical formulation comprising a physiologically active secreted protein, comprising transfecting a first population of human cells with a pharmaceutical nucleic acid made by the methods described herein, wherein the secreted protein is active upon a second population of human cells.
- the secreted protein is capable of interacting, e.g. binding, with a receptor on the surface of at least one cell present in the second population.
- the secreted protein is Granulocyte-Colony Stimulating Factor (G-CSF).
- G-CSF Granulocyte-Colony Stimulating Factor
- the second population contains myeloblast cells that express the G-CSF receptor.
- the present disclosure provides for methods of making a pharmaceutical formulation comprising human cells comprising a physiologically active secreted protein, comprising transfecting a first population of human cells with a pharmaceutical nucleic acid made by the methods described herein, wherein the secreted protein is active upon a second population of human cells.
- substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges.
- C 1-6 alkyl is specifically intended to individually disclose methyl, ethyl, C 3 alkyl, C 4 alkyl, C 5 alkyl, and C 6 alkyl.
- stable refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
- alkyl is meant to refer to a saturated hydrocarbon group which is straight-chained or branched.
- Example alkyl groups include methyl (Me), ethyl (Et), propyl (e.g., n-propyl and isopropyl), butyl (e.g., n-butyl, isobutyl, t-butyl), pentyl (e.g., n-pentyl, isopentyl, neopentyl), and the like.
- An alkyl group can contain from 1 to about 20, from 2 to about 20, from 1 to about 12, from 1 to about 8, from 1 to about 6, from 1 to about 4, or from 1 to about 3 carbon atoms.
- alkenyl refers to an alkyl group having one or more double carbon-carbon bonds.
- Example alkenyl groups include ethenyl, propenyl, and the like.
- alkoxy refers to an —O-alkyl group.
- Example alkoxy groups include methoxy, ethoxy, propoxy (e.g., n-propoxy and isopropoxy), t-butoxy, and the like.
- alkynyl refers to an alkyl group having one or more triple carbon-carbon bonds.
- Example alkynyl groups include ethynyl, propynyl, and the like.
- aryl refers to monocyclic or polycyclic (e.g., having 2, 3 or 4 fused rings) aromatic hydrocarbons such as, for example, phenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, indenyl, and the like. In some embodiments, aryl groups have from 6 to about 20 carbon atoms.
- halo or “halogen” includes fluoro, chloro, bromo, and iodo.
- therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
- animal refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.
- the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- association with means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions.
- biologically active refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active.
- a nucleic acid is biologically active
- a portion of that nucleic acid that shares at least one biological activity of the whole nucleic acid is typically referred to as a “biologically active” portion.
- conserved refers to nucleotides or amino acid residues of a polynucleotide sequence or amino acid sequence, respectively, that are those that occur unaltered in the same position of two or more related sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences. In some embodiments, two or more sequences are said to be “completely conserved” if they are 100% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
- two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
- two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another.
- expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
- a “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
- in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
- in vivo refers to events that occur within an organism (e.g., animal, plant, or microbe).
- isolated refers to a substance or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and/or (2) produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is “pure” if it is substantially free of other components.
- subject or “patient” refers to any organism to which a composition in accordance with the present disclosure may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes.
- Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
- substantially refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
- biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
- the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- An individual who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition.
- an individual who is “susceptible to” a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition.
- an individual who is susceptible to a disease, disorder, and/or condition may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition.
- an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
- therapeutically effective amount means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
- agent to be delivered e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.
- transcription factor refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
- treating refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular disease, disorder, and/or condition.
- “treating” cancer may refer to inhibiting survival, growth, and/or spread of a tumor.
- Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
- treatment comprises delivery of a protein associated with a therapeutically active nucleic acid to a subject in need thereof.
- unmodified refers to a nucleic acid prior to being modified, e.g. adenosine, guanosine, cytosine, thymidine, and uracil, or a naturally occurring amino acid.
- the compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated.
- Compounds of the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis.
- Tautomeric forms result from the swapping of a single bond with an adjacent double bond together with the concomitant migration of a proton.
- Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge.
- Example prototropic tautomers include ketone—enol pairs, amide—imidic acid pairs, lactam—lactim pairs, amide—imidic acid pairs, enamine—imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, for example, 1H- and 3H-imidazole, 1H-, 2H- and 4H-1,2,4-triazole, 1H- and 2H-isoindole, and 1H- and 2H-pyrazole.
- Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
- Compounds of the present disclosure can also include all isotopes of atoms occurring in the intermediates or final compounds.
- Isotopes include those atoms having the same atomic number but different mass numbers.
- isotopes of hydrogen include tritium and deuterium.
- compound as used herein, is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted.
- the compounds of the present disclosure are substantially isolated.
- substantially isolated is meant that the compound is at least partially or substantially separated from the environment in which it was formed or detected.
- Partial separation can include, for example, a composition enriched in the compound of the present disclosure.
- Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
- the compounds of the present disclosure, and salts thereof, can also be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
- the present disclosure also includes pharmaceutically acceptable salts of the compounds described herein.
- pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form.
- examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
- the pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
- the pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods.
- such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17 th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418 and Journal of Pharmaceutical Science, 66, 2 (1977), each of which is incorporated herein by reference in its entirety.
- phrases “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- prodrugs refer to any carriers, typically covalently bonded, which release the active parent drug when administered to a mammalian subject.
- Prodrugs can be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds.
- Prodrugs include compounds wherein hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any group that, when administered to a mammalian subject, cleaves to form a free hydroxyl, amino, sulfhydryl, or carboxyl group respectively.
- prodrugs include, but are not limited to, acetate, formate and benzoate derivatives of alcohol and amine functional groups in the compounds of the present disclosure. Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, “Pro-drugs as Novel Delivery Systems,” Vol. 14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in Drug Design , ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987, both of which are hereby incorporated by reference in their entirety.
- nucleoside is defined as a compound containing a five-carbon sugar molecule (a pentose or ribose) or derivative thereof, and an organic base, purine or pyrimidine, or a derivative thereof.
- nucleotide is defined as a nucleoside consisting of a phosphate group.
- the nucleosides and nucleotides described herein are generally chemically modified on the major groove face.
- the major groove chemical modifications can include an amino group, a thiol group, an alkyl group, or a halo group.
- Table 1 below identifies the chemical faces of each canonical nucleotide. Circles identify the atoms comprising the respective chemical regions.
- modified nucleosides include pyridin-4-one ribonucleoside, 5-aza-uridine, 2-thio-5-aza-uridine, 2-thiouridine, 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxyuridine, 3-methyluridine, 5-carboxymethyl-uridine, 1-carboxymethyl-pseudouridine, 5-propynyl-uridine, 1-propynyl-pseudouridine, 5-taurinomethyluridine, 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine, 1-taurinomethyl-4-thio-uridine, 5-methyl-uridine, 1-methyl-pseudouridine, 4-thio-1-methyl-pseudouridine, 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-1-methyl-1-
- modified nucleosides include 5-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine, N4-acetylcytidine, 5-formylcytidine, N4-methylcytidine, 5-hydroxymethylcytidine, 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine, 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza-pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebula
- modified nucleosides include 2-aminopurine, 2,6-diaminopurine, 7-deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine, 7-deaza-8-aza-2-aminopurine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyl adenosine, N6-methyladenosine, N6-isopentenyladenosine, N6-(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N6-(cis-hydroxyisopentenyl) adenosine, N6-glycinylcarbamoyladenosine, N6-threonylcarbamoyladenosine, 2-methylthio-N6-threonyl carbamoyladenosine, N6,N6-d
- modified nucleosides include inosine, 1-methyl-inosine, wyosine, wybutosine, 7-deaza-guanosine, 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine, 6-thio-7-methyl-guanosine, 7-methylinosine, 6-methoxy-guanosine, 1-methylguanosine, N2-methylguanosine, N2,N2-dimethylguanosine, 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine, and N2,N2-dimethyl-6-thio-guanosine.
- the nucleotide can be modified on the major groove face and can include replacement of the hydrogen on C-5 of uracil with a methyl group or a halo group.
- the nucleoside and nucleotide can be a compound of Formula I:
- Z is O or S
- each of Y 1 is independently selected from —OR a1 , it and —SR a1 ;
- each of Y 2 is independently selected from O, NR a , S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y 3 is independently selected from O and S;
- Y 4 is selected from H, —SR a , and —NHR a ;
- n 0, 1, 2, or 3;
- n 0, 1, 2 or 3;
- B is a nucleobase
- R a is H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R a1 and R b1 are each independently H or a counterion
- —Y 3 —R c1 is OH or SH at a pH of about 1 or —Y 3 —R c1 is O ⁇ or S ⁇ at physiological pH;
- R c1 is C 1-20 alkoxy, C 2-20 —O-alkenyl, or C 1-20 —O-alkynyl;
- B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y 1 or Y 2 is not O or OH.
- B is a nucleobase of Formula II-a, II-b, or II-c:
- X is O or S
- U and W are each independently C or N;
- V is O, S, C or N;
- R 1 is H, C 1-6 alkyl, C 1-6 alkenyl, C 1-6 alkynyl, halo, or —OR c , wherein C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl are each optionally substituted with —OH, —NR a R b , —SH, —C(O)R c , —C(O)OR c , —NHC(O)R c , or —NHC(O)OR c ;
- R 2 is H, —NR a R b , or halo
- R 1 and R 2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NR a R b , C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, C 1-20 alkoxy, or C 1-20 thioalkyl;
- R 3 is H or C 1-20 alkyl
- R 4 is H or C 1-20 alkyl; wherein when denotes a double bond then R 4 is absent, or N—R 4 , taken together, forms a positively charged N substituted with C 1-20 alkyl;
- R a and R b are each independently H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R c is H, C 1-20 alkyl, C 2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- B is a nucleobase selected from the group consisting of cytosine, guanine, adenine, and uracil.
- B is a pyrimidine or derivative thereof.
- the nucleotide is selected from the group consisting of:
- the nucleotide is selected from the group consisting of:
- the modified nucleotide can be:
- the major groove chemical modification can include replacement of the C—H group at C-5 with an —NH— group or a —NH(CH 3 )— group.
- the modified nucleotide can be:
- the major groove chemical modification can include replacement of the hydrogen at C-5 of cytosine with a halo group or a methyl group.
- the modified nucleotide can be:
- the major groove chemical modification can include a fused ring that is formed by the NH 2 at the C-4 position and the carbon atom at the C-5 position.
- the modified nucleotide can be:
- a modified nucleotide is 5′-O-(1-Thiophosphate)-Adenosine, 5′-O-(1-Thiophosphate)-Cytidine, 5′-O-(1-Thiophosphate)-Guanosine, 5′-O-(1-Thiophosphate)-Uridine or 5′-O-(1-Thiophosphate)-Pseudouridine.
- the ⁇ -thio substituted phosphate moiety is provided to confer stability to RNA and DNA polymers through the unnatural phosphorothioate backbone linkages.
- Phosphorothioate DNA and RNA have increased nuclease resistance and subsequently a longer half-life in a cellular environment.
- Phosphorothioate linked nucleic acids are expected to also reduce the innate immune response through weaker binding/activation of cellular innate immune molecules.
- modified nucleotides and modified nucleotide combinations are provided below in Table 2.
- modified nucleosides and nucleotides disclosed herein can be prepared from readily available starting materials using the following general methods and procedures. It is understood that where typical or preferred process conditions (i.e., reaction temperatures, times, mole ratios of reactants, solvents, pressures, etc.) are given; other process conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvent used, but such conditions can be determined by one skilled in the art by routine optimization procedures.
- spectroscopic means such as nuclear magnetic resonance spectroscopy (e.g., 1 H or 13 C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high performance liquid chromatography (HPLC) or thin layer chromatography.
- HPLC high performance liquid chromatography
- Preparation of modified nucleosides and nucleotides can involve the protection and deprotection of various chemical groups.
- the need for protection and deprotection, and the selection of appropriate protecting groups can be readily determined by one skilled in the art.
- the chemistry of protecting groups can be found, for example, in Greene, et al., Protective Groups in Organic Synthesis, 2d. Ed., Wiley & Sons, 1991, which is incorporated herein by reference in its entirety.
- Suitable solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, i.e., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature.
- a given reaction can be carried out in one solvent or a mixture of more than one solvent.
- suitable solvents for a particular reaction step can be selected. Resolution of racemic mixtures of modified nucleosides and nucleotides can be carried out by any of numerous methods known in the art.
- An example method includes fractional recrystallization using a “chiral resolving acid” which is an optically active, salt-forming organic acid.
- Suitable resolving agents for fractional recrystallization methods are, for example, optically active acids, such as the D and L forms of tartaric acid, diacetyltartaric acid, dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or the various optically active camphorsulfonic acids.
- Resolution of racemic mixtures can also be carried out by elution on a column packed with an optically active resolving agent (e.g., dinitrobenzoylphenylglycine).
- Suitable elution solvent composition can be determined by one skilled in the art.
- Modified nucleosides and nucleotides can also be prepared according to the synthetic methods described in Ogata et al. Journal of Organic Chemistry 74:2585-2588, 2009; Purmal et al. Nucleic Acids Research 22(1): 72-78, 1994; Fukuhara et al. Biochemistry 1(4): 563-568, 1962; and Xu et al. Tetrahedron 48(9): 1729-1740, 1992, each of which are incorporated by reference in their entirety.
- nucleic acids including RNAs such as mRNAs that contain one or more modified nucleosides (termed “modified nucleic acids”) or nucleotides as described herein, which have useful properties including the significant decreast or lack of a substantial induction of the innate immune response of a cell into which the mRNA is introduced, or the suppression thereof.
- modified nucleic acids enhance the efficiency of protein production, intracellular retention of nucleic acids, and viability of contacted cells, as well as possess reduced immunogenicity, of these nucleic acids compared to unmodified nucleic acids, having these properties are termed “enhanced nucleic acids” herein.
- nucleic acids which have decreased binding affinity to a major groove interacting, e.g. binding, partner.
- the nucleic acids are comprised of at least one nucleotide that has been chemically modified on the major groove face as described herein.
- nucleic acid in its broadest sense, includes any compound and/or substance that is or can be incorporated into an oligonucleotide chain.
- exemplary nucleic acids for use in accordance with the present disclosure include, but are not limited to, one or more of DNA, RNA including messenger mRNA (mRNA), hybrids thereof, RNAi-inducing agents, RNAi agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes, catalytic DNA, RNAs that induce triple helix formation, aptamers, vectors, etc., described in detail herein.
- mRNA messenger mRNA
- modified nucleic acids containing a translatable region and one, two, or more than two different nucleoside modifications.
- the modified nucleic acid exhibits reduced degradation in a cell into which the nucleic acid is introduced, relative to a corresponding unmodified nucleic acid.
- exemplary nucleic acids include ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), locked nucleic acids (LNAs) or a hybrid thereof.
- the modified nucleic acid includes messenger RNAs (mRNAs). As described herein, the nucleic acids of the present disclosure do not substantially induce an innate immune response of a cell into which the mRNA is introduced.
- the present disclosure provides a modified nucleic acid containing a degradation domain, which is capable of being acted on in a directed manner within a cell.
- nucleic acid is optional, and are beneficial in some embodiments.
- a 5′ untranslated region (UTR) and/or a 3′UTR are provided, wherein either or both may independently contain one or more different nucleoside modifications.
- nucleoside modifications may also be present in the translatable region.
- nucleic acids containing a Kozak sequence are also provided.
- nucleic acids containing one or more intronic nucleotide sequences capable of being excised from the nucleic acid.
- nucleic acids containing an internal ribosome entry site may act as the sole ribosome binding site, or may serve as one of multiple ribosome binding sites of an mRNA.
- An mRNA containing more than one functional ribosome binding site may encode several peptides or polypeptides that are translated independently by the ribosomes (“multicistronic mRNA”).
- multicistronic mRNA When nucleic acids are provided with an IRES, further optionally provided is a second translatable region. Examples of IRES sequences that can be used according to the present disclosure include without limitation, those from picornaviruses (e.g.
- FMDV pest viruses
- CFFV pest viruses
- PV polio viruses
- ECMV encephalomyocarditis viruses
- FMDV foot-and-mouth disease viruses
- HCV hepatitis C viruses
- CSFV classical swine fever viruses
- MLV murine leukemia virus
- SIV simian immune deficiency viruses
- CrPV cricket paralysis viruses
- the nucleic acid sequences comprise a compound of Formula I-d:
- Z is O or S
- each of Y 1 is independently selected from —OR a1 , —NR a1 R b1 , and —SR al ;
- each of Y 2 is independently selected from O, NR a , S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y 3 is independently selected from O and S;
- Y 4 is selected from H, —OR a , —SR a , and —NHR a ;
- B is a nucleobase
- R a is H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R a1 and R b1 are each independently H or a counterion
- —Y 3 —R c1 is OH or SH at a pH of about 1 or —Y 3 —R c1 is O ⁇ or S ⁇ at physiological pH;
- R c1 is C 1-20 alkoxy, C 2-20 —O-alkenyl, or C 1-20 —O-alkynyl;
- B is an unmodified nucleobase selected from cytosine, guanine, thymidine, uracil and adenine, then at least one of Z, Y′ or Y 2 is not O or OH.
- B is a nucleobase of Formula II-a, II-b, or II-c:
- X is O or S
- U and W are each independently C or N;
- V is O, S, C or N;
- R 1 is H, C 1-6 alkyl, C 1-6 alkenyl, C 1-6 alkynyl, halo, or —OR c , wherein C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl are each optionally substituted with —OH, —NR a R b , —SH, —C(O)R c , —C(O)OR c , —NHC(O)R c , or —NHC(O)OR c ;
- R 2 is H, —NR a R b , or halo
- R 1 and R 2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NR a R b , C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, C 1-20 alkoxy, or C 1-20 thioalkyl;
- R 3 is H or C 1-20 alkyl
- R 4 is H or C 1-20 alkyl; wherein when denotes a double bond then R 4 is absent, or N—R 4 , taken together, forms a positively charged N substituted with C 1-20 alkyl;
- R a and R b are each independently H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R c is H, C 1-20 alkyl, C 2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- At least 25% of the cytosines are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- a compound of Formula I-a e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- At least 25% of the uracils are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- a compound of Formula I-a e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- At least 25% of the cytosines and 25% of the uracils are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- a compound of Formula I-a e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- the nucleic acid is translatable.
- RNA recognition receptors that detect and respond to RNA ligands through interactions, e.g. binding, with the major groove face of a nucleotide or nucleic acid.
- RNA ligands comprising modified nucleotides or nucleic acids as described herein decrease interactions with major groove binding partners, and therefore decrease an innate immune response, or expression and secretion of pro-inflammatory cytokines, or both.
- Example major groove interacting, e.g. binding, partners include, but are not limited to the following nucleases and helicases.
- TLRs Toll-like Receptors
- members of the superfamily 2 class of DEX(D/H) helicases and ATPases can sense RNAs to initiate antiviral responses.
- These helicases include the RIG-I (retinoic acid-inducible gene I) and MDA5 (melanoma differentiation-associated gene 5).
- Other examples include laboratory of genetics and physiology 2 (LGP2), HIN-200 domain containing proteins, or Helicase-domain containing proteins.
- innate immune response includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, generally of viral or bacterial origin, which involves the induction of cytokine expression and release, particularly the interferons, and cell death. Protein synthesis is also reduced during the innate cellular immune response. While it is advantageous to eliminate the innate immune response in a cell, the present disclosure provides modified mRNAs that substantially reduce the immune response, including interferon signaling, without entirely eliminating such a response.
- the immune response is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.9%, or greater than 99.9% as compared to the immune response induced by a corresponding unmodified nucleic acid.
- a reduction can be measured by expression or activity level of Type 1 interferons or the expression of interferon-regulated genes such as the toll-like receptors (e.g., TLR7 and TLR8).
- Reduction of innate immune response can also be measured by decreased cell death following one or more administrations of modified RNAs to a cell population; e.g., cell death is 10%, 25%, 50%, 75%, 85%, 90%, 95%, or over 95% less than the cell death frequency observed with a corresponding unmodified nucleic acid.
- cell death may affect fewer than 50%, 40%, 30%, 20%, 10%, 5%, 1%, 0.1%, 0.01% or fewer than 0.01% of cells contacted with the modified nucleic acids.
- the present disclosure provides for the repeated introduction (e.g., transfection) of modified nucleic acids into a target cell population, e.g., in vitro, ex vivo, or in vivo.
- the step of contacting the cell population may be repeated one or more times (such as two, three, four, five or more than five times).
- the step of contacting the cell population with the modified nucleic acids is repeated a number of times sufficient such that a predetermined efficiency of protein translation in the cell population is achieved. Given the reduced cytotoxicity of the target cell population provided by the nucleic acid modifications, such repeated transfections are achievable in a diverse array of cell types.
- nucleic acids that encode variant polypeptides, which have a certain identity with a reference polypeptide sequence.
- identity refers to a relationship between the sequences of two or more peptides, as determined by comparing the sequences. In the art, “identity” also means the degree of sequence relatedness between peptides, as determined by the number of matches between strings of two or more amino acid residues. “Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., “algorithms”). Identity of related peptides can be readily calculated by known methods.
- Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math. 48, 1073 (1988).
- the polypeptide variant has the same or a similar activity as the reference polypeptide.
- the variant has an altered activity (e.g., increased or decreased) relative to a reference polypeptide.
- variants of a particular polynucleotide or polypeptide of the present disclosure will have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art.
- protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of this present disclosure.
- a protein fragment of a reference protein meaning a polypeptide sequence at least one amino acid residue shorter than a reference polypeptide sequence but otherwise identical
- any protein that includes a stretch of about 20, about 30, about 40, about 50, or about 100 amino acids which are about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or about 100% identical to any of the sequences described herein can be utilized in accordance with the present disclosure.
- a protein sequence to be utilized in accordance with the present disclosure includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as shown in any of the sequences provided or referenced herein.
- polynucleotide libraries containing nucleoside modifications wherein the polynucleotides individually contain a first nucleic acid sequence encoding a polypeptide, such as an antibody, protein binding partner, scaffold protein, and other polypeptides known in the art.
- a polypeptide such as an antibody, protein binding partner, scaffold protein, and other polypeptides known in the art.
- the polynucleotides are mRNA in a form suitable for direct introduction into a target cell host, which in turn synthesizes the encoded polypeptide.
- multiple variants of a protein are produced and tested to determine the best variant in terms of pharmacokinetics, stability, biocompatibility, and/or biological activity, or a biophysical property such as expression level.
- a library may contain 10, 10 2 , 10 3 , 10 4 , 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , or over 10 9 possible variants (including substitutions, deletions of one or more residues, and insertion of one or more residues).
- Proper protein translation involves the physical aggregation of a number of polypeptides and nucleic acids associated with the mRNA.
- Provided by the present disclosure are protein-nucleic acid complexes, containing a translatable mRNA having one or more nucleoside modifications (e.g., at least two different nucleoside modifications) and one or more polypeptides bound to the mRNA.
- the proteins are provided in an amount effective to prevent or reduce an innate immune response of a cell into which the complex is introduced.
- mRNAs having sequences that are substantially not translatable. Such mRNA is effective as a vaccine when administered to a mammalian subject.
- modified nucleic acids that contain one or more noncoding regions. Such modified nucleic acids are generally not translated, but are capable of binding to and sequestering one or more translational machinery component such as a ribosomal protein or a transfer RNA (tRNA), thereby effectively reducing protein expression in the cell.
- the modified nucleic acid may contain a small nucleolar RNA (sno-RNA), micro RNA (miRNA), small interfering RNA (siRNA) or Piwi-interacting RNA (piRNA).
- Nucleic acids for use in accordance with the present disclosure may be prepared according to any available technique including, but not limited to chemical synthesis, enzymatic synthesis, which is generally termed in vitro transcription, enzymatic or chemical cleavage of a longer precursor, etc.
- Methods of synthesizing RNAs are known in the art (see, e.g., Gait, M. J. (ed.) Oligonucleotide synthesis: a practical approach , Oxford [Oxfordshire], Washington, D.C.: IRL Press, 1984; and Herdewijn, P. (ed.) Oligonucleotide synthesis: methods and applications , Methods in Molecular Biology, v. 288 (Clifton, N.J.) Totowa, N.J.: Humana Press, 2005; both of which are incorporated herein by reference).
- modified nucleosides and nucleotides disclosed herein can be prepared from readily available starting materials using the following general methods and procedures. It is understood that where typical or preferred process conditions (i.e., reaction temperatures, times, mole ratios of reactants, solvents, pressures, etc.) are given; other process conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvent used, but such conditions can be determined by one skilled in the art by routine optimization procedures.
- spectroscopic means such as nuclear magnetic resonance spectroscopy (e.g., 1 H or 13 C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high performance liquid chromatography (HPLC) or thin layer chromatography.
- HPLC high performance liquid chromatography
- Preparation of modified nucleosides and nucleotides can involve the protection and deprotection of various chemical groups.
- the need for protection and deprotection, and the selection of appropriate protecting groups can be readily determined by one skilled in the art.
- the chemistry of protecting groups can be found, for example, in Greene, et al., Protective Groups in Organic Synthesis, 2d. Ed., Wiley & Sons, 1991, which is incorporated herein by reference in its entirety.
- Suitable solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, i.e., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature.
- a given reaction can be carried out in one solvent or a mixture of more than one solvent.
- suitable solvents for a particular reaction step can be selected.
- An example method includes fractional recrystallization using a “chiral resolving acid” which is an optically active, salt-forming organic acid.
- Suitable resolving agents for fractional recrystallization methods are, for example, optically active acids, such as the D and L forms of tartaric acid, diacetyltartaric acid, dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or the various optically active camphorsulfonic acids.
- Resolution of racemic mixtures can also be carried out by elution on a column packed with an optically active resolving agent (e.g., dinitrobenzoylphenylglycine).
- Suitable elution solvent composition can be determined by one skilled in the art.
- Modified nucleic acids need not be uniformly modified along the entire length of the molecule. Different nucleotide modifications and/or backbone structures may exist at various positions in the nucleic acid. One of ordinary skill in the art will appreciate that the nucleotide analogs or other modification(s) may be located at any position(s) of a nucleic acid such that the function of the nucleic acid is not substantially decreased.
- a modification may also be a 5′ or 3′ terminal modification.
- the nucleic acids may contain at a minimum one and at maximum 100% modified nucleotides, or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides.
- the nucleic acids may contain a modified pyrimidine such as uracil or cytosine.
- at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the nucleic acid is replaced with a modified uracil.
- the modified uracil can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures). In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the cytosine in the nucleic acid is replaced with a modified cytosine.
- the modified cytosine can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures).
- the shortest length of a modified mRNA of the present disclosure can be the length of an mRNA sequence that is sufficient to encode for a dipeptide. In another embodiment, the length of the mRNA sequence is sufficient to encode for a tripeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a tetrapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a pentapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a hexapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a heptapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for an octapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a nonapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a decapeptide.
- dipeptides that the modified nucleic acid sequences can encode for include, but are not limited to, carnosine and anserine.
- the mRNA is greater than 30 nucleotides in length. In another embodiment, the RNA molecule is greater than 35 nucleotides in length. In another embodiment, the length is at least 40 nucleotides. In another embodiment, the length is at least 45 nucleotides. In another embodiment, the length is at least 55 nucleotides. In another embodiment, the length is at least 60 nucleotides. In another embodiment, the length is at least 60 nucleotides. In another embodiment, the length is at least 80 nucleotides. In another embodiment, the length is at least 90 nucleotides. In another embodiment, the length is at least 100 nucleotides. In another embodiment, the length is at least 120 nucleotides.
- the length is at least 140 nucleotides. In another embodiment, the length is at least 160 nucleotides. In another embodiment, the length is at least 180 nucleotides. In another embodiment, the length is at least 200 nucleotides. In another embodiment, the length is at least 250 nucleotides. In another embodiment, the length is at least 300 nucleotides. In another embodiment, the length is at least 350 nucleotides. In another embodiment, the length is at least 400 nucleotides. In another embodiment, the length is at least 450 nucleotides. In another embodiment, the length is at least 500 nucleotides. In another embodiment, the length is at least 600 nucleotides.
- the length is at least 700 nucleotides. In another embodiment, the length is at least 800 nucleotides. In another embodiment, the length is at least 900 nucleotides. In another embodiment, the length is at least 1000 nucleotides. In another embodiment, the length is at least 1100 nucleotides. In another embodiment, the length is at least 1200 nucleotides. In another embodiment, the length is at least 1300 nucleotides. In another embodiment, the length is at least 1400 nucleotides. In another embodiment, the length is at least 1500 nucleotides. In another embodiment, the length is at least 1600 nucleotides. In another embodiment, the length is at least 1800 nucleotides.
- the length is at least 2000 nucleotides. In another embodiment, the length is at least 2500 nucleotides. In another embodiment, the length is at least 3000 nucleotides. In another embodiment, the length is at least 4000 nucleotides. In another embodiment, the length is at least 5000 nucleotides, or greater than 5000 nucleotides.
- the present disclosure provides methods of preparing a nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove interacting partner with the nucleic acid sequence, wherein the nucleic acid sequence comprises a compound of Formula I-d:
- Z is O or S
- each of Y 1 is independently selected from —OR a1 , —NR a1 R b1 , and —SR a1 ;
- each of Y 2 is independently selected from O, NR a , S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y 3 is independently selected from O and S;
- Y 4 is selected from H, —OR a , —SR a , and —NHR a ;
- B is a nucleobase
- R a is H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R a1 and R b1 are each independently H or a counterion
- —Y 3 —R c1 is OH or SH at a pH of about 1 or —Y 3 —R c1 is O ⁇ or S ⁇ at physiological pH;
- R c1 is C 1-20 alkoxy, C 2-20 —O-alkenyl, or C 1-20 —O-alkynyl;
- B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y 1 or Y 2 is not O or OH; the method comprising: reacting a compound of Formula I-c:
- the reaction is repeated from 1 to about 7,000 times.
- B is a nucleobase of Formula II-a, Mb, or II-c:
- X is O or S
- U and W are each independently C or N;
- V is O, S, C or N;
- R 1 is H, C 1-6 alkyl, C 1-6 alkenyl, C 1-6 alkynyl, halo, or —OR c , wherein C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl are each optionally substituted with —OH, —NR a R b , —SH, —C(O)R c , —C(O)OR c , —NHC(O)R c , or —NHC(O)OR c ;
- R 2 is H, —OR c , —SR c , —NR a R b , or halo;
- R 1 and R 2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NR a R b , C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, C 1-20 alkoxy, or C 1-20 thioalkyl;
- R 3 is H or C 1-20 alkyl
- R 4 is H or C 1-20 alkyl; wherein when denotes a double bond then R 4 is absent, or N—R 4 , taken together, forms a positively charged N substituted with C 1-20 alkyl;
- R a and R b are each independently H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R c is H, C 1-20 alkyl, C 2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- the methods further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- the nucleobase is a pyrimidine or derivative thereof.
- the present disclosure provides methods of amplifying a nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove binding partner with the nucleic acid sequence, the method comprising:
- Z is O or S
- each of Y 1 is independently selected from —OR a1 , —NR a1 R b1 , and —SR a1 ;
- each of Y 2 is independently selected from O, NR a , S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y 3 is independently selected from O and S;
- Y 4 is selected from H, —OR a , —SR a , and —NHR a ;
- B is a nucleobase
- R a is H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R a1 and R b1 are each independently H or a counterion
- —Y 3 —R c1 is OH or SH at a pH of about 1 or —Y 3 —R c1 is O ⁇ or S ⁇ at physiological pH;
- R c1 is C 1-20 alkoxy, C 2-20 —O-alkenyl, or C 1-20 —O-alkynyl;
- B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y 1 or Y 2 is not O or OH; with a primer, a cDNA template, and an RNA polymerase.
- B is a nucleobase of Formula II-a, II-b, or II-c:
- X is O or S
- U and W are each independently C or N;
- V is O, S, C or N;
- R 1 is H, C 1-6 alkyl, C 1-6 alkenyl, C 1-6 alkynyl, halo, or —OR c , wherein C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl are each optionally substituted with —OH, —NR a R b , —SH, —C(O)R′, —C(O)OR′, —NHC(O)R c , or —NHC(O)OR c ;
- R 2 is H, —OR c , —SR', —NR a R b , or halo;
- R 1 and R 2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NR a R b , C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, C 1-20 alkoxy, or C 1-20 thioalkyl;
- R 3 is H or C 1-20 alkyl
- R 4 is H or C 1-20 alkyl; wherein when denotes a double bond then R 4 is absent, or N—R 4 , taken together, forms a positively charged N substituted with C 1-20 alkyl;
- R a and R b are each independently H, C 1-20 alkyl, C 2-20 alkenyl, C 2-20 alkynyl, or C 6-20 aryl;
- R c is H, C 1-20 alkyl, C 2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- the methods further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- the nucleobase is a pyrimidine or derivative thereof.
- modified nucleic acids and the proteins translated from the modified nucleic acids described herein can be used as therapeutic agents.
- a modified nucleic acid described herein can be administered to a subject, wherein the modified nucleic acid is translated in vivo to produce a therapeutic peptide in the subject.
- compositions, methods, kits, and reagents for treatment or prevention of disease or conditions in humans and other mammals include modified nucleic acids, cells containing modified nucleic acids or polypeptides translated from the modified nucleic acids, polypeptides translated from modified nucleic acids, and cells contacted with cells containing modified nucleic acids or polypeptides translated from the modified nucleic acids.
- combination therapeutics containing one or more modified nucleic acids containing translatable regions that encode for a protein or proteins that boost a mammalian subject's immunity along with a protein that induces antibody-dependent cellular toxitity.
- G-CSF granulocyte-colony stimulating factor
- such combination therapeutics are useful in Her2+ breast cancer patients who develop induced resistance to trastuzumab. (See, e.g., Albrecht, Immunotherapy. 2(6):795-8 (2010)).
- Such translation can be in vivo, ex vivo, in culture, or in vitro.
- the cell population is contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and a translatable region encoding the recombinant polypeptide.
- the population is contacted under conditions such that the nucleic acid is localized into one or more cells of the cell population and the recombinant polypeptide is translated in the cell from the nucleic acid.
- an effective amount of the composition is provided based, at least in part, on the target tissue, target cell type, means of administration, physical characteristics of the nucleic acid (e.g., size, and extent of modified nucleosides), and other determinants.
- an effective amount of the composition provides efficient protein production in the cell, preferably more efficient than a composition containing a corresponding unmodified nucleic acid. Increased efficiency may be demonstrated by increased cell transfection (i.e., the percentage of cells transfected with the nucleic acid), increased protein translation from the nucleic acid, decreased nucleic acid degradation (as demonstrated, e.g., by increased duration of protein translation from a modified nucleic acid), or reduced innate immune response of the host cell.
- aspects of the present disclosure are directed to methods of inducing in vivo translation of a recombinant polypeptide in a mammalian subject in need thereof.
- an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification and a translatable region encoding the recombinant polypeptide is administered to the subject using the delivery methods described herein.
- the nucleic acid is provided in an amount and under other conditions such that the nucleic acid is localized into a cell of the subject and the recombinant polypeptide is translated in the cell from the nucleic acid.
- the cell in which the nucleic acid is localized, or the tissue in which the cell is present, may be targeted with one or more than one rounds of nucleic acid administration.
- compositions containing modified nucleic acids are formulated for administration intramuscularly, transarterially, intraperitoneally, intravenously, intranasally, subcutaneously, endoscopically, transdermally, or intrathecally. In some embodiments, the composition is formulated for extended release.
- the subject to whom the therapeutic agent is administered suffers from or is at risk of developing a disease, disorder, or deleterious condition.
- GWAS genome-wide association studies
- the administered modified nucleic acid directs production of one or more recombinant polypeptides that provide a functional activity which is substantially absent in the cell in which the recombinant polypeptide is translated.
- the missing functional activity may be enzymatic, structural, or gene regulatory in nature.
- the administered modified nucleic acid directs production of one or more recombinant polypeptides that replace a polypeptide (or multiple polypeptides) that is substantially absent in the cell in which the recombinant polypeptide is translated. Such absence may be due to genetic mutation of the encoding gene or regulatory pathway thereof.
- the recombinant polypeptide functions to antagonize the activity of an endogenous protein present in, on the surface of, or secreted from the cell. Usually, the activity of the endogenous protein is deleterious to the subject, for example, do to mutation of the endogenous protein resulting in altered activity or localization.
- the recombinant polypeptide antagonizes, directly or indirectly, the activity of a biological moiety present in, on the surface of, or secreted from the cell.
- antagonized biological moieties include lipids (e.g., cholesterol), a lipoprotein (e.g., low density lipoprotein), a nucleic acid, a carbohydrate, or a small molecule toxin.
- the recombinant proteins described herein are engineered for localization within the cell, potentially within a specific compartment such as the nucleus, or are engineered for secretion from the cell or translocation to the plasma membrane of the cell.
- a useful feature of the modified nucleic acids of the present disclosure is the capacity to reduce the innate immune response of a cell to an exogenous nucleic acid.
- the cell is contacted with a first composition that contains a first dose of a first exogenous nucleic acid including a translatable region and at least one nucleoside modification, and the level of the innate immune response of the cell to the first exogenous nucleic acid is determined.
- the cell is contacted with a second composition, which includes a second dose of the first exogenous nucleic acid, the second dose containing a lesser amount of the first exogenous nucleic acid as compared to the first dose.
- the cell is contacted with a first dose of a second exogenous nucleic acid.
- the second exogenous nucleic acid may contain one or more modified nucleosides, which may be the same or different from the first exogenous nucleic acid or, alternatively, the second exogenous nucleic acid may not contain modified nucleosides.
- the steps of contacting the cell with the first composition and/or the second composition may be repeated one or more times. Additionally, efficiency of protein production (e.g., protein translation) in the cell is optionally determined, and the cell may be re-transfected with the first and/or second composition repeatedly until a target protein production efficiency is achieved.
- the compounds of the present disclosure are particularly advantageous in treating acute diseases such as sepsis, stroke, and myocardial infarction. Moreover, the lack of transcriptional regulation of the modified mRNAs of the present disclosure is advantageous in that accurate titration of protein production is achievable.
- Diseases characterized by dysfunctional or aberrant protein activity include, but not limited to, cancer and proliferative diseases, genetic diseases (e.g., cystic fibrosis), autoimmune diseases, diabetes, neurodegenerative diseases, cardiovascular diseases, and metabolic diseases.
- the present disclosure provides a method for treating such conditions or diseases in a subject by introducing nucleic acid or cell-based therapeutics containing the modified nucleic acids provided herein, wherein the modified nucleic acids encode for a protein that antagonizes or otherwise overcomes the aberrant protein activity present in the cell of the subject.
- Specific examples of a dysfunctional protein are the missense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a dysfunctional protein variant of CFTR protein, which causes cystic fibrosis.
- CFTR cystic fibrosis transmembrane conductance regulator
- CFTR cystic fibrosis transmembrane conductance regulator
- RNA molecules are formulated for administration by inhalation.
- the present disclosure provides a method for treating hyperlipidemia in a subject, by introducing into a cell population of the subject with a modified mRNA molecule encoding Sortilin, a protein recently characterized by genomic studies, thereby ameliorating the hyperlipidemia in a subject.
- the SORT1 gene encodes a trans-Golgi network (TGN) transmembrane protein called Sortilin.
- TGN trans-Golgi network
- Methods of the present disclosure enhance nucleic acid delivery into a cell population, in vivo, ex vivo, or in culture.
- a cell culture containing a plurality of host cells e.g., eukaryotic cells such as yeast or mammalian cells
- the composition also generally contains a transfection reagent or other compound that increases the efficiency of enhanced nucleic acid uptake into the host cells.
- the enhanced nucleic acid exhibits enhanced retention in the cell population, relative to a corresponding unmodified nucleic acid. The retention of the enhanced nucleic acid is greater than the retention of the unmodified nucleic acid.
- it is at least about 50%, 75%, 90%, 95%, 100%, 150%, 200% or more than 200% greater than the retention of the unmodified nucleic acid.
- retention advantage may be achieved by one round of transfection with the enhanced nucleic acid, or may be obtained following repeated rounds of transfection.
- the enhanced nucleic acid is delivered to a target cell population with one or more additional nucleic acids. Such delivery may be at the same time, or the enhanced nucleic acid is delivered prior to delivery of the one or more additional nucleic acids.
- the additional one or more nucleic acids may be modified nucleic acids or unmodified nucleic acids. It is understood that the initial presence of the enhanced nucleic acids does not substantially induce an innate immune response of the cell population and, moreover, that the innate immune response will not be activated by the later presence of the unmodified nucleic acids. In this regard, the enhanced nucleic acid may not itself contain a translatable region, if the protein desired to be present in the target cell population is translated from the unmodified nucleic acids.
- modified nucleic acids are provided to express a protein-binding partner or a receptor on the surface of the cell, which functions to target the cell to a specific tissue space or to interact with a specific moiety, either in vivo or in vitro.
- Suitable protein-binding partners include antibodies and functional fragments thereof, scaffold proteins, or peptides.
- modified nucleic acids can be employed to direct the synthesis and extracellular localization of lipids, carbohydrates, or other biological moieties.
- a method for epigenetically silencing gene expression in a mammalian subject comprising a nucleic acid where the translatable region encodes a polypeptide or polypeptides capable of directing sequence-specific histone H3 methylation to initiate heterochromatin formation and reduce gene transcription around specific genes for the purpose of silencing the gene.
- a gain-of-function mutation in the Janus Kinase 2 gene is responsible for the family of Myeloproliferative Diseases.
- compositions may optionally comprise one or more additional therapeutically active substances.
- a method of administering pharmaceutical compositions comprising one or more proteins to be delivered to a subject in need thereof is provided.
- compositions are administered to humans.
- active ingredient generally refers to a protein or protein-containing complex as described herein.
- compositions suitable for administration to humans are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation.
- Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as chickens, ducks, geese, and/or turkeys.
- Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
- a pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses.
- a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient.
- the amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
- Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered.
- the composition may comprise between 0.1% and 100% (w/w) active ingredient.
- compositions may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- a pharmaceutically acceptable excipient includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
- Remington's The Science and Practice of Pharmacy 21 st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference) discloses various excipients
- a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure.
- an excipient is approved for use in humans and for veterinary use.
- an excipient is approved by United States Food and Drug Administration.
- an excipient is pharmaceutical grade.
- an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
- compositions used in the manufacture of pharmaceutical compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical formulations. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and/or perfuming agents can be present in the composition, according to the judgment of the formulator.
- Exemplary diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
- Exemplary granulating and/or dispersing agents include, but are not limited to, potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, etc., and/or combinations thereof.
- crospovidone cross-linked poly(vinyl-pyrrolidone)
- Exemplary surface active agents and/or emulsifiers include, but are not limited to, natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum® [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g.
- natural emulsifiers e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin
- colloidal clays e.g. bentonite [aluminum silicate
- stearyl alcohol cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g. carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g.
- polyoxyethylene monostearate [Myrj®45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol®), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. Cremophor®), polyoxyethylene ethers, (e.g.
- polyoxyethylene lauryl ether [Brij®30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic®F 68, Poloxamer®188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and/or combinations thereof.
- Exemplary binding agents include, but are not limited to, starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol,); natural and synthetic gums (e.g.
- acacia sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum®), and larch arabogalactan); alginates; polyethylene oxide; polyethylene glycol; inorganic calcium salts; silicic acid; polymethacrylates; waxes; water; alcohol; etc.; and combinations thereof.
- Exemplary preservatives may include, but are not limited to, antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and/or other preservatives.
- Exemplary antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and/or sodium sulfite.
- Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate, disodium edetate, dipotassium edetate, edetic acid, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or trisodium edetate.
- EDTA ethylenediaminetetraacetic acid
- citric acid monohydrate disodium edetate
- dipotassium edetate dipotassium edetate
- edetic acid fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or trisodium edetate.
- antimicrobial preservatives include, but are not limited to, benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and/or thimerosal.
- Exemplary antifungal preservatives include, but are not limited to, butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and/or sorbic acid.
- Exemplary alcohol preservatives include, but are not limited to, ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and/or phenylethyl alcohol.
- Exemplary acidic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid.
- preservatives include, but are not limited to, tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus®, Phenonip®, methylparaben, Germall®115, Germaben®II, NeoloneTM, KathonTM, and/or Euxyl®.
- Exemplary buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, d-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isot
- Exemplary lubricating agents include, but are not limited to, magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
- oils include, but are not limited to, almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury
- oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and/or combinations thereof.
- Liquid dosage forms for oral and parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs.
- liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- inert diluents commonly used in the art such as, for example,
- oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
- adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents.
- compositions are mixed with solubilizing agents such as Cremophor®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
- Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents.
- Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol.
- the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution.
- Sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil can be employed including synthetic mono- or diglycerides.
- Fatty acids such as oleic acid can be used in the preparation of injectables.
- Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- the rate of drug release can be controlled.
- biodegradable polymers include poly(orthoesters) and poly(anhydrides).
- Depot injectable formulations are prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
- compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing compositions with suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
- an active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient such as sodium citrate or dicalcium phosphate and/or fillers or extenders (e.g. starches, lactose, sucrose, glucose, mannitol, and silicic acid), binders (e.g. carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia), humectants (e.g. glycerol), disintegrating agents (e.g.
- the dosage form may comprise buffering agents.
- solution retarding agents e.g. paraffin
- absorption accelerators e.g. quaternary ammonium compounds
- wetting agents e.g. cetyl alcohol and glycerol monostearate
- absorbents e.g. kaolin and bentonite clay
- lubricants e.g. talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate
- the dosage form may comprise buffering agents.
- Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- Solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes.
- Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- Dosage forms for topical and/or transdermal administration of a composition may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches.
- an active ingredient is admixed under sterile conditions with a pharmaceutically acceptable excipient and/or any needed preservatives and/or buffers as may be required.
- the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of a compound to the body.
- dosage forms may be prepared, for example, by dissolving and/or dispensing the compound in the proper medium.
- rate may be controlled by either providing a rate controlling membrane and/or by dispersing the compound in a polymer matrix and/or gel.
- Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices such as those described in U.S. Pat. Nos. 4,886,499; 5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235; 5,141,496; and 5,417,662.
- Intradermal compositions may be administered by devices which limit the effective penetration length of a needle into the skin, such as those described in PCT publication WO 99/34850 and functional equivalents thereof.
- Jet injection devices which deliver liquid compositions to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable.
- Jet injection devices are described, for example, in U.S. Pat. Nos. 5,480,381; 5,599,302; 5,334,144; 5,993,412; 5,649,912; 5,569,189; 5,704,911; 5,383,851; 5,893,397; 5,466,220; 5,339,163; 5,312,335; 5,503,627; 5,064,413; 5,520,639; 4,596,556; 4,790,824; 4,941,880; 4,940,460; and PCT publications WO 97/37705 and WO 97/13537.
- Ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis are suitable.
- conventional syringes may be used in the classical mantoux method of intradermal administration.
- Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions.
- Topically-administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of active ingredient may be as high as the solubility limit of the active ingredient in the solvent.
- Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
- a pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity.
- a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 nm to about 7 nm or from about 1 nm to about 6 nm.
- Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant may be directed to disperse the powder and/or using a self propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container.
- Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nm and at least 95% of the particles by number have a diameter less than 7 nm. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nm and at least 90% of the particles by number have a diameter less than 6 nm.
- Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
- Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50% to 99.9% (w/w) of the composition, and active ingredient may constitute 0.1% to 20% (w/w) of the composition.
- a propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
- compositions formulated for pulmonary delivery may provide an active ingredient in the form of droplets of a solution and/or suspension.
- Such formulations may be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising active ingredient, and may conveniently be administered using any nebulization and/or atomization device.
- Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate.
- Droplets provided by this route of administration may have an average diameter in the range from about 0.1 nm to about 200 nm.
- Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition.
- Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 ⁇ m to 500 ⁇ m. Such a formulation is administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
- Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein.
- a pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, 0.1% to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein.
- formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient.
- Such powdered, aerosolized, and/or aerosolized formulations when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein.
- a pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration.
- Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid excipient.
- Such drops may further comprise buffering agents, salts, and/or one or more other of any additional ingredients described herein.
- Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this present disclosure.
- the present disclosure provides methods comprising administering proteins or complexes in accordance with the present disclosure to a subject in need thereof.
- Proteins or complexes, or pharmaceutical, imaging, diagnostic, or prophylactic compositions thereof may be administered to a subject using any amount and any route of administration effective for preventing, treating, diagnosing, or imaging a disease, disorder, and/or condition (e.g., a disease, disorder, and/or condition relating to working memory deficits).
- a disease, disorder, and/or condition e.g., a disease, disorder, and/or condition relating to working memory deficits.
- the exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like.
- Compositions in accordance with the present disclosure are typically formulated in dosage unit form for ease of administration and uniformity of dosage.
- compositions of the present disclosure will be decided by the attending physician within the scope of sound medical judgment.
- the specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
- Proteins to be delivered and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof may be administered to animals, such as mammals (e.g., humans, domesticated animals, cats, dogs, mice, rats, etc.). In some embodiments, pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof are administered to humans.
- Proteins to be delivered and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof in accordance with the present disclosure may be administered by any route.
- proteins and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof are administered by one or more of a variety of routes, including oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (e.g.
- proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof are administered by systemic intravenous injection.
- proteins or complexes and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof may be administered intravenously and/or orally.
- proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof may be administered in a way which allows the protein or complex to cross the blood-brain barrier, vascular barrier, or other epithelial barrier.
- the present disclosure encompasses the delivery of proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof, by any appropriate route taking into consideration likely advances in the sciences of drug delivery.
- the most appropriate route of administration will depend upon a variety of factors including the nature of the protein or complex comprising proteins associated with at least one agent to be delivered (e.g., its stability in the environment of the gastrointestinal tract, bloodstream, etc.), the condition of the patient (e.g., whether the patient is able to tolerate particular routes of administration), etc.
- the present disclosure encompasses the delivery of the pharmaceutical, prophylactic, diagnostic, or imaging compositions by any appropriate route taking into consideration likely advances in the sciences of drug delivery.
- compositions in accordance with the present disclosure may be administered at dosage levels sufficient to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect.
- the desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks.
- the desired dosage may be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
- Proteins or complexes may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents.
- combination with it is not intended to imply that the agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of the present disclosure.
- Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent.
- the present disclosure encompasses the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
- therapeutically, prophylactically, diagnostically, or imaging active agents utilized in combination may be administered together in a single composition or administered separately in different compositions.
- agents utilized in combination with be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- the particular combination of therapies (therapeutics or procedures) to employ in a combination regimen will take into account compatibility of the desired therapeutics and/or procedures and the desired therapeutic effect to be achieved. It will also be appreciated that the therapies employed may achieve a desired effect for the same disorder (for example, a composition useful for treating cancer in accordance with the present disclosure may be administered concurrently with a chemotherapeutic agent), or they may achieve different effects (e.g., control of any adverse effects).
- kits for conveniently and/or effectively carrying out methods of the present disclosure.
- kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments.
- kits for protein production comprising a first isolated nucleic acid comprising a translatable region and a nucleic acid modification, wherein the nucleic acid is capable of evading an innate immune response of a cell into which the first isolated nucleic acid is introduced, and packaging and instructions.
- kits for protein production comprising: a first isolated nucleic acid comprising a translatable region, provided in an amount effective to produce a desired amount of a protein encoded by the translatable region when introduced into a target cell; a second nucleic acid comprising an inhibitory nucleic acid, provided in an amount effective to substantially inhibit the innate immune response of the cell; and packaging and instructions.
- kits for protein production comprising a first isolated nucleic acid comprising a translatable region and a nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and packaging and instructions.
- kits for protein production comprising a first isolated nucleic acid comprising a translatable region and at least two different nucleoside modifications, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and packaging and instructions.
- kits for protein production comprising a first isolated nucleic acid comprising a translatable region and at least one nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease; a second nucleic acid comprising an inhibitory nucleic acid; and packaging and instructions.
- the first isolated nucleic acid comprises messenger RNA (mRNA).
- mRNA messenger RNA
- the mRNA comprises at least one nucleoside selected from the group consisting of pyridin-4-one ribonucleoside, 5-aza-uridine, 2-thio-5-aza-uridine, 2-thiouridine, 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxyuridine, 3-methyluridine, 5-carboxymethyl-uridine, 1-carboxymethyl-pseudouridine, 5-propynyl-uridine, 1-propynyl-pseudouridine, 5-taurinomethyluridine, 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine, 1-taurinomethyl-4-thio-uridine, 5-methyl-uridine, 1-methyl-pseudouridine, 4-thio-1-methyl-pseudouridine, 2-thio-1
- the mRNA comprises at least one nucleoside selected from the group consisting of 5-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine, N4-acetylcytidine, 5-formylcytidine, N4-methylcytidine, 5-hydroxymethylcytidine, 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine, 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza-pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-
- the mRNA comprises at least one nucleoside selected from the group consisting of 2-aminopurine, 2,6-diaminopurine, 7-deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine, 7-deaza-8-aza-2-aminopurine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyladenosine, N6-methyladenosine, N6-isopentenyladenosine, N6-(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine, N6-glycinylcarbamoyladenosine, N6-threonylcarbamoyladenosine, 2-methylthio-N6-threonyl carbamoyladen
- the mRNA comprises at least one nucleoside selected from the group consisting of inosine, 1-methyl-inosine, wyosine, wybutosine, 7-deaza-guanosine, 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine, 6-thio-7-methyl-guanosine, 7-methylinosine, 6-methoxy-guanosine, 1-methylguanosine, N2-methylguanosine, N2,N2-dimethylguanosine, 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine, and N2,N2-dimethyl-6-thio-guanosine.
- nucleoside selected from the group consisting of in
- compositions for protein production comprising a first isolated nucleic acid comprising a translatable region and a nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and a mammalian cell suitable for translation of the translatable region of the first nucleic acid.
- Modified mRNAs were made using standard laboratory methods and materials for in vitro transcription with the exception that the nucleotide mix contained modified nucleotides.
- the open reading frame (ORF) of the gene of interest is flanked by a 5′ untranslated region (UTR) containing a strong Kozak translational initiation signal and an alpha-globin 3′ UTR terminating with an oligo(dT) sequence for templated addition of a polyA tail for modRNAs not incorporating Adenosine analogs.
- Adenosine-containing modRNAs were synthesized without an oligo (dT) sequence to allow for post-transcription poly (A) polymerase poly-(A) tailing.
- the modRNAs were modified by incorporating chemically modified nucleotides indicated in Table 3 (below) during the in vitro transcription with 100% replacement of the corresponding natural nucleotide or partial replacement of the corresponding natural nucleotide at the indicated percentage.
- Table 3 indicates the chemical identity of each chemically-distinct modified nucleotide incorporated into a modified mRNA with the given chemistry designation number.
- Pyrrolo-C containing modRNAs have an increase in UV absorbance at a lower wavelength due to the presence of the pyrrolo ring of the modified C nucleotide.
- 2-amino-adenine nucleotide-containing modRNAs have an increase in UV absorbance at a higher wavelength due to the presence of an exocyclic amine off the purine ring.
- Nucleotides that are not transcription-competent and cannot be incorporated into a modRNA have a scrambled UV spectrum indicating no product from the transcription reaction.
- RNAiMAX RNAiMAX was prepared as described and mixed with the cells in the multi-well plate within a period of time, e.g., 6 hours, of cell seeding before cells had adhered to the tissue culture plate.
- RNAiMAX was prepared as described and transfected onto the cells in the multi-well plate over 24 hours after cell seeding and adherence to the tissue culture plate.
- FIGS. 2A and 2B show an Enzyme-linked immunosorbent assay (ELISA) for Human Granulocyte-Colony Stimulating Factor (hu-G-CSF) of in vitro transfected Human Keratinocyte cells. Keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70%.
- FIG. 2A keratinocytes were reverse transfected with 300 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen.
- FIG. 2B keratinocytes were forward transfected with 300 ng modRNA complexed with RNAiMAX from Invitrogen.
- RNA:RNAiMAX complex was formed by first incubating the RNA with Supplement-free EpiLife media in a 5 ⁇ volumetric dilution for 10 minutes at room temperature. In a second vial, RNAiMAX reagent was incubated with Supplement-free EpiLife Media in a 10 ⁇ volumetric dilution for 10 minutes at room temperature. The RNA vial was then mixed with the RNAiMAX vial and incubated for 20-30 at room temperature before being added to the cells in a drop-wise fashion. Secreted huG-CSF concentration in the culture medium was measured at 18 hours post-transfection for each of the chemically modified mRNAs in triplicate.
- G-CSF Human Granulocyte-Colony Stimulating Factor
- FIGS. 3A-N show Enzyme-linked immunosorbent assays (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) of in vitro transfected Human Keratinocyte cells.
- Keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70%. Keratinocytes were reverse transfected with 0 ng, 46.875 ng, 93.75 ng, 187.5 ng, 375 ng, 750 ng, or 1500 ng modRNA complexed with RNAiMAX from Invitrogen. The modRNA:RNAiMAX complex was formed as described.
- G-CSF Human Granulocyte-Colony Stimulating Factor
- modified RNAs containing modified nucleotide analogs sustain hu-G-CSF expression for the longest and at the highest levels.
- modified RNA containing modified nucleotides with chemical modifications on the major groove face of pyrimidine analogs have the highest levels of secreted hu-G-CSF into the cell culture medium and that 750 ng of modRNA elicits the highest level of secreted hu-G-CSF.
- FIGS. 4A-F show an Enzyme-linked immunosorbent assay (ELISA) for Human Tumor Necrosis Factor- ⁇ (TNF- ⁇ ) ( FIGS. 4A and 4B ); Human Interferon- ⁇ (IFN- ⁇ ) ( FIGS. 4C and 4D ); and Human Granulocyte-Colony Stimulating Factor (G-CSF) ( FIGS. 4E and 4F ) secreted from in vitro-transfected Human Keratinocyte cells. Keratinocytes were grown in EpiLife medium with Human Keratinocyte Growth Supplement in the absence of hydrocortisone from Invitrogen at a confluence of >70%.
- ELISA Enzyme-linked immunosorbent assay
- keratinocytes were reverse transfected with Ong, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng or 3000 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen as described in triplicate.
- Secreted TNF- ⁇ in the culture medium was measured 24 hours post-transfection for each of the chemically modified mRNAs using an ELISA kit from Invitrogen according to the manufacturer protocols.
- FIGS. 4C and 4D secreted IFN- ⁇ in the same culture medium was measured 24 hours post-transfection for each of the chemically modified mRNAs using an ELISA kit from Invitrogen according to the manufacturer protocols.
- FIGS. 4E and 4F secreted hu-G-CSF concentration in the same culture medium was measured at 24 hours post-transfection for each of the chemically modified mRNAs.
- G-CSF Human Granulocyte-Colony Stimulating Factor
- modified RNAs containing modified nucleotides were capable of eliciting a reduced cellular innate immune response in comparison to natural and other chemically modified nucleotides by measuring exemplary type I cytokines TNF- ⁇ and IFN- ⁇ .
- modified RNAs containing modified nucleotides with chemical modifications on the major groove face of pyrimidine analogs have the lowest levels of secreted TNF- ⁇ and IFN- ⁇ into the cell culture medium while maintaining high levels of modRNA-encoding hu-G-CSF secretion into the cell culture medium.
- FIGS. 5A-D show modRNA-encoding hu-G-CSF produced by a human keratinocyte feeder cell layer induced the proliferation of both human myeloblast cells KG-1 and Kasumi-1 that express the G-CSF-receptor where the cell populations are separated by a semi-permeable membrane.
- Human keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70% in a 24-well collagen-coated Transwell® (Corning, Lowell, Mass.) co-culture tissue culture plate. Keratinocytes were reverse transfected with 750 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen as described in triplicate. The modRNA:RNAiMAX complex was formed as described. Keratinocyte media was exchanged 6-8 hours post-transfection.
- FIG. 5A is a table showing the results from an Enzyme-linked immunosorbent assay (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells sampled from individual wells in a co-culture 24-well tissue culture plate 42 hours post-transfection with 750 ng of each indicated hu-G-CSF-encoding modRNA.
- ELISA Enzyme-linked immunosorbent assay
- G-CSF Human Granulocyte-Colony Stimulating Factor
- RNA from sample cells was extracted and lysed using RNeasy kit (Qiagen, Valencia, Calif.) according to the manufacturer instructions. Extracted total RNA was submitted to RT-PCR for specific amplification of modRNA-G-CSF using ProtoScript® M-MuLV Taq RT-PCR kit (New England BioLabs, Ipswich, Mass.) according to the manufacturer instructions with hu-G-CSF-specific primers (see below). RT-PCR products were visualized by 1.2% agarose gel electrophoresis ( FIG. 5B ). Table 6 below shows which modRNAs were run on the agarose gel.
- Keratinocytes are grown in EpiLife medium with Human Keratinocyte Growth Supplement in the absence of hydrocortisone from Invitrogen at a confluence of >70%. Keratinocytes are reverse transfected with Ong, 46.875 ng, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng, 3000 ng, or 6000 ng of modRNA complexed with RNAiMAX from Invitrogen. The modRNA:RNAiMAX complex is formed.
- G-CSF Human Granulocyte-Colony Stimulating Factor
- the modified mRNA comprised of chemically-distinct modified nucleotides encoding human Granulocyte-Colony Stimulating Factor (G-CSF) may stimulate the cellular proliferation of a transfection incompetent cell in co-culture environment.
- the co-culture includes a highly transfectable cell type such as a human keratinocyte and a transfection incompetent cell type such as a white blood cell (WBC).
- WBC white blood cell
- the modified mRNA encoding G-CSF may be transfected into the highly transfectable cell allowing for the production and secretion of G-CSF protein into the extracellular environment where G-CSF acts in a paracrine-like manner to stimulate the white blood cell expressing the G-CSF receptor to proliferate.
- the expanded WBC population may be used to treat immune-compromised patients or partially reconstitute the WBC population of an immunosuppressed patient and thus reduce the risk of opportunistic infections.
- a highly transfectable cell such as a fibroblast may be transfected with certain growth factors to support and simulate the growth, maintenance, or differentiation of poorly transfectable embryonic stem cells or induced pluripotent stem cells.
- the cloning, gene synthesis and vector sequencing was performed by DNA2.0 Inc. (Menlo Park, Calif.). Sequence and insert sequence are set forth herein.
- the ORF was restriction digested using XbaI and used for cDNA synthesis using tailed- or tail-less-PCR.
- the tailed-PCR cDNA product was used as the template for the modified mRNA synthesis reaction using 25 mM mixture each modified nucleotide (all modified nucleotides were custom synthesized or purchased from TriLink Biotech, San Diego, Calif.
- RNA synthesis kit except pyrrolo-C triphosphate purchased from Glen Research, Sterling Va.; unmodified nucleotides were purchased from Epicenter Biotechnologies, Madison, Wis.) and CellScript MegaScriptTM (Epicenter Biotechnologies, Madison, Wis.) complete mRNA synthesis kit.
- modRNAs incorporating adenosine analogs were poly (A) tailed using yeast Poly (A) Polymerase (Affymetrix, Santa Clara, Calif.).
- PCR reaction used HiFi PCR 2 ⁇ Master MixTM (Kapa Biosystems, Woburn, Mass.).
- RNAs were post-transcriptionally capped using recombinant Vaccinia Virus Capping Enzyme (New England BioLabs, Ipswich, Mass.) and a recombinant 2′-O-methyltransferase (Epicenter Biotechnologies, Madison, Wis.) to generate the 5′-guanosine Cap 1 structure.
- Cap 2 structure and Cap 3 structures may be generated using additional 2′-O-methyltransferases.
- the in vitro transcribed mRNA product was run on an agarose gel and visualized. modRNA was purified with Ambion/Applied Biosystems (Austin, Tex.) MEGAClear RNATM purification kit.
- PCR used PureLinkTM PCR purification kit (Invitrogen, Carlsbad, Calif.). The product was quantified on NanodropTM UV Absorbance (ThermoFisher, Waltham, Mass.). Quality, UV absorbance quality and visualization of the product was performed on an 1.2% agarose gel. The product was resuspended in TE buffer.
- 5′-modRNA capping may be completed concomitantly during the in vitro-transcription reaction using the following chemical RNA cap analogs to generate the 5′-guanosine cap structure according to manufacturer protocols: 3′-O-Me-m 7 G(5′)ppp(5′)G; G(5′)ppp(5′)A; G(5′)ppp(5′)G; m 7 G(5′)ppp(5′)A; m 7 G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.).
- 5′-modRNA capping may be completed post-transcriptionally using a Vaccinia Virus Capping Enzyme to generate the “Cap 0” structure: m 7 G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.).
- Cap 1 structure may be generated using both Vaccinia Virus Capping Enzyme and a 2′-O methyl-transferase to generate: m7G(5′)ppp(5′)G-2′-O-methyl.
- Cap 2 structure may be generated from the Cap 1 structure followed by the 2′-O-methylation of the 5′-antepenultimate nucleotide using a 2′-O methyl-transferase.
- Cap 3 structure may be generated from the Cap 2 structure followed by the 2′-O-methylation of the 5′-preantepenultimate nucleotide using a 2′-O methyl-transferase.
- Enzymes are preferably derived from a recombinant source.
- G-CSF cDNA (SEQ ID NO: 1) agcttttggaccctcgtacagaagctaatacgactcactatagggaaata agagagaaaagaagagtaagaagaaatataagagccaccatggccggtcc cgcgacccaaagccccatgaaacttatggccctgcagttgctgctttggc actcggccctctggacagtccaagaagcgactcctcteggacctgcctca tcgtgccgcagtcattccttttgaagtgtctggagcaggtgcgaaagat tcagggcgatggagccgcactccaagagaagctctgcgcgacatacaacaactttgccatccccgaggagccgagg
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Immunology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Crystallography & Structural Chemistry (AREA)
- Dispersion Chemistry (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Endocrinology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
- This application claims the benefit of U.S. Provisional Application Ser. No. 61/404,413, filed on Oct. 1, 2010, which is incorporated herein by reference in its entirety.
- Naturally occurring RNAs are synthesized from four basic ribonucleotides: ATP, CTP, UTP and GTP, but may contain post-transcriptionally modified nucleotides. Further, approximately one hundred different nucleoside modifications have been identified in RNA (Rozenski, J, Crain, P, and McCloskey, J. (1999). The RNA Modification Database: 1999 update. Nucl Acids Res 27: 196-197). The role of nucleoside modifications on the immuno-stimulatory potential, stability, and on the translation efficiency of RNA, and the consequent benefits to this for enhancing protein expression and producing therapeutics however, is unclear.
- There are multiple problems with prior methodologies of effecting protein expression. For example, heterologous deoxyribonucleic acid (DNA) introduced into a cell can be inherited by daughter cells (whether or not the heterologous DNA has integrated into the chromosome) or by offspring. Introduced DNA can integrate into host cell genomic DNA at some frequency, resulting in alterations and/or damage to the host cell genomic DNA. In addition, multiple steps must occur before a protein is made. Once inside the cell, DNA must be transported into the nucleus where it is transcribed into RNA. The RNA transcribed from DNA must then enter the cytoplasm where it is translated into protein. This need for multiple processing steps creates lag times before the generation of a protein of interest. Further, it is difficult to obtain DNA expression in cells; frequently DNA enters cells but is not expressed or not expressed at reasonable rates or concentrations. This can be a particular problem when DNA is introduced into cells such as primary cells or modified cell lines.
- There is a need in the art for biological modalities to address the modulation of intracellular translation of nucleic acids.
- The present disclosure provides, inter alia, modified nucleosides, modified nucleotides, and modified nucleic acids which can exhibit a reduced innate immune response when introduced into a population of cells, both in vivo and ex vivo. Further, these modified nucleosides, modified nucleotides, and modified nucleic acids described herein can disrupt binding of a major groove interacting partner with the nucleic acid. Because of the reduced immunogenicity and the decrease in major groove interactions, these modified nucleosides, modified nucleotides, and modified nucleic acids can be more efficient during protein production than, e.g., unmodified nucleic acids.
- Thus, the present disclosure provides compounds comprising nucleotides that can disrupt binding of a major groove binding partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to the major groove binding partner.
- The present disclosure further provides compounds having Formula I:
- wherein constituent variables are provided herein.
- The present disclosure further provides nucleic acid sequences of at least two nucleotides comprising a compound of Formula I-d:
- wherein constituent variables are provided herein.
- The present disclosure further provides compositions comprising at least one compound of Formula I.
- The present disclosure further provides pharmaceutical compositions comprising a compound of Formula I.
- The present disclosure further provides methods of preparing nucleic acid sequences of at least two nucleotides of a compound of Formula I-d.
- The present disclosure further provides methods of amplifying nucleic acid sequences of at least two nucleotides of a compound of Formula I-d.
- The present disclosure further provides kits comprising a compound of Formula I.
- Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present invention; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.
- Other features and advantages of the invention will be apparent from the following detailed description and figures, and from the claims.
-
FIGS. 1A and 1B depict images of non-denaturing agarose gels of each in vitro-transcribed modified RNA. -
FIGS. 2A and 2B depict images of an Enzyme-linked immunosorbent assay (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) of in vitro transfected Human Keratinocyte cells with each indicated modRNA encoding human G-CSF and the line indicates a saturating level of maximum detectable limit of secreted G-CSF in the assay. -
FIGS. 3A-N depict line graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) secreted from in vitro-transfected Human Keratinocyte cells at different time points with each indicated human G-CSF-encoding modRNA at the indicated doses. The line indicates a saturating level of maximum detectable limit of secreted G-CSF in the assay. -
FIGS. 4A and 4B depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for endogenous cellular human Tumor Necrosis Factor-α (TNF-α) secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses. -
FIGS. 4C and 4D depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for endogenous cellular human Interferon-β (IFN-β) secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses. -
FIGS. 4E and 4F depict bar graphs of a series of Enzyme-linked immunosorbent assays (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells at 24 hours with each indicated hu-G-CSF-encoding modRNA at increasing doses. -
FIG. 5A is a table showing results from an Enzyme-linked immunosorbent assay (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells sampled from individual wells in a co-culture 24-welltissue culture plate 42 hours post-transfection with 750 ng of each indicated hu-G-CSF-encoding modRNA. -
FIG. 5B depicts an image of an agarose gel of RT-PCR hu-G-CSF modRNA products fromco-culture cell extracts 42 hours post-transfection of the human keratinocyte feeder layer with hu-G-CSG modRNA and the un-transfected Kasumi-1 and KG-1 insert culture cells. -
FIGS. 5C and 5D depict graphs of results from a hu-G-CSF-modRNA-induced cell proliferation assay of Kasumi-1 (FIG. 5C ) and KG-1 (FIG. 5D ) cells normalized to untransfected cells. Hu-G-CSF modRNA identity transfected into human keratinocyte feeder cells is indicated. -
FIGS. 6A-L depict graphs of the UV absorbance spectra for exemplary modRNA molecules that incorporate the indicated modified nucleotide. - The present disclosure provides, inter alia, modified nucleosides, modified nucleotides, and modified nucleic acids that exhibit a reduced innate immune response when introduced into a population of cells. The modified nucleosides, modified nucleotides, and modified nucleic acids can be chemically modified on the major groove face, thereby disrupting major groove binding partner interactions, which cause innate immune responses.
- In general, exogenous unmodified nucleic acids, particularly viral nucleic acids, introduced into cells induce an innate immune response, resulting in cytokine and interferon (IFN) production and cell death. However, it is of great interest for therapeutics, diagnostics, reagents and for biological assays to deliver a nucleic acid, e.g., a ribonucleic acid (RNA) inside a cell, either in vivo or ex vivo, such as to cause intracellular translation of the nucleic acid and production of the encoded protein. Of particular importance is the delivery and function of a non-integrative nucleic acid, as nucleic acids characterized by integration into a target cell are generally imprecise in their expression levels, deleteriously transferable to progeny and neighbor cells, and suffer from the substantial risk of causing mutation. Provided herein in part are nucleic acids encoding useful polypeptides capable of modulating a cell's function and/or activity, and methods of making and using these nucleic acids and polypeptides. As described herein, these nucleic acids are capable of reducing the innate immune activity of a population of cells into which they are introduced, thus increasing the efficiency of protein production in that cell population. Further, one or more additional advantageous activities and/or properties of the nucleic acids and proteins of the present disclosure are described.
- Further, the modified nucleosides, modified nucleotides, and modified nucleic acids described herein can be modified on the major groove face. These major groove modifications can allow for alterations, e.g. a decrease, in the interaction of the modified nucleosides, modified nucleotides, and modified nucleic acids with a binding groove partner.
- Accordingly, in a first aspect, the present disclosure provides compounds comprising a nucleotide that can disrupts binding of a major groove interacting, e.g. binding, partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to major groove interacting, e.g. binding, partners.
- In another aspect, the present disclosure provides compounds comprising a nucleotide that contains chemical modifications, wherein the nucleotide can have altered binding to major groove interacting, e.g. binding, partners.
- In some embodiments, the chemical modifications are located on the major groove face of the nucleobase, and wherein the chemical modifications can include replacing or substituting an atom of a pyrimidine nucleobase with an amine, an SH, an alkyl (e.g., methyl or ethyl), or a halo (e.g., chloro or fluoro).
- In some embodiments, the chemical modifications can be located on the major groove face of the nucleobase, and wherein the chemical modification can include replacing or substituting an atom of a pyrimidine nucleobase with an amine, an SH, a methyl or ethyl, or a chloro or fluoro.
- In some embodiments, the chemical modifications can be located on the sugar moiety of the nucleotide.
- In some embodiments, the chemical modifications can be located on the phosphate backbone of the nucleotide.
- In some embodiments, the chemical modifications can alter the electrochemistry on the major groove face of the nucleotide.
- In another aspect, the present disclosure provides nucleotides that contain chemical modifications, wherein the nucleotide reduces the cellular innate immune response, as compared to the cellular innate immune induced by a corresponding unmodified nucleic acid.
- In another aspect, the present disclosure provides nucleic acid sequences comprising at least two nucleotides, the nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove interacting partner with the nucleic acid sequence, wherein the nucleotide has decreased binding affinity to the major groove binding partner.
- In another aspect, the present disclosure provides compositions comprising a compound as described herein.
- In some embodiments, the composition is a reaction mixture.
- In some embodiments, the composition is a pharmaceutical composition.
- In some embodiments, the composition is a cell culture.
- In some embodiments, the compositions further comprise an RNA polymerase and a cDNA template.
- In some embodiments, the compositions further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- In a further aspect, the present disclosure provides for methods of synthesizing a pharmaceutical nucleic acid, comprising providing a complementary deoxyribonucleic acid (cDNA) that encodes a pharmaceutical protein of interest; selecting a nucleotide that is known to disrupt a binding of a major groove binding partner with a nucleic acid, wherein the nucleotide has decreased binding affinity to the major groove binding partner; and contacting the provided cDNA and the selected nucleotide with an RNA polymerase, under conditions such that the pharmaceutical nucleic acid is synthesized.
- In some embodiments, the pharmaceutical nucleic acid is a ribonucleic acid (RNA).
- In a further aspect, the present disclosure provides for methods of making a pharmaceutical formulation comprising a physiologically active secreted protein, comprising transfecting a first population of human cells with a pharmaceutical nucleic acid made by the methods described herein, wherein the secreted protein is active upon a second population of human cells.
- In some embodiments, the secreted protein is capable of interacting, e.g. binding, with a receptor on the surface of at least one cell present in the second population.
- In some embodiments, the secreted protein is Granulocyte-Colony Stimulating Factor (G-CSF).
- In some embodiments, the second population contains myeloblast cells that express the G-CSF receptor.
- In a further aspect, the present disclosure provides for methods of making a pharmaceutical formulation comprising human cells comprising a physiologically active secreted protein, comprising transfecting a first population of human cells with a pharmaceutical nucleic acid made by the methods described herein, wherein the secreted protein is active upon a second population of human cells.
- At various places in the present specification, substituents of compounds of the present disclosure are disclosed in groups or in ranges. It is specifically intended that the present disclosure include each and every individual subcombination of the members of such groups and ranges. For example, the term “C1-6 alkyl” is specifically intended to individually disclose methyl, ethyl, C3 alkyl, C4 alkyl, C5 alkyl, and C6 alkyl.
- It is further intended that the compounds of the present disclosure are stable. As used herein “stable” refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
- It is further appreciated that certain features of the present disclosure, which are, for clarity, described in the context of separate embodiments, can also be provided in combination in a single embodiment. Conversely, various features of the present disclosure which are, for brevity, described in the context of a single embodiment, can also be provided separately or in any suitable subcombination.
- As used herein, the term “alkyl” is meant to refer to a saturated hydrocarbon group which is straight-chained or branched. Example alkyl groups include methyl (Me), ethyl (Et), propyl (e.g., n-propyl and isopropyl), butyl (e.g., n-butyl, isobutyl, t-butyl), pentyl (e.g., n-pentyl, isopentyl, neopentyl), and the like. An alkyl group can contain from 1 to about 20, from 2 to about 20, from 1 to about 12, from 1 to about 8, from 1 to about 6, from 1 to about 4, or from 1 to about 3 carbon atoms.
- As used herein, “alkenyl” refers to an alkyl group having one or more double carbon-carbon bonds. Example alkenyl groups include ethenyl, propenyl, and the like.
- As used herein, “alkoxy” refers to an —O-alkyl group. Example alkoxy groups include methoxy, ethoxy, propoxy (e.g., n-propoxy and isopropoxy), t-butoxy, and the like.
- As used herein, “alkynyl” refers to an alkyl group having one or more triple carbon-carbon bonds. Example alkynyl groups include ethynyl, propynyl, and the like.
- As used herein, “aryl” refers to monocyclic or polycyclic (e.g., having 2, 3 or 4 fused rings) aromatic hydrocarbons such as, for example, phenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, indenyl, and the like. In some embodiments, aryl groups have from 6 to about 20 carbon atoms.
- As used herein, “halo” or “halogen” includes fluoro, chloro, bromo, and iodo.
- As used herein, “therapeutic agent” refers to any agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
- As used herein, “animal” refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.
- As used herein, “approximately” or “about,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
- As used herein, “associated with,” “conjugated,” “linked,” “attached,” and “tethered,” when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions.
- As used herein, “biologically active” refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. In particular embodiments, where a nucleic acid is biologically active, a portion of that nucleic acid that shares at least one biological activity of the whole nucleic acid is typically referred to as a “biologically active” portion.
- As used herein, “conserved” refers to nucleotides or amino acid residues of a polynucleotide sequence or amino acid sequence, respectively, that are those that occur unaltered in the same position of two or more related sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences. In some embodiments, two or more sequences are said to be “completely conserved” if they are 100% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another.
- As used herein, “expression” of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.
- As used herein, a “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
- As used herein, “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
- As used herein, “in vivo” refers to events that occur within an organism (e.g., animal, plant, or microbe).
- As used herein, “isolated” refers to a substance or entity that has been (1) separated from at least some of the components with which it was associated when initially produced (whether in nature or in an experimental setting), and/or (2) produced, prepared, and/or manufactured by the hand of man. Isolated substances and/or entities may be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is “pure” if it is substantially free of other components.
- As used herein, “subject” or “patient” refers to any organism to which a composition in accordance with the present disclosure may be administered, e.g., for experimental, diagnostic, prophylactic, and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans) and/or plants.
- As used herein, “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
- An individual who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more symptoms of a disease, disorder, and/or condition.
- An individual who is “susceptible to” a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition (for example, cancer) may be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
- As used herein, “therapeutically effective amount” means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
- As used herein, “transcription factor” refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
- As used herein, “treating” refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a particular disease, disorder, and/or condition. For example, “treating” cancer may refer to inhibiting survival, growth, and/or spread of a tumor. Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition. In some embodiments, treatment comprises delivery of a protein associated with a therapeutically active nucleic acid to a subject in need thereof.
- As used herein, “unmodified” refers to a nucleic acid prior to being modified, e.g. adenosine, guanosine, cytosine, thymidine, and uracil, or a naturally occurring amino acid. The compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds of the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically active starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, C═N double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present disclosure. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms.
- Compounds of the present disclosure also include tautomeric forms. Tautomeric forms result from the swapping of a single bond with an adjacent double bond together with the concomitant migration of a proton. Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge. Example prototropic tautomers include ketone—enol pairs, amide—imidic acid pairs, lactam—lactim pairs, amide—imidic acid pairs, enamine—imine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, for example, 1H- and 3H-imidazole, 1H-, 2H- and 4H-1,2,4-triazole, 1H- and 2H-isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.
- Compounds of the present disclosure can also include all isotopes of atoms occurring in the intermediates or final compounds. Isotopes include those atoms having the same atomic number but different mass numbers. For example, isotopes of hydrogen include tritium and deuterium.
- The term “compound,” as used herein, is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted.
- In some embodiments, the compounds of the present disclosure are substantially isolated. By “substantially isolated” is meant that the compound is at least partially or substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof. Methods for isolating compounds and their salts are routine in the art.
- The compounds of the present disclosure, and salts thereof, can also be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
- The present disclosure also includes pharmaceutically acceptable salts of the compounds described herein. As used herein, “pharmaceutically acceptable salts” refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form. Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. The pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. The pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are preferred. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418 and Journal of Pharmaceutical Science, 66, 2 (1977), each of which is incorporated herein by reference in its entirety.
- The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- The present disclosure also includes prodrugs of the compounds described herein. As used herein, “prodrugs” refer to any carriers, typically covalently bonded, which release the active parent drug when administered to a mammalian subject. Prodrugs can be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds. Prodrugs include compounds wherein hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any group that, when administered to a mammalian subject, cleaves to form a free hydroxyl, amino, sulfhydryl, or carboxyl group respectively. Examples of prodrugs include, but are not limited to, acetate, formate and benzoate derivatives of alcohol and amine functional groups in the compounds of the present disclosure. Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, “Pro-drugs as Novel Delivery Systems,” Vol. 14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987, both of which are hereby incorporated by reference in their entirety.
- The present disclosure provides for modified nucleosides and nucleotides. As described herein “nucleoside” is defined as a compound containing a five-carbon sugar molecule (a pentose or ribose) or derivative thereof, and an organic base, purine or pyrimidine, or a derivative thereof. As described herein, “nucleotide” is defined as a nucleoside consisting of a phosphate group. The nucleosides and nucleotides described herein are generally chemically modified on the major groove face. In some embodiments, the major groove chemical modifications can include an amino group, a thiol group, an alkyl group, or a halo group.
- Table 1 below identifies the chemical faces of each canonical nucleotide. Circles identify the atoms comprising the respective chemical regions.
- In some embodiments, modified nucleosides include pyridin-4-one ribonucleoside, 5-aza-uridine, 2-thio-5-aza-uridine, 2-thiouridine, 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxyuridine, 3-methyluridine, 5-carboxymethyl-uridine, 1-carboxymethyl-pseudouridine, 5-propynyl-uridine, 1-propynyl-pseudouridine, 5-taurinomethyluridine, 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine, 1-taurinomethyl-4-thio-uridine, 5-methyl-uridine, 1-methyl-pseudouridine, 4-thio-1-methyl-pseudouridine, 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-1-deaza-pseudouridine, dihydrouridine, dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-dihydropseudouridine, 2-methoxyuridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, and 4-methoxy-2-thio-pseudouridine.
- In some embodiments, modified nucleosides include 5-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine, N4-acetylcytidine, 5-formylcytidine, N4-methylcytidine, 5-hydroxymethylcytidine, 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine, 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza-pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine, 2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine, 4-methoxy-pseudoisocytidine, and 4-methoxy-1-methyl-pseudoisocytidine.
- In other embodiments, modified nucleosides include 2-aminopurine, 2,6-diaminopurine, 7-deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine, 7-deaza-8-aza-2-aminopurine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyl adenosine, N6-methyladenosine, N6-isopentenyladenosine, N6-(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N6-(cis-hydroxyisopentenyl) adenosine, N6-glycinylcarbamoyladenosine, N6-threonylcarbamoyladenosine, 2-methylthio-N6-threonyl carbamoyladenosine, N6,N6-dimethyladenosine, 7-methyladenine, 2-methylthio-adenine, and 2-methoxy-adenine.
- In some embodiments, modified nucleosides include inosine, 1-methyl-inosine, wyosine, wybutosine, 7-deaza-guanosine, 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine, 6-thio-7-methyl-guanosine, 7-methylinosine, 6-methoxy-guanosine, 1-methylguanosine, N2-methylguanosine, N2,N2-dimethylguanosine, 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine, and N2,N2-dimethyl-6-thio-guanosine.
- In some embodiments, the nucleotide can be modified on the major groove face and can include replacement of the hydrogen on C-5 of uracil with a methyl group or a halo group.
- In some embodiments, the nucleoside and nucleotide can be a compound of Formula I:
- wherein:
- Z is O or S;
- each of Y1 is independently selected from —ORa1, it and —SRa1;
- each of Y2 is independently selected from O, NRa, S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y3 is independently selected from O and S;
- Y4 is selected from H, —SRa, and —NHRa;
- n is 0, 1, 2, or 3;
- m is 0, 1, 2 or 3;
- B is a nucleobase;
- Ra is H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl;
- Ra1 and Rb1 are each independently H or a counterion; and
- —Y3—Rc1 is OH or SH at a pH of about 1 or —Y3—Rc1 is O− or S− at physiological pH;
- or —Y3—Rc1 is C1-20 alkoxy, C2-20 —O-alkenyl, or C1-20 —O-alkynyl;
- wherein when B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y1 or Y2 is not O or OH.
- In some embodiments, B is a nucleobase of Formula II-a, II-b, or II-c:
- wherein:
-
- X is O or S;
- U and W are each independently C or N;
- V is O, S, C or N;
- wherein when V is C then R1 is H, C1-6 alkyl, C1-6 alkenyl, C1-6 alkynyl, halo, or —ORc, wherein C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl are each optionally substituted with —OH, —NRaRb, —SH, —C(O)Rc, —C(O)ORc, —NHC(O)Rc, or —NHC(O)ORc;
- and wherein when V is O, S, or N then R1 is absent;
- R2 is H, —NRaRb, or halo;
- or when V is C then R1 and R2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NRaRb, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, C1-20 alkoxy, or C1-20 thioalkyl;
- R3 is H or C1-20 alkyl;
-
- Ra and Rb are each independently H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl; and
- Rc is H, C1-20 alkyl, C2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- In some embodiments, B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- In some embodiments, B is a nucleobase selected from the group consisting of cytosine, guanine, adenine, and uracil.
- In some embodiments, B is a pyrimidine or derivative thereof.
- In some embodiments the nucleotide is a compound of Formula I-a:
- In some embodiments the nucleotide is a compound of Formula I-b:
- In some embodiments the nucleotide is a compound of Formula I-c:
- In some embodiments, the nucleotide is selected from the group consisting of:
- In some embodiments, the nucleotide is selected from the group consisting of:
- For example, the modified nucleotide can be:
- In some embodiments, the major groove chemical modification can include replacement of the C—H group at C-5 with an —NH— group or a —NH(CH3)— group.
- For example, the modified nucleotide can be:
- In another embodiment, the major groove chemical modification can include replacement of the hydrogen at C-5 of cytosine with a halo group or a methyl group.
- For example, the modified nucleotide can be:
- In yet a further embodiment, the major groove chemical modification can include a fused ring that is formed by the NH2 at the C-4 position and the carbon atom at the C-5 position.
- For example, the modified nucleotide can be:
-
- The α-thio substituted phosphate moiety is provided to confer stability to RNA and DNA polymers through the unnatural phosphorothioate backbone linkages. Phosphorothioate DNA and RNA have increased nuclease resistance and subsequently a longer half-life in a cellular environment. Phosphorothioate linked nucleic acids are expected to also reduce the innate immune response through weaker binding/activation of cellular innate immune molecules.
- Further examples of modified nucleotides and modified nucleotide combinations are provided below in Table 2.
-
TABLE 2 Modified Nucleotide Modified Nucleotide Combination 6-aza-cytidine α-thio-cytidine/5-iodo-uridine 2-thio-cytidine α-thio-cytidine/N1-methyl-pseudo-uridine α-thio-cytidine α-thio-cytidine/α-thio-uridine Pseudo-iso-cytidine α-thio-cytidine/5-methyl-uridine 5-aminoallyl-uridine α-thio-cytidine/pseudo-uridine 5-iodo-uridine Pseudo-iso-cytidine/5-iodo-uridine N1-methyl- Pseudo-iso-cytidine/N1-methyl-pseudo-uridine pseudouridine 5,6-dihydrouridine Pseudo-iso-cytidine/α-thio-uridine α-thio-uridine Pseudo-iso-cytidine/5-methyl-uridine 4-thio-uridine Pseudo-iso-cytidine/Pseudo-uridine 6-aza-uridine Pyrrolo-cytidine 5-hydroxy-uridine Pyrrolo-cytidine/5-iodo-uridine Deoxy-thymidine Pyrrolo-cytidine/N1-methyl-pseudo-uridine Pseudo-uridine Pyrrolo-cytidine/α-thio-uridine Inosine Pyrrolo-cytidine/5-methyl-uridine α-thio-guanosine Pyrrolo-cytidine/Pseudo-uridine 8-oxo-guanosine 5-methyl-cytidine/5-iodo-uridine O6-methyl-guanosine 5-methyl-cytidine/N1-methyl-pseudo-uridine 7-deaza-guanosine 5-methyl-cytidine/α-thio-uridine No modification 5-methyl-cytidine/5-methyl-uridine N1-methyl-adenosine 5-methyl-cytidine/Pseudo-uridine 2-amino-6-Chloro- 5-methyl-cytidine purine N6-methyl-2-amino- 25% Pseudo-iso-cytidine purine 6-Chloro-purine 25% N1-methyl-pseudo-uridine N6-methyl-adenosine 25% N1-Methyl-pseudo-uridine/75%-pseudo-uridine α-thio-adenosine 5-methyl-uridine 8-azido-adenosine 5-iodo-cytidine 7-deaza-adenosine - The modified nucleosides and nucleotides disclosed herein can be prepared from readily available starting materials using the following general methods and procedures. It is understood that where typical or preferred process conditions (i.e., reaction temperatures, times, mole ratios of reactants, solvents, pressures, etc.) are given; other process conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvent used, but such conditions can be determined by one skilled in the art by routine optimization procedures.
- The processes described herein can be monitored according to any suitable method known in the art. For example, product formation can be monitored by spectroscopic means, such as nuclear magnetic resonance spectroscopy (e.g., 1H or 13C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high performance liquid chromatography (HPLC) or thin layer chromatography.
- Preparation of modified nucleosides and nucleotides can involve the protection and deprotection of various chemical groups. The need for protection and deprotection, and the selection of appropriate protecting groups can be readily determined by one skilled in the art. The chemistry of protecting groups can be found, for example, in Greene, et al., Protective Groups in Organic Synthesis, 2d. Ed., Wiley & Sons, 1991, which is incorporated herein by reference in its entirety.
- The reactions of the processes described herein can be carried out in suitable solvents, which can be readily selected by one of skill in the art of organic synthesis. Suitable solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, i.e., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature. A given reaction can be carried out in one solvent or a mixture of more than one solvent. Depending on the particular reaction step, suitable solvents for a particular reaction step can be selected. Resolution of racemic mixtures of modified nucleosides and nucleotides can be carried out by any of numerous methods known in the art. An example method includes fractional recrystallization using a “chiral resolving acid” which is an optically active, salt-forming organic acid. Suitable resolving agents for fractional recrystallization methods are, for example, optically active acids, such as the D and L forms of tartaric acid, diacetyltartaric acid, dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or the various optically active camphorsulfonic acids. Resolution of racemic mixtures can also be carried out by elution on a column packed with an optically active resolving agent (e.g., dinitrobenzoylphenylglycine). Suitable elution solvent composition can be determined by one skilled in the art.
- Exemplary syntheses of modified nucleotides are provided below in
1 and 2.Schemes - Modified nucleosides and nucleotides can also be prepared according to the synthetic methods described in Ogata et al. Journal of Organic Chemistry 74:2585-2588, 2009; Purmal et al. Nucleic Acids Research 22(1): 72-78, 1994; Fukuhara et al. Biochemistry 1(4): 563-568, 1962; and Xu et al. Tetrahedron 48(9): 1729-1740, 1992, each of which are incorporated by reference in their entirety.
- The present disclosure provides nucleic acids, including RNAs such as mRNAs that contain one or more modified nucleosides (termed “modified nucleic acids”) or nucleotides as described herein, which have useful properties including the significant decreast or lack of a substantial induction of the innate immune response of a cell into which the mRNA is introduced, or the suppression thereof. Because these modified nucleic acids enhance the efficiency of protein production, intracellular retention of nucleic acids, and viability of contacted cells, as well as possess reduced immunogenicity, of these nucleic acids compared to unmodified nucleic acids, having these properties are termed “enhanced nucleic acids” herein.
- In addition, the present disclosure provides nucleic acids, which have decreased binding affinity to a major groove interacting, e.g. binding, partner. For example, the nucleic acids are comprised of at least one nucleotide that has been chemically modified on the major groove face as described herein.
- The term “nucleic acid,” in its broadest sense, includes any compound and/or substance that is or can be incorporated into an oligonucleotide chain. Exemplary nucleic acids for use in accordance with the present disclosure include, but are not limited to, one or more of DNA, RNA including messenger mRNA (mRNA), hybrids thereof, RNAi-inducing agents, RNAi agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes, catalytic DNA, RNAs that induce triple helix formation, aptamers, vectors, etc., described in detail herein.
- Provided are modified nucleic acids containing a translatable region and one, two, or more than two different nucleoside modifications. In some embodiments, the modified nucleic acid exhibits reduced degradation in a cell into which the nucleic acid is introduced, relative to a corresponding unmodified nucleic acid. Exemplary nucleic acids include ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), locked nucleic acids (LNAs) or a hybrid thereof. In preferred embodiments, the modified nucleic acid includes messenger RNAs (mRNAs). As described herein, the nucleic acids of the present disclosure do not substantially induce an innate immune response of a cell into which the mRNA is introduced.
- In certain embodiments, it is desirable to intracellularly degrade a modified nucleic acid introduced into the cell, for example if precise timing of protein production is desired. Thus, the present disclosure provides a modified nucleic acid containing a degradation domain, which is capable of being acted on in a directed manner within a cell.
- Other components of nucleic acid are optional, and are beneficial in some embodiments. For example, a 5′ untranslated region (UTR) and/or a 3′UTR are provided, wherein either or both may independently contain one or more different nucleoside modifications. In such embodiments, nucleoside modifications may also be present in the translatable region. Also provided are nucleic acids containing a Kozak sequence.
- Additionally, provided are nucleic acids containing one or more intronic nucleotide sequences capable of being excised from the nucleic acid.
- Further, provided are nucleic acids containing an internal ribosome entry site (IRES). An IRES may act as the sole ribosome binding site, or may serve as one of multiple ribosome binding sites of an mRNA. An mRNA containing more than one functional ribosome binding site may encode several peptides or polypeptides that are translated independently by the ribosomes (“multicistronic mRNA”). When nucleic acids are provided with an IRES, further optionally provided is a second translatable region. Examples of IRES sequences that can be used according to the present disclosure include without limitation, those from picornaviruses (e.g. FMDV), pest viruses (CFFV), polio viruses (PV), encephalomyocarditis viruses (ECMV), foot-and-mouth disease viruses (FMDV), hepatitis C viruses (HCV), classical swine fever viruses (CSFV), murine leukemia virus (MLV), simian immune deficiency viruses (SIV) or cricket paralysis viruses (CrPV).
- In some embodiments, the nucleic acid sequences comprise a compound of Formula I-d:
- wherein:
- Z is O or S;
- each of Y1 is independently selected from —ORa1, —NRa1Rb1, and —SRal;
- each of Y2 is independently selected from O, NRa, S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y3 is independently selected from O and S;
- Y4 is selected from H, —ORa, —SRa, and —NHRa;
- B is a nucleobase;
- Ra is H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl;
- Ra1 and Rb1 are each independently H or a counterion; and
- —Y3—Rc1 is OH or SH at a pH of about 1 or —Y3—Rc1 is O− or S− at physiological pH;
- or —Y3—Rc1 is C1-20 alkoxy, C2-20 —O-alkenyl, or C1-20 —O-alkynyl;
- wherein when B is an unmodified nucleobase selected from cytosine, guanine, thymidine, uracil and adenine, then at least one of Z, Y′ or Y2 is not O or OH.
- In some embodiments, B is a nucleobase of Formula II-a, II-b, or II-c:
- wherein:
-
- X is O or S;
- U and W are each independently C or N;
- V is O, S, C or N;
- wherein when V is C then R1 is H, C1-6 alkyl, C1-6 alkenyl, C1-6 alkynyl, halo, or —ORc, wherein C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl are each optionally substituted with —OH, —NRaRb, —SH, —C(O)Rc, —C(O)ORc, —NHC(O)Rc, or —NHC(O)ORc;
- and wherein when V is O, S, or N then R1 is absent;
- R2 is H, —NRaRb, or halo;
- or when V is C then R1 and R2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NRaRb, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, C1-20 alkoxy, or C1-20 thioalkyl;
- R3 is H or C1-20 alkyl;
-
- Ra and Rb are each independently H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl; and
- Rc is H, C1-20 alkyl, C2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- In some embodiments, B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- In some embodiments, at least 25% of the cytosines are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- In some embodiments, at least 25% of the uracils are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- In some embodiments, at least 25% of the cytosines and 25% of the uracils are replaced by a compound of Formula I-a (e.g., at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%).
- In some embodiments, the nucleic acid is translatable.
- As described herein, the phrase “major groove interacting partner” refers RNA recognition receptors that detect and respond to RNA ligands through interactions, e.g. binding, with the major groove face of a nucleotide or nucleic acid. As such, RNA ligands comprising modified nucleotides or nucleic acids as described herein decrease interactions with major groove binding partners, and therefore decrease an innate immune response, or expression and secretion of pro-inflammatory cytokines, or both.
- Example major groove interacting, e.g. binding, partners include, but are not limited to the following nucleases and helicases. Within membranes, TLRs (Toll-like Receptors) 3, 7, and 8 can respond to single- and double-stranded RNAs. Within the cytoplasm, members of the
superfamily 2 class of DEX(D/H) helicases and ATPases can sense RNAs to initiate antiviral responses. These helicases include the RIG-I (retinoic acid-inducible gene I) and MDA5 (melanoma differentiation-associated gene 5). Other examples include laboratory of genetics and physiology 2 (LGP2), HIN-200 domain containing proteins, or Helicase-domain containing proteins. - The term “innate immune response” includes a cellular response to exogenous nucleic acids, including single stranded nucleic acids, generally of viral or bacterial origin, which involves the induction of cytokine expression and release, particularly the interferons, and cell death. Protein synthesis is also reduced during the innate cellular immune response. While it is advantageous to eliminate the innate immune response in a cell, the present disclosure provides modified mRNAs that substantially reduce the immune response, including interferon signaling, without entirely eliminating such a response. In some embodiments, the immune response is reduced by 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.9%, or greater than 99.9% as compared to the immune response induced by a corresponding unmodified nucleic acid. Such a reduction can be measured by expression or activity level of
Type 1 interferons or the expression of interferon-regulated genes such as the toll-like receptors (e.g., TLR7 and TLR8). Reduction of innate immune response can also be measured by decreased cell death following one or more administrations of modified RNAs to a cell population; e.g., cell death is 10%, 25%, 50%, 75%, 85%, 90%, 95%, or over 95% less than the cell death frequency observed with a corresponding unmodified nucleic acid. Moreover, cell death may affect fewer than 50%, 40%, 30%, 20%, 10%, 5%, 1%, 0.1%, 0.01% or fewer than 0.01% of cells contacted with the modified nucleic acids. - The present disclosure provides for the repeated introduction (e.g., transfection) of modified nucleic acids into a target cell population, e.g., in vitro, ex vivo, or in vivo. The step of contacting the cell population may be repeated one or more times (such as two, three, four, five or more than five times). In some embodiments, the step of contacting the cell population with the modified nucleic acids is repeated a number of times sufficient such that a predetermined efficiency of protein translation in the cell population is achieved. Given the reduced cytotoxicity of the target cell population provided by the nucleic acid modifications, such repeated transfections are achievable in a diverse array of cell types.
- Provided are nucleic acids that encode variant polypeptides, which have a certain identity with a reference polypeptide sequence. The term “identity” as known in the art, refers to a relationship between the sequences of two or more peptides, as determined by comparing the sequences. In the art, “identity” also means the degree of sequence relatedness between peptides, as determined by the number of matches between strings of two or more amino acid residues. “Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., “algorithms”). Identity of related peptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data,
Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math. 48, 1073 (1988). - In some embodiments, the polypeptide variant has the same or a similar activity as the reference polypeptide. Alternatively, the variant has an altered activity (e.g., increased or decreased) relative to a reference polypeptide. Generally, variants of a particular polynucleotide or polypeptide of the present disclosure will have at least about 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to that particular reference polynucleotide or polypeptide as determined by sequence alignment programs and parameters described herein and known to those skilled in the art.
- As recognized by those skilled in the art, protein fragments, functional protein domains, and homologous proteins are also considered to be within the scope of this present disclosure. For example, provided herein is any protein fragment of a reference protein (meaning a polypeptide sequence at least one amino acid residue shorter than a reference polypeptide sequence but otherwise identical) 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or greater than 100 amino acids in length In another example, any protein that includes a stretch of about 20, about 30, about 40, about 50, or about 100 amino acids which are about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, or about 100% identical to any of the sequences described herein can be utilized in accordance with the present disclosure. In certain embodiments, a protein sequence to be utilized in accordance with the present disclosure includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as shown in any of the sequences provided or referenced herein.
- Also provided are polynucleotide libraries containing nucleoside modifications, wherein the polynucleotides individually contain a first nucleic acid sequence encoding a polypeptide, such as an antibody, protein binding partner, scaffold protein, and other polypeptides known in the art. Preferably, the polynucleotides are mRNA in a form suitable for direct introduction into a target cell host, which in turn synthesizes the encoded polypeptide.
- In certain embodiments, multiple variants of a protein, each with different amino acid modification(s), are produced and tested to determine the best variant in terms of pharmacokinetics, stability, biocompatibility, and/or biological activity, or a biophysical property such as expression level. Such a library may contain 10, 102, 103, 104, 105, 106, 107, 108, 109, or over 109 possible variants (including substitutions, deletions of one or more residues, and insertion of one or more residues).
- Proper protein translation involves the physical aggregation of a number of polypeptides and nucleic acids associated with the mRNA. Provided by the present disclosure are protein-nucleic acid complexes, containing a translatable mRNA having one or more nucleoside modifications (e.g., at least two different nucleoside modifications) and one or more polypeptides bound to the mRNA. Generally, the proteins are provided in an amount effective to prevent or reduce an innate immune response of a cell into which the complex is introduced.
- As described herein, provided are mRNAs having sequences that are substantially not translatable. Such mRNA is effective as a vaccine when administered to a mammalian subject.
- Also provided are modified nucleic acids that contain one or more noncoding regions. Such modified nucleic acids are generally not translated, but are capable of binding to and sequestering one or more translational machinery component such as a ribosomal protein or a transfer RNA (tRNA), thereby effectively reducing protein expression in the cell. The modified nucleic acid may contain a small nucleolar RNA (sno-RNA), micro RNA (miRNA), small interfering RNA (siRNA) or Piwi-interacting RNA (piRNA).
- Nucleic acids for use in accordance with the present disclosure may be prepared according to any available technique including, but not limited to chemical synthesis, enzymatic synthesis, which is generally termed in vitro transcription, enzymatic or chemical cleavage of a longer precursor, etc. Methods of synthesizing RNAs are known in the art (see, e.g., Gait, M. J. (ed.) Oligonucleotide synthesis: a practical approach, Oxford [Oxfordshire], Washington, D.C.: IRL Press, 1984; and Herdewijn, P. (ed.) Oligonucleotide synthesis: methods and applications, Methods in Molecular Biology, v. 288 (Clifton, N.J.) Totowa, N.J.: Humana Press, 2005; both of which are incorporated herein by reference).
- The modified nucleosides and nucleotides disclosed herein can be prepared from readily available starting materials using the following general methods and procedures. It is understood that where typical or preferred process conditions (i.e., reaction temperatures, times, mole ratios of reactants, solvents, pressures, etc.) are given; other process conditions can also be used unless otherwise stated. Optimum reaction conditions may vary with the particular reactants or solvent used, but such conditions can be determined by one skilled in the art by routine optimization procedures.
- The processes described herein can be monitored according to any suitable method known in the art. For example, product formation can be monitored by spectroscopic means, such as nuclear magnetic resonance spectroscopy (e.g., 1H or 13C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high performance liquid chromatography (HPLC) or thin layer chromatography.
- Preparation of modified nucleosides and nucleotides can involve the protection and deprotection of various chemical groups. The need for protection and deprotection, and the selection of appropriate protecting groups can be readily determined by one skilled in the art. The chemistry of protecting groups can be found, for example, in Greene, et al., Protective Groups in Organic Synthesis, 2d. Ed., Wiley & Sons, 1991, which is incorporated herein by reference in its entirety.
- The reactions of the processes described herein can be carried out in suitable solvents, which can be readily selected by one of skill in the art of organic synthesis. Suitable solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products at the temperatures at which the reactions are carried out, i.e., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature. A given reaction can be carried out in one solvent or a mixture of more than one solvent. Depending on the particular reaction step, suitable solvents for a particular reaction step can be selected.
- Resolution of racemic mixtures of modified nucleosides and nucleotides can be carried out by any of numerous methods known in the art. An example method includes fractional recrystallization using a “chiral resolving acid” which is an optically active, salt-forming organic acid. Suitable resolving agents for fractional recrystallization methods are, for example, optically active acids, such as the D and L forms of tartaric acid, diacetyltartaric acid, dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or the various optically active camphorsulfonic acids. Resolution of racemic mixtures can also be carried out by elution on a column packed with an optically active resolving agent (e.g., dinitrobenzoylphenylglycine). Suitable elution solvent composition can be determined by one skilled in the art. Modified nucleic acids need not be uniformly modified along the entire length of the molecule. Different nucleotide modifications and/or backbone structures may exist at various positions in the nucleic acid. One of ordinary skill in the art will appreciate that the nucleotide analogs or other modification(s) may be located at any position(s) of a nucleic acid such that the function of the nucleic acid is not substantially decreased. A modification may also be a 5′ or 3′ terminal modification. The nucleic acids may contain at a minimum one and at maximum 100% modified nucleotides, or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides. For example, the nucleic acids may contain a modified pyrimidine such as uracil or cytosine. In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the nucleic acid is replaced with a modified uracil. The modified uracil can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures). In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the cytosine in the nucleic acid is replaced with a modified cytosine. The modified cytosine can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures).
- Generally, the shortest length of a modified mRNA of the present disclosure can be the length of an mRNA sequence that is sufficient to encode for a dipeptide. In another embodiment, the length of the mRNA sequence is sufficient to encode for a tripeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a tetrapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a pentapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a hexapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a heptapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for an octapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a nonapeptide. In another embodiment, the length of an mRNA sequence is sufficient to encode for a decapeptide.
- Examples of dipeptides that the modified nucleic acid sequences can encode for include, but are not limited to, carnosine and anserine.
- In a further embodiment, the mRNA is greater than 30 nucleotides in length. In another embodiment, the RNA molecule is greater than 35 nucleotides in length. In another embodiment, the length is at least 40 nucleotides. In another embodiment, the length is at least 45 nucleotides. In another embodiment, the length is at least 55 nucleotides. In another embodiment, the length is at least 60 nucleotides. In another embodiment, the length is at least 60 nucleotides. In another embodiment, the length is at least 80 nucleotides. In another embodiment, the length is at least 90 nucleotides. In another embodiment, the length is at least 100 nucleotides. In another embodiment, the length is at least 120 nucleotides. In another embodiment, the length is at least 140 nucleotides. In another embodiment, the length is at least 160 nucleotides. In another embodiment, the length is at least 180 nucleotides. In another embodiment, the length is at least 200 nucleotides. In another embodiment, the length is at least 250 nucleotides. In another embodiment, the length is at least 300 nucleotides. In another embodiment, the length is at least 350 nucleotides. In another embodiment, the length is at least 400 nucleotides. In another embodiment, the length is at least 450 nucleotides. In another embodiment, the length is at least 500 nucleotides. In another embodiment, the length is at least 600 nucleotides. In another embodiment, the length is at least 700 nucleotides. In another embodiment, the length is at least 800 nucleotides. In another embodiment, the length is at least 900 nucleotides. In another embodiment, the length is at least 1000 nucleotides. In another embodiment, the length is at least 1100 nucleotides. In another embodiment, the length is at least 1200 nucleotides. In another embodiment, the length is at least 1300 nucleotides. In another embodiment, the length is at least 1400 nucleotides. In another embodiment, the length is at least 1500 nucleotides. In another embodiment, the length is at least 1600 nucleotides. In another embodiment, the length is at least 1800 nucleotides. In another embodiment, the length is at least 2000 nucleotides. In another embodiment, the length is at least 2500 nucleotides. In another embodiment, the length is at least 3000 nucleotides. In another embodiment, the length is at least 4000 nucleotides. In another embodiment, the length is at least 5000 nucleotides, or greater than 5000 nucleotides.
- The present disclosure provides methods of preparing a nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove interacting partner with the nucleic acid sequence, wherein the nucleic acid sequence comprises a compound of Formula I-d:
- wherein:
- Z is O or S;
- each of Y1 is independently selected from —ORa1, —NRa1Rb1, and —SRa1;
- each of Y2 is independently selected from O, NRa, S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y3 is independently selected from O and S;
- Y4 is selected from H, —ORa, —SRa, and —NHRa;
- B is a nucleobase;
- Ra is H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl;
- Ra1 and Rb1 are each independently H or a counterion; and
- —Y3—Rc1 is OH or SH at a pH of about 1 or —Y3—Rc1 is O− or S− at physiological pH;
- or —Y3—Rc1 is C1-20 alkoxy, C2-20 —O-alkenyl, or C1-20 —O-alkynyl;
- wherein when B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y1 or Y2 is not O or OH;
the method comprising:
reacting a compound of Formula I-c: - with an RNA polymerase, and a cDNA template.
- In some embodiments, the reaction is repeated from 1 to about 7,000 times.
- In some embodiments, B is a nucleobase of Formula II-a, Mb, or II-c:
- wherein:
-
- X is O or S;
- U and W are each independently C or N;
- V is O, S, C or N;
- wherein when V is C then R1 is H, C1-6 alkyl, C1-6 alkenyl, C1-6 alkynyl, halo, or —ORc, wherein C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl are each optionally substituted with —OH, —NRaRb, —SH, —C(O)Rc, —C(O)ORc, —NHC(O)Rc, or —NHC(O)ORc;
- and wherein when V is O, S, or N then R1 is absent;
- R2 is H, —ORc, —SRc, —NRaRb, or halo;
- or when V is C then R1 and R2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NRaRb, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, C1-20 alkoxy, or C1-20 thioalkyl;
- R3 is H or C1-20 alkyl;
-
- Ra and Rb are each independently H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl; and
- Rc is H, C1-20 alkyl, C2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- In some embodiments, B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- In some embodiments, the methods further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- In some embodiments, the nucleobase is a pyrimidine or derivative thereof.
- In a further aspect, the present disclosure provides methods of amplifying a nucleic acid sequence comprising a nucleotide that disrupts binding of a major groove binding partner with the nucleic acid sequence, the method comprising:
- reacting a compound of Formula I-c:
- Z is O or S;
- each of Y1 is independently selected from —ORa1, —NRa1Rb1, and —SRa1;
- each of Y2 is independently selected from O, NRa, S or a linker comprising an atom selected from the group consisting of C, O, N, and S;
- each of Y3 is independently selected from O and S;
- Y4 is selected from H, —ORa, —SRa, and —NHRa;
- B is a nucleobase;
- Ra is H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl;
- Ra1 and Rb1 are each independently H or a counterion; and
- —Y3—Rc1 is OH or SH at a pH of about 1 or —Y3—Rc1 is O− or S− at physiological pH;
- or —Y3—Rc1 is C1-20 alkoxy, C2-20 —O-alkenyl, or C1-20 —O-alkynyl;
- wherein when B is an unmodified nucleobase selected from cytosine, guanine, uracil and adenine, then at least one of Z, Y1 or Y2 is not O or OH; with a primer, a cDNA template, and an RNA polymerase.
- In some embodiments, B is a nucleobase of Formula II-a, II-b, or II-c:
- wherein:
-
- X is O or S;
- U and W are each independently C or N;
- V is O, S, C or N;
- wherein when V is C then R1 is H, C1-6 alkyl, C1-6 alkenyl, C1-6 alkynyl, halo, or —ORc, wherein C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl are each optionally substituted with —OH, —NRaRb, —SH, —C(O)R′, —C(O)OR′, —NHC(O)Rc, or —NHC(O)ORc;
- and wherein when V is O, S, or N then R1 is absent;
- R2 is H, —ORc, —SR', —NRaRb, or halo;
- or when V is C then R1 and R2 together with the carbon atoms to which they are attached can form a 5- or 6-membered ring optionally substituted with 1-4 substituents selected from halo, —OH, —SH, —NRaRb, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, C1-20 alkoxy, or C1-20 thioalkyl;
- R3 is H or C1-20 alkyl;
-
- Ra and Rb are each independently H, C1-20 alkyl, C2-20 alkenyl, C2-20 alkynyl, or C6-20 aryl; and
- Rc is H, C1-20 alkyl, C2-20 alkenyl, phenyl, benzyl, a polyethylene glycol group, or an amino-polyethylene glycol group.
- In some embodiments, B is a nucleobase of Formula II-al, II-a2, II-a3, II-a4, or II-a5:
- In some embodiments, the methods further comprise a nucleotide selected from the group consisting of adenosine, cytosine, guanosine, and uracil.
- In some embodiments, the nucleobase is a pyrimidine or derivative thereof.
- The modified nucleic acids and the proteins translated from the modified nucleic acids described herein can be used as therapeutic agents. For example, a modified nucleic acid described herein can be administered to a subject, wherein the modified nucleic acid is translated in vivo to produce a therapeutic peptide in the subject. Accordingly, provided herein are compositions, methods, kits, and reagents for treatment or prevention of disease or conditions in humans and other mammals. The active therapeutic agents of the present disclosure include modified nucleic acids, cells containing modified nucleic acids or polypeptides translated from the modified nucleic acids, polypeptides translated from modified nucleic acids, and cells contacted with cells containing modified nucleic acids or polypeptides translated from the modified nucleic acids.
- In certain embodiments, provided are combination therapeutics containing one or more modified nucleic acids containing translatable regions that encode for a protein or proteins that boost a mammalian subject's immunity along with a protein that induces antibody-dependent cellular toxitity. For example, provided are therapeutics containing one or more nucleic acids that encode trastuzumab and granulocyte-colony stimulating factor (G-CSF). In particular, such combination therapeutics are useful in Her2+ breast cancer patients who develop induced resistance to trastuzumab. (See, e.g., Albrecht, Immunotherapy. 2(6):795-8 (2010)).
- Provided are methods of inducing translation of a recombinant polypeptide in a cell population using the modified nucleic acids described herein. Such translation can be in vivo, ex vivo, in culture, or in vitro. The cell population is contacted with an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification, and a translatable region encoding the recombinant polypeptide. The population is contacted under conditions such that the nucleic acid is localized into one or more cells of the cell population and the recombinant polypeptide is translated in the cell from the nucleic acid.
- An effective amount of the composition is provided based, at least in part, on the target tissue, target cell type, means of administration, physical characteristics of the nucleic acid (e.g., size, and extent of modified nucleosides), and other determinants. In general, an effective amount of the composition provides efficient protein production in the cell, preferably more efficient than a composition containing a corresponding unmodified nucleic acid. Increased efficiency may be demonstrated by increased cell transfection (i.e., the percentage of cells transfected with the nucleic acid), increased protein translation from the nucleic acid, decreased nucleic acid degradation (as demonstrated, e.g., by increased duration of protein translation from a modified nucleic acid), or reduced innate immune response of the host cell.
- Aspects of the present disclosure are directed to methods of inducing in vivo translation of a recombinant polypeptide in a mammalian subject in need thereof. Therein, an effective amount of a composition containing a nucleic acid that has at least one nucleoside modification and a translatable region encoding the recombinant polypeptide is administered to the subject using the delivery methods described herein. The nucleic acid is provided in an amount and under other conditions such that the nucleic acid is localized into a cell of the subject and the recombinant polypeptide is translated in the cell from the nucleic acid. The cell in which the nucleic acid is localized, or the tissue in which the cell is present, may be targeted with one or more than one rounds of nucleic acid administration.
- Other aspects of the present disclosure relate to transplantation of cells containing modified nucleic acids to a mammalian subject. Administration of cells to mammalian subjects is known to those of ordinary skill in the art, such as local implantation (e.g., topical or subcutaneous administration), organ delivery or systemic injection (e.g., intravenous injection or inhalation), as is the formulation of cells in pharmaceutically acceptable carrier. Compositions containing modified nucleic acids are formulated for administration intramuscularly, transarterially, intraperitoneally, intravenously, intranasally, subcutaneously, endoscopically, transdermally, or intrathecally. In some embodiments, the composition is formulated for extended release.
- The subject to whom the therapeutic agent is administered suffers from or is at risk of developing a disease, disorder, or deleterious condition. Provided are methods of identifying, diagnosing, and classifying subjects on these bases, which may include clinical diagnosis, biomarker levels, genome-wide association studies (GWAS), and other methods known in the art.
- In certain embodiments, the administered modified nucleic acid directs production of one or more recombinant polypeptides that provide a functional activity which is substantially absent in the cell in which the recombinant polypeptide is translated. For example, the missing functional activity may be enzymatic, structural, or gene regulatory in nature.
- In other embodiments, the administered modified nucleic acid directs production of one or more recombinant polypeptides that replace a polypeptide (or multiple polypeptides) that is substantially absent in the cell in which the recombinant polypeptide is translated. Such absence may be due to genetic mutation of the encoding gene or regulatory pathway thereof. Alternatively, the recombinant polypeptide functions to antagonize the activity of an endogenous protein present in, on the surface of, or secreted from the cell. Usually, the activity of the endogenous protein is deleterious to the subject, for example, do to mutation of the endogenous protein resulting in altered activity or localization. Additionally, the recombinant polypeptide antagonizes, directly or indirectly, the activity of a biological moiety present in, on the surface of, or secreted from the cell. Examples of antagonized biological moieties include lipids (e.g., cholesterol), a lipoprotein (e.g., low density lipoprotein), a nucleic acid, a carbohydrate, or a small molecule toxin.
- The recombinant proteins described herein are engineered for localization within the cell, potentially within a specific compartment such as the nucleus, or are engineered for secretion from the cell or translocation to the plasma membrane of the cell.
- As described herein, a useful feature of the modified nucleic acids of the present disclosure is the capacity to reduce the innate immune response of a cell to an exogenous nucleic acid. Provided are methods for performing the titration, reduction or elimination of the immune response in a cell or a population of cells. In some embodiments, the cell is contacted with a first composition that contains a first dose of a first exogenous nucleic acid including a translatable region and at least one nucleoside modification, and the level of the innate immune response of the cell to the first exogenous nucleic acid is determined. Subsequently, the cell is contacted with a second composition, which includes a second dose of the first exogenous nucleic acid, the second dose containing a lesser amount of the first exogenous nucleic acid as compared to the first dose. Alternatively, the cell is contacted with a first dose of a second exogenous nucleic acid. The second exogenous nucleic acid may contain one or more modified nucleosides, which may be the same or different from the first exogenous nucleic acid or, alternatively, the second exogenous nucleic acid may not contain modified nucleosides. The steps of contacting the cell with the first composition and/or the second composition may be repeated one or more times. Additionally, efficiency of protein production (e.g., protein translation) in the cell is optionally determined, and the cell may be re-transfected with the first and/or second composition repeatedly until a target protein production efficiency is achieved.
- Provided are methods for treating or preventing a symptom of diseases characterized by missing or aberrant protein activity, by replacing the missing protein activity or overcoming the aberrant protein activity. Because of the rapid initiation of protein production following introduction of modified mRNAs, as compared to viral DNA vectors, the compounds of the present disclosure are particularly advantageous in treating acute diseases such as sepsis, stroke, and myocardial infarction. Moreover, the lack of transcriptional regulation of the modified mRNAs of the present disclosure is advantageous in that accurate titration of protein production is achievable.
- Diseases characterized by dysfunctional or aberrant protein activity include, but not limited to, cancer and proliferative diseases, genetic diseases (e.g., cystic fibrosis), autoimmune diseases, diabetes, neurodegenerative diseases, cardiovascular diseases, and metabolic diseases. The present disclosure provides a method for treating such conditions or diseases in a subject by introducing nucleic acid or cell-based therapeutics containing the modified nucleic acids provided herein, wherein the modified nucleic acids encode for a protein that antagonizes or otherwise overcomes the aberrant protein activity present in the cell of the subject. Specific examples of a dysfunctional protein are the missense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a dysfunctional protein variant of CFTR protein, which causes cystic fibrosis.
- Multiple diseases are characterized by missing (or substantially diminished such that proper protein function does not occur) protein activity. Such proteins may not be present, or are essentially non-functional. The present disclosure provides a method for treating such conditions or diseases in a subject by introducing nucleic acid or cell-based therapeutics containing the modified nucleic acids provided herein, wherein the modified nucleic acids encode for a protein that replaces the protein activity missing from the target cells of the subject. Specific examples of a dysfunctional protein are the nonsense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a nonfunctional protein variant of CFTR protein, which causes cystic fibrosis.
- Thus, provided are methods of treating cystic fibrosis in a mammalian subject by contacting a cell of the subject with a modified nucleic acid having a translatable region that encodes a functional CFTR polypeptide, under conditions such that an effective amount of the CTFR polypeptide is present in the cell. Preferred target cells are epithelial cells, such as the lung, and methods of administration are determined in view of the target tissue; i.e., for lung delivery, the RNA molecules are formulated for administration by inhalation.
- In another embodiment, the present disclosure provides a method for treating hyperlipidemia in a subject, by introducing into a cell population of the subject with a modified mRNA molecule encoding Sortilin, a protein recently characterized by genomic studies, thereby ameliorating the hyperlipidemia in a subject. The SORT1 gene encodes a trans-Golgi network (TGN) transmembrane protein called Sortilin. Genetic studies have shown that one of five individuals has a single nucleotide polymorphism, rs12740374, in the 1p13 locus of the SORT I gene that predisposes them to having low levels of low-density lipoprotein (LDL) and very-low-density lipoprotein (VLDL). Each copy of the minor allele, present in about 30% of people, alters LDL cholesterol by 8 mg/dL, while two copies of the minor allele, present in about 5% of the population, lowers
LDL cholesterol 16 mg/dL. Carriers of the minor allele have also been shown to have a 40% decreased risk of myocardial infarction. Functional in vivo studies in mice describes that overexpression of SORT1 in mouse liver tissue led to significantly lower LDL-cholesterol levels, as much as 80% lower, and that silencing SORT1 increased LDL cholesterol approximately 200% (Musunuru K et al. From noncoding variant to phenotype via SORT1 at the 1p13 cholesterol locus. Nature 2010; 466: 714-721). - Methods of the present disclosure enhance nucleic acid delivery into a cell population, in vivo, ex vivo, or in culture. For example, a cell culture containing a plurality of host cells (e.g., eukaryotic cells such as yeast or mammalian cells) is contacted with a composition that contains an enhanced nucleic acid having at least one nucleoside modification and, optionally, a translatable region. The composition also generally contains a transfection reagent or other compound that increases the efficiency of enhanced nucleic acid uptake into the host cells. The enhanced nucleic acid exhibits enhanced retention in the cell population, relative to a corresponding unmodified nucleic acid. The retention of the enhanced nucleic acid is greater than the retention of the unmodified nucleic acid. In some embodiments, it is at least about 50%, 75%, 90%, 95%, 100%, 150%, 200% or more than 200% greater than the retention of the unmodified nucleic acid. Such retention advantage may be achieved by one round of transfection with the enhanced nucleic acid, or may be obtained following repeated rounds of transfection.
- In some embodiments, the enhanced nucleic acid is delivered to a target cell population with one or more additional nucleic acids. Such delivery may be at the same time, or the enhanced nucleic acid is delivered prior to delivery of the one or more additional nucleic acids. The additional one or more nucleic acids may be modified nucleic acids or unmodified nucleic acids. It is understood that the initial presence of the enhanced nucleic acids does not substantially induce an innate immune response of the cell population and, moreover, that the innate immune response will not be activated by the later presence of the unmodified nucleic acids. In this regard, the enhanced nucleic acid may not itself contain a translatable region, if the protein desired to be present in the target cell population is translated from the unmodified nucleic acids.
- In some embodiments, modified nucleic acids are provided to express a protein-binding partner or a receptor on the surface of the cell, which functions to target the cell to a specific tissue space or to interact with a specific moiety, either in vivo or in vitro. Suitable protein-binding partners include antibodies and functional fragments thereof, scaffold proteins, or peptides. Additionally, modified nucleic acids can be employed to direct the synthesis and extracellular localization of lipids, carbohydrates, or other biological moieties.
- A method for epigenetically silencing gene expression in a mammalian subject, comprising a nucleic acid where the translatable region encodes a polypeptide or polypeptides capable of directing sequence-specific histone H3 methylation to initiate heterochromatin formation and reduce gene transcription around specific genes for the purpose of silencing the gene. For example, a gain-of-function mutation in the
Janus Kinase 2 gene is responsible for the family of Myeloproliferative Diseases. - The present disclosure provides proteins generated from modified mRNAs. Pharmaceutical compositions may optionally comprise one or more additional therapeutically active substances. In accordance with some embodiments, a method of administering pharmaceutical compositions comprising one or more proteins to be delivered to a subject in need thereof is provided. In some embodiments, compositions are administered to humans. For the purposes of the present disclosure, the phrase “active ingredient” generally refers to a protein or protein-containing complex as described herein.
- Although the descriptions of pharmaceutical compositions provided herein are principally directed to pharmaceutical compositions which are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to animals of all sorts. Modification of pharmaceutical compositions suitable for administration to humans in order to render the compositions suitable for administration to various animals is well understood, and the ordinarily skilled veterinary pharmacologist can design and/or perform such modification with merely ordinary, if any, experimentation. Subjects to which administration of the pharmaceutical compositions is contemplated include, but are not limited to, humans and/or other primates; mammals, including commercially relevant mammals such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats; and/or birds, including commercially relevant birds such as chickens, ducks, geese, and/or turkeys.
- Formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
- A pharmaceutical composition in accordance with the present disclosure may be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a “unit dose” is discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient which would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.
- Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure will vary, depending upon the identity, size, and/or condition of the subject treated and further depending upon the route by which the composition is to be administered. By way of example, the composition may comprise between 0.1% and 100% (w/w) active ingredient.
- Pharmaceutical formulations may additionally comprise a pharmaceutically acceptable excipient, which, as used herein, includes any and all solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired. Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference) discloses various excipients used in formulating pharmaceutical compositions and known techniques for the preparation thereof. Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this present disclosure.
- In some embodiments, a pharmaceutically acceptable excipient is at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% pure. In some embodiments, an excipient is approved for use in humans and for veterinary use. In some embodiments, an excipient is approved by United States Food and Drug Administration. In some embodiments, an excipient is pharmaceutical grade. In some embodiments, an excipient meets the standards of the United States Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British Pharmacopoeia, and/or the International Pharmacopoeia.
- Pharmaceutically acceptable excipients used in the manufacture of pharmaceutical compositions include, but are not limited to, inert diluents, dispersing and/or granulating agents, surface active agents and/or emulsifiers, disintegrating agents, binding agents, preservatives, buffering agents, lubricating agents, and/or oils. Such excipients may optionally be included in pharmaceutical formulations. Excipients such as cocoa butter and suppository waxes, coloring agents, coating agents, sweetening, flavoring, and/or perfuming agents can be present in the composition, according to the judgment of the formulator.
- Exemplary diluents include, but are not limited to, calcium carbonate, sodium carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate, calcium hydrogen phosphate, sodium phosphate lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch, cornstarch, powdered sugar, etc., and/or combinations thereof.
- Exemplary granulating and/or dispersing agents include, but are not limited to, potato starch, corn starch, tapioca starch, sodium starch glycolate, clays, alginic acid, guar gum, citrus pulp, agar, bentonite, cellulose and wood products, natural sponge, cation-exchange resins, calcium carbonate, silicates, sodium carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone), sodium carboxymethyl starch (sodium starch glycolate), carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), methylcellulose, pregelatinized starch (starch 1500), microcrystalline starch, water insoluble starch, calcium carboxymethyl cellulose, magnesium aluminum silicate (Veegum), sodium lauryl sulfate, quaternary ammonium compounds, etc., and/or combinations thereof.
- Exemplary surface active agents and/or emulsifiers include, but are not limited to, natural emulsifiers (e.g. acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), colloidal clays (e.g. bentonite [aluminum silicate] and Veegum® [magnesium aluminum silicate]), long chain amino acid derivatives, high molecular weight alcohols (e.g. stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene glycol distearate, glyceryl monostearate, and propylene glycol monostearate, polyvinyl alcohol), carbomers (e.g. carboxy polymethylene, polyacrylic acid, acrylic acid polymer, and carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g. carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty acid esters (e.g. polyoxyethylene sorbitan monolaurate [Tween®20], polyoxyethylene sorbitan [Tween®60], polyoxyethylene sorbitan monooleate [Tween®80], sorbitan monopalmitate [Span®40], sorbitan monostearate [Span®60], sorbitan tristearate [Span®65], glyceryl monooleate, sorbitan monooleate [Span®80]), polyoxyethylene esters (e.g. polyoxyethylene monostearate [Myrj®45], polyoxyethylene hydrogenated castor oil, polyethoxylated castor oil, polyoxymethylene stearate, and Solutol®), sucrose fatty acid esters, polyethylene glycol fatty acid esters (e.g. Cremophor®), polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij®30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate, triethanolamine oleate, sodium oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic®F 68, Poloxamer®188, cetrimonium bromide, cetylpyridinium chloride, benzalkonium chloride, docusate sodium, etc. and/or combinations thereof.
- Exemplary binding agents include, but are not limited to, starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g. sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol,); natural and synthetic gums (e.g. acacia, sodium alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks, carboxymethylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose, microcrystalline cellulose, cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum®), and larch arabogalactan); alginates; polyethylene oxide; polyethylene glycol; inorganic calcium salts; silicic acid; polymethacrylates; waxes; water; alcohol; etc.; and combinations thereof.
- Exemplary preservatives may include, but are not limited to, antioxidants, chelating agents, antimicrobial preservatives, antifungal preservatives, alcohol preservatives, acidic preservatives, and/or other preservatives. Exemplary antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated hydroxyanisole, butylated hydroxytoluene, monothioglycerol, potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite, sodium metabisulfite, and/or sodium sulfite. Exemplary chelating agents include ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate, disodium edetate, dipotassium edetate, edetic acid, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, and/or trisodium edetate. Exemplary antimicrobial preservatives include, but are not limited to, benzalkonium chloride, benzethonium chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol, chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol, phenylmercuric nitrate, propylene glycol, and/or thimerosal. Exemplary antifungal preservatives include, but are not limited to, butyl paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium benzoate, sodium propionate, and/or sorbic acid. Exemplary alcohol preservatives include, but are not limited to, ethanol, polyethylene glycol, phenol, phenolic compounds, bisphenol, chlorobutanol, hydroxybenzoate, and/or phenylethyl alcohol. Exemplary acidic preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid, and/or phytic acid. Other preservatives include, but are not limited to, tocopherol, tocopherol acetate, deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium sulfite, potassium metabisulfite, Glydant Plus®, Phenonip®, methylparaben, Germall®115, Germaben®II, Neolone™, Kathon™, and/or Euxyl®.
- Exemplary buffering agents include, but are not limited to, citrate buffer solutions, acetate buffer solutions, phosphate buffer solutions, ammonium chloride, calcium carbonate, calcium chloride, calcium citrate, calcium glubionate, calcium gluceptate, calcium gluconate, d-gluconic acid, calcium glycerophosphate, calcium lactate, propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium phosphate, calcium hydroxide phosphate, potassium acetate, potassium chloride, potassium gluconate, potassium mixtures, dibasic potassium phosphate, monobasic potassium phosphate, potassium phosphate mixtures, sodium acetate, sodium bicarbonate, sodium chloride, sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic sodium phosphate, sodium phosphate mixtures, tromethamine, magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl alcohol, etc., and/or combinations thereof.
- Exemplary lubricating agents include, but are not limited to, magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, glyceryl behanate, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium acetate, sodium chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate, etc., and combinations thereof.
- Exemplary oils include, but are not limited to, almond, apricot kernel, avocado, babassu, bergamot, black current seed, borage, cade, camomile, canola, caraway, carnauba, castor, cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut, mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange, orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed, pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood, sasquana, savoury, sea buckthorn, sesame, shea butter, silicone, soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut, and wheat germ oils. Exemplary oils include, but are not limited to, butyl stearate, caprylic triglyceride, capric triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone oil, and/or combinations thereof.
- Liquid dosage forms for oral and parenteral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and/or elixirs. In addition to active ingredients, liquid dosage forms may comprise inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof. Besides inert diluents, oral compositions can include adjuvants such as wetting agents, emulsifying and suspending agents, sweetening, flavoring, and/or perfuming agents. In certain embodiments for parenteral administration, compositions are mixed with solubilizing agents such as Cremophor®, alcohols, oils, modified oils, glycols, polysorbates, cyclodextrins, polymers, and/or combinations thereof.
- Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents. Sterile injectable preparations may be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables.
- Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
- In order to prolong the effect of an active ingredient, it is often desirable to slow the absorption of the active ingredient from subcutaneous or intramuscular injection. This may be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, may depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
- Compositions for rectal or vaginal administration are typically suppositories which can be prepared by mixing compositions with suitable non-irritating excipients such as cocoa butter, polyethylene glycol or a suppository wax which are solid at ambient temperature but liquid at body temperature and therefore melt in the rectum or vaginal cavity and release the active ingredient.
- Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules. In such solid dosage forms, an active ingredient is mixed with at least one inert, pharmaceutically acceptable excipient such as sodium citrate or dicalcium phosphate and/or fillers or extenders (e.g. starches, lactose, sucrose, glucose, mannitol, and silicic acid), binders (e.g. carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia), humectants (e.g. glycerol), disintegrating agents (e.g. agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate), solution retarding agents (e.g. paraffin), absorption accelerators (e.g. quaternary ammonium compounds), wetting agents (e.g. cetyl alcohol and glycerol monostearate), absorbents (e.g. kaolin and bentonite clay), and lubricants (e.g. talc, calcium stearate, magnesium stearate, solid polyethylene glycols, sodium lauryl sulfate), and mixtures thereof. In the case of capsules, tablets and pills, the dosage form may comprise buffering agents.
- Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like. Solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally comprise opacifying agents and can be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner. Examples of embedding compositions which can be used include polymeric substances and waxes. Solid compositions of a similar type may be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
- Dosage forms for topical and/or transdermal administration of a composition may include ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants and/or patches. Generally, an active ingredient is admixed under sterile conditions with a pharmaceutically acceptable excipient and/or any needed preservatives and/or buffers as may be required. Additionally, the present disclosure contemplates the use of transdermal patches, which often have the added advantage of providing controlled delivery of a compound to the body. Such dosage forms may be prepared, for example, by dissolving and/or dispensing the compound in the proper medium. Alternatively or additionally, rate may be controlled by either providing a rate controlling membrane and/or by dispersing the compound in a polymer matrix and/or gel.
- Suitable devices for use in delivering intradermal pharmaceutical compositions described herein include short needle devices such as those described in U.S. Pat. Nos. 4,886,499; 5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235; 5,141,496; and 5,417,662. Intradermal compositions may be administered by devices which limit the effective penetration length of a needle into the skin, such as those described in PCT publication WO 99/34850 and functional equivalents thereof. Jet injection devices which deliver liquid compositions to the dermis via a liquid jet injector and/or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis are suitable. Jet injection devices are described, for example, in U.S. Pat. Nos. 5,480,381; 5,599,302; 5,334,144; 5,993,412; 5,649,912; 5,569,189; 5,704,911; 5,383,851; 5,893,397; 5,466,220; 5,339,163; 5,312,335; 5,503,627; 5,064,413; 5,520,639; 4,596,556; 4,790,824; 4,941,880; 4,940,460; and PCT publications WO 97/37705 and WO 97/13537. Ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis are suitable. Alternatively or additionally, conventional syringes may be used in the classical mantoux method of intradermal administration.
- Formulations suitable for topical administration include, but are not limited to, liquid and/or semi liquid preparations such as liniments, lotions, oil in water and/or water in oil emulsions such as creams, ointments and/or pastes, and/or solutions and/or suspensions. Topically-administrable formulations may, for example, comprise from about 1% to about 10% (w/w) active ingredient, although the concentration of active ingredient may be as high as the solubility limit of the active ingredient in the solvent. Formulations for topical administration may further comprise one or more of the additional ingredients described herein.
- A pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for pulmonary administration via the buccal cavity. Such a formulation may comprise dry particles which comprise the active ingredient and which have a diameter in the range from about 0.5 nm to about 7 nm or from about 1 nm to about 6 nm. Such compositions are conveniently in the form of dry powders for administration using a device comprising a dry powder reservoir to which a stream of propellant may be directed to disperse the powder and/or using a self propelling solvent/powder dispensing container such as a device comprising the active ingredient dissolved and/or suspended in a low-boiling propellant in a sealed container. Such powders comprise particles wherein at least 98% of the particles by weight have a diameter greater than 0.5 nm and at least 95% of the particles by number have a diameter less than 7 nm. Alternatively, at least 95% of the particles by weight have a diameter greater than 1 nm and at least 90% of the particles by number have a diameter less than 6 nm. Dry powder compositions may include a solid fine powder diluent such as sugar and are conveniently provided in a unit dose form.
- Low boiling propellants generally include liquid propellants having a boiling point of below 65° F. at atmospheric pressure. Generally the propellant may constitute 50% to 99.9% (w/w) of the composition, and active ingredient may constitute 0.1% to 20% (w/w) of the composition. A propellant may further comprise additional ingredients such as a liquid non-ionic and/or solid anionic surfactant and/or a solid diluent (which may have a particle size of the same order as particles comprising the active ingredient).
- Pharmaceutical compositions formulated for pulmonary delivery may provide an active ingredient in the form of droplets of a solution and/or suspension. Such formulations may be prepared, packaged, and/or sold as aqueous and/or dilute alcoholic solutions and/or suspensions, optionally sterile, comprising active ingredient, and may conveniently be administered using any nebulization and/or atomization device. Such formulations may further comprise one or more additional ingredients including, but not limited to, a flavoring agent such as saccharin sodium, a volatile oil, a buffering agent, a surface active agent, and/or a preservative such as methylhydroxybenzoate. Droplets provided by this route of administration may have an average diameter in the range from about 0.1 nm to about 200 nm.
- Formulations described herein as being useful for pulmonary delivery are useful for intranasal delivery of a pharmaceutical composition. Another formulation suitable for intranasal administration is a coarse powder comprising the active ingredient and having an average particle from about 0.2 μm to 500 μm. Such a formulation is administered in the manner in which snuff is taken, i.e. by rapid inhalation through the nasal passage from a container of the powder held close to the nose.
- Formulations suitable for nasal administration may, for example, comprise from about as little as 0.1% (w/w) and as much as 100% (w/w) of active ingredient, and may comprise one or more of the additional ingredients described herein. A pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for buccal administration. Such formulations may, for example, be in the form of tablets and/or lozenges made using conventional methods, and may, for example, 0.1% to 20% (w/w) active ingredient, the balance comprising an orally dissolvable and/or degradable composition and, optionally, one or more of the additional ingredients described herein. Alternately, formulations suitable for buccal administration may comprise a powder and/or an aerosolized and/or atomized solution and/or suspension comprising active ingredient. Such powdered, aerosolized, and/or aerosolized formulations, when dispersed, may have an average particle and/or droplet size in the range from about 0.1 nm to about 200 nm, and may further comprise one or more of any additional ingredients described herein.
- A pharmaceutical composition may be prepared, packaged, and/or sold in a formulation suitable for ophthalmic administration. Such formulations may, for example, be in the form of eye drops including, for example, a 0.1/1.0% (w/w) solution and/or suspension of the active ingredient in an aqueous or oily liquid excipient. Such drops may further comprise buffering agents, salts, and/or one or more other of any additional ingredients described herein. Other opthalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form and/or in a liposomal preparation. Ear drops and/or eye drops are contemplated as being within the scope of this present disclosure.
- General considerations in the formulation and/or manufacture of pharmaceutical agents may be found, for example, in Remington: The Science and Practice of
Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference). - The present disclosure provides methods comprising administering proteins or complexes in accordance with the present disclosure to a subject in need thereof. Proteins or complexes, or pharmaceutical, imaging, diagnostic, or prophylactic compositions thereof, may be administered to a subject using any amount and any route of administration effective for preventing, treating, diagnosing, or imaging a disease, disorder, and/or condition (e.g., a disease, disorder, and/or condition relating to working memory deficits). The exact amount required will vary from subject to subject, depending on the species, age, and general condition of the subject, the severity of the disease, the particular composition, its mode of administration, its mode of activity, and the like. Compositions in accordance with the present disclosure are typically formulated in dosage unit form for ease of administration and uniformity of dosage. It will be understood, however, that the total daily usage of the compositions of the present disclosure will be decided by the attending physician within the scope of sound medical judgment. The specific therapeutically effective, prophylactically effective, or appropriate imaging dose level for any particular patient will depend upon a variety of factors including the disorder being treated and the severity of the disorder; the activity of the specific compound employed; the specific composition employed; the age, body weight, general health, sex and diet of the patient; the time of administration, route of administration, and rate of excretion of the specific compound employed; the duration of the treatment; drugs used in combination or coincidental with the specific compound employed; and like factors well known in the medical arts.
- Proteins to be delivered and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof may be administered to animals, such as mammals (e.g., humans, domesticated animals, cats, dogs, mice, rats, etc.). In some embodiments, pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof are administered to humans.
- Proteins to be delivered and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof in accordance with the present disclosure may be administered by any route. In some embodiments, proteins and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof, are administered by one or more of a variety of routes, including oral, intravenous, intramuscular, intra-arterial, intramedullary, intrathecal, subcutaneous, intraventricular, transdermal, interdermal, rectal, intravaginal, intraperitoneal, topical (e.g. by powders, ointments, creams, gels, lotions, and/or drops), mucosal, nasal, buccal, enteral, vitreal, intratumoral, sublingual; by intratracheal instillation, bronchial instillation, and/or inhalation; as an oral spray, nasal spray, and/or aerosol, and/or through a portal vein catheter. In some embodiments, proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof, are administered by systemic intravenous injection. In specific embodiments, proteins or complexes and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof may be administered intravenously and/or orally. In specific embodiments, proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof, may be administered in a way which allows the protein or complex to cross the blood-brain barrier, vascular barrier, or other epithelial barrier.
- However, the present disclosure encompasses the delivery of proteins or complexes, and/or pharmaceutical, prophylactic, diagnostic, or imaging compositions thereof, by any appropriate route taking into consideration likely advances in the sciences of drug delivery.
- In general the most appropriate route of administration will depend upon a variety of factors including the nature of the protein or complex comprising proteins associated with at least one agent to be delivered (e.g., its stability in the environment of the gastrointestinal tract, bloodstream, etc.), the condition of the patient (e.g., whether the patient is able to tolerate particular routes of administration), etc. The present disclosure encompasses the delivery of the pharmaceutical, prophylactic, diagnostic, or imaging compositions by any appropriate route taking into consideration likely advances in the sciences of drug delivery.
- In certain embodiments, compositions in accordance with the present disclosure may be administered at dosage levels sufficient to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about 25 mg/kg, of subject body weight per day, one or more times a day, to obtain the desired therapeutic, diagnostic, prophylactic, or imaging effect. The desired dosage may be delivered three times a day, two times a day, once a day, every other day, every third day, every week, every two weeks, every three weeks, or every four weeks. In certain embodiments, the desired dosage may be delivered using multiple administrations (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or more administrations).
- Proteins or complexes may be used in combination with one or more other therapeutic, prophylactic, diagnostic, or imaging agents. By “in combination with,” it is not intended to imply that the agents must be administered at the same time and/or formulated for delivery together, although these methods of delivery are within the scope of the present disclosure. Compositions can be administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures. In general, each agent will be administered at a dose and/or on a time schedule determined for that agent. In some embodiments, the present disclosure encompasses the delivery of pharmaceutical, prophylactic, diagnostic, or imaging compositions in combination with agents that improve their bioavailability, reduce and/or modify their metabolism, inhibit their excretion, and/or modify their distribution within the body.
- It will further be appreciated that therapeutically, prophylactically, diagnostically, or imaging active agents utilized in combination may be administered together in a single composition or administered separately in different compositions. In general, it is expected that agents utilized in combination with be utilized at levels that do not exceed the levels at which they are utilized individually. In some embodiments, the levels utilized in combination will be lower than those utilized individually.
- The particular combination of therapies (therapeutics or procedures) to employ in a combination regimen will take into account compatibility of the desired therapeutics and/or procedures and the desired therapeutic effect to be achieved. It will also be appreciated that the therapies employed may achieve a desired effect for the same disorder (for example, a composition useful for treating cancer in accordance with the present disclosure may be administered concurrently with a chemotherapeutic agent), or they may achieve different effects (e.g., control of any adverse effects).
- The present disclosure provides a variety of kits for conveniently and/or effectively carrying out methods of the present disclosure. Typically kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments.
- In one aspect, the disclosure provides kits for protein production, comprising a first isolated nucleic acid comprising a translatable region and a nucleic acid modification, wherein the nucleic acid is capable of evading an innate immune response of a cell into which the first isolated nucleic acid is introduced, and packaging and instructions.
- In one aspect, the disclosure provides kits for protein production, comprising: a first isolated nucleic acid comprising a translatable region, provided in an amount effective to produce a desired amount of a protein encoded by the translatable region when introduced into a target cell; a second nucleic acid comprising an inhibitory nucleic acid, provided in an amount effective to substantially inhibit the innate immune response of the cell; and packaging and instructions.
- In one aspect, the disclosure provides kits for protein production, comprising a first isolated nucleic acid comprising a translatable region and a nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and packaging and instructions.
- In one aspect, the disclosure provides kits for protein production, comprising a first isolated nucleic acid comprising a translatable region and at least two different nucleoside modifications, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and packaging and instructions.
- In one aspect, the disclosure provides kits for protein production, comprising a first isolated nucleic acid comprising a translatable region and at least one nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease; a second nucleic acid comprising an inhibitory nucleic acid; and packaging and instructions.
- In some embodiments, the first isolated nucleic acid comprises messenger RNA (mRNA). In some embodiments the mRNA comprises at least one nucleoside selected from the group consisting of pyridin-4-one ribonucleoside, 5-aza-uridine, 2-thio-5-aza-uridine, 2-thiouridine, 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxyuridine, 3-methyluridine, 5-carboxymethyl-uridine, 1-carboxymethyl-pseudouridine, 5-propynyl-uridine, 1-propynyl-pseudouridine, 5-taurinomethyluridine, 1-taurinomethyl-pseudouridine, 5-taurinomethyl-2-thio-uridine, 1-taurinomethyl-4-thio-uridine, 5-methyl-uridine, 1-methyl-pseudouridine, 4-thio-1-methyl-pseudouridine, 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-1-deaza-pseudouridine, dihydrouridine, dihydropseudouridine, 2-thio-dihydrouridine, 2-thio-dihydropseudouridine, 2-methoxyuridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, and 4-methoxy-2-thio-pseudouridine.
- In some embodiments, the mRNA comprises at least one nucleoside selected from the group consisting of 5-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine, N4-acetylcytidine, 5-formylcytidine, N4-methylcytidine, 5-hydroxymethylcytidine, 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo-pseudoisocytidine, 2-thio-cytidine, 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine, 4-thio-1-methyl-pseudoisocytidine, 4-thio-1-methyl-1-deaza-pseudoisocytidine, 1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine, 5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine, 2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine, 4-methoxy-pseudoisocytidine, and 4-methoxy-1-methyl-pseudoisocytidine.
- In some embodiments, the mRNA comprises at least one nucleoside selected from the group consisting of 2-aminopurine, 2,6-diaminopurine, 7-deaza-adenine, 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine, 7-deaza-8-aza-2-aminopurine, 7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine, 1-methyladenosine, N6-methyladenosine, N6-isopentenyladenosine, N6-(cis-hydroxyisopentenyl)adenosine, 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine, N6-glycinylcarbamoyladenosine, N6-threonylcarbamoyladenosine, 2-methylthio-N6-threonyl carbamoyladenosine, N6,N6-dimethyladenosine, 7-methyladenine, 2-methylthio-adenine, and 2-methoxy-adenine.
- In some embodiments, the mRNA comprises at least one nucleoside selected from the group consisting of inosine, 1-methyl-inosine, wyosine, wybutosine, 7-deaza-guanosine, 7-deaza-8-aza-guanosine, 6-thio-guanosine, 6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine, 6-thio-7-methyl-guanosine, 7-methylinosine, 6-methoxy-guanosine, 1-methylguanosine, N2-methylguanosine, N2,N2-dimethylguanosine, 8-oxo-guanosine, 7-methyl-8-oxo-guanosine, 1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine, and N2,N2-dimethyl-6-thio-guanosine.
- In another aspect, the disclosure provides compositions for protein production, comprising a first isolated nucleic acid comprising a translatable region and a nucleoside modification, wherein the nucleic acid exhibits reduced degradation by a cellular nuclease, and a mammalian cell suitable for translation of the translatable region of the first nucleic acid.
- The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
- Modified mRNAs (modRNAs) were made using standard laboratory methods and materials for in vitro transcription with the exception that the nucleotide mix contained modified nucleotides. The open reading frame (ORF) of the gene of interest is flanked by a 5′ untranslated region (UTR) containing a strong Kozak translational initiation signal and an alpha-
globin 3′ UTR terminating with an oligo(dT) sequence for templated addition of a polyA tail for modRNAs not incorporating Adenosine analogs. Adenosine-containing modRNAs were synthesized without an oligo (dT) sequence to allow for post-transcription poly (A) polymerase poly-(A) tailing. The modRNAs were modified by incorporating chemically modified nucleotides indicated in Table 3 (below) during the in vitro transcription with 100% replacement of the corresponding natural nucleotide or partial replacement of the corresponding natural nucleotide at the indicated percentage. - Table 3 indicates the chemical identity of each chemically-distinct modified nucleotide incorporated into a modified mRNA with the given chemistry designation number.
-
TABLE 3 Modified Nucleotide Chemistry # Modified Nucleotide Combination Chemistry # 6-aza-cytidine Chem 1 α-thio-cytidine/5-iodo-uridine Chem 29 2-thio-cytidine Chem 2 α-thio-cytidine/N1-methyl-pseudo-uridine Chem 30 α-thio-cytidine Chem 3 α-thio-cytidine/α-thio-uridine Chem 31 Pseudo-iso-cytidine Chem 4 α-thio-cytidine/5-methyl-uridine Chem 32 5-aminoallyl-uridine Chem 5 α-thio-cytidine/pseudo-uridine Chem 33 5-iodo-uridine Chem 6 Pseudo-iso-cytidine/5-iodo-uridine Chem 34 N1-methyl-pseudouridine Chem 7 Pseudo-iso-cytidine/N1-methyl-pseudo-uridine Chem 35 5,6-dihydrouridine Chem 8 Pseudo-iso-cytidine/α-thio-uridine Chem 36 α-thio-uridine Chem 9 Pseudo-iso-cytidine/5-methyl-uridine Chem 37 4-thio-uridine Chem 10 Pseudo-iso-cytidine/Pseudo-uridine Chem 38 6-aza-uridine Chem 11 Pyrrolo-cytidine Chem 39 5-hydroxy-uridine Chem 12 Pyrrolo-cytidine/5-iodo-uridine Chem 40 Deoxy-thymidine Chem 13 Pyrrolo-cytidine/N1-methyl-pseudo-uridine Chem 41 Pseudo-uridine Chem 14 Pyrrolo-cytidine/α-thio-uridine Chem 42 Inosine Chem 15 Pyrrolo-cytidine/5-methyl-uridine Chem 43 α-thio-guanosine Chem 16 Pyrrolo-cytidine/Pseudo-uridine Chem 44 8-oxo-guanosine Chem 17 5-methyl-cytidine/5-iodo-uridine Chem 45 O6-methyl-guanosine Chem 18 5-methyl-cytidine/N1-methyl-pseudo-uridine Chem 46 7-deaza-guanosine Chem 19 5-methyl-cytidine/α-thio-uridine Chem 47 No modification Chem 20 5-methyl-cytidine/5-methyl-uridine Chem 48 N1-methyl-adenosine Chem 21 5-methyl-cytidine/Pseudo-uridine Chem 49 2-amino-6-Chloro-purine Chem 22 5-methyl-cytidine Chem 50 N6-methyl-2-amino- Chem 23 25% Pseudo-iso-cytidine Chem 51 purine 25% N1-methyl-pseudo-uridine Chem 52 6-Chloro-purine Chem 24 25% N1-Methyl-pseudo-uridine/75%-pseudo- Chem 53 N6-methyl-adenosine Chem 25 uridine α-thio-adenosine Chem 26 5-methyl-uridine Chem 54 8-azido-adenosine Chem 27 5-iodo-cytidine Chem 55 7-deaza-adenosine Chem 28 - Agarose Gel Electrophoresis of modRNA:
- Individual modRNAs (200-400 ng in a 20 μl volume) were loaded into a well on a non-denaturing 1.2% Agarose E-Gel (Invitrogen, Carlsbad, Calif.) and run for 12-15 minutes according to the manufacturer protocol (
FIG. 1A ). Tables 4 and 5 below indicate the modified nucleotide (Table 4) or nucleic acid (Table 5) loaded in each lane. These data indicate which chemically modified nucleotides were transcribed into chemically-modified mRNAs and the quality of each individual modRNA. These data demonstrate that nucleotides with chemical modifications on the major groove and minor groove face of the nucleotide were capable of being transcribed into a modRNA. -
TABLE 4 Lane Modified NTP 1 α-thio- cytidine 2 Pseudo-iso- cytidine 3 5-aminoallyl- uridine 4 5-iodo- uridine 5 N1-methyl- pseudo-uridine 6 α-thio- uridine 7 4-thio- uridine 8 5-hydroxy- uridine 9 Deoxy- thymidine 10 Pseudo-uridine 11 Inosine 12 α-thio- guanosine 13 8-oxo- guanosine 14 N1-methyl- guanosine 15 O6-methyl- guanosine 16 No modification 17 N1-methyl- adenosine 18 2-amino-6-Chloro- purine 19 N6-methyl-2-amino- purine 20 6-Chloro- purine 21 α-thio- adenosine 22 8-azido- adenosine 23 7-deaza- adenosine 24 6-aza- cytidine 25 2-thio- cytidine 26 5,6-dihydro- uridine 27 6-aza- uridine 28 7-deaza- guanosine 29 N6-methyl-adenosine -
TABLE 5 Lane Modified NTP combination 1 α-thio-cytidine/5-iodo-uridine 2 α-thio-cytidine/N1-methyl-pseudouridine 3 α-thio-cytidine/α-thio-uridine 4 α-thio-cytidine/5-methyl-uridine 5 α-thio-cytidine/pseudouridine 6 5-iodo-cytidine/5-iodo-uridine 7 5-iodo-cytidine/N1-methyl-pseudouridine 8 5-iodo-cytidine/α-thio-uridine 9 5-iodo-cytidine/5-methyl-uridine 10 5-iodo-cytidine/pseudouridine 11 Pseudo-iso-cytidine/5-iodo-uridine 12 Pyrrolo-cytidine 13 Pyrrolo-cytidine/5-iodo-uridine 14 Pyrrolo-cytidine/N1-methyl-pseudouridine 15 Pyrrolo-cytidine/α-thio-uridine 16 Pyrrolo-cytidine/5-methyl-uridine 17 Pyrrolo-cytidine/pseudouridine 18 5-methyl-cytidine/5-iodo-uridine 19 5-methyl-cytidine/N1-methyl-uridine 20 5-methyl-cytidine/α-thio-uridine 21 5-methyl-cytidine/5-methyl-uridine 22 5-methyl-cytidine/pseudouridine 23 Pseudo-iso-cytidine/N1-methyl-pseudouridine 24 Pseudo-iso-cytidine/α-thio-uridine 25 Pseudo-iso-cytidine/5-methyl-uridine 26 Pseudo-iso-cytidine/pseudouridine 27 5-methyl-cytidine 28 25% pseudo-iso-cytidine 29 25% N1-methyl-pseudouridine 30 25% N1-methyl-pseudouridine/75% pseudouridine - Agarose Gel Electrophoresis of RT-PCR Products:
- Individual reverse transcribed-PCR products (200-400 ng) were loaded into a well of a non-denaturing 1.2% Agarose E-Gel (Invitrogen, Carlsbad, Calif.) and run for 12-15 minutes according to the manufacturer protocol (
FIG. 1B ). Table 5 below indicates the modified nucleotide loaded in each lane. - Nanodrop modRNA Quantification and UV Spectral Data:
- modRNAs in TE buffer (1 μl) were used for Nanodrop UV absorbance readings to quantitate the yield of each modRNA from an in vitro transcription reaction (UV absorbance traces are shown in
FIGS. 6A-6L ). These data indicate which chemically modified nucleotides were transcribed into chemically-modified mRNAs. These data also demonstrate that nucleotides with chemical modifications on the major groove and minor groove face of the nucleotide were capable of being transcribed into a modRNA. These data further demonstrate that the nucleotides of the present invention are transcription-competent and compatible with incorporation into a modRNA, which may have altered UV spectra due to the presence of a given modified nucleotide. For example, Pyrrolo-C containing modRNAs have an increase in UV absorbance at a lower wavelength due to the presence of the pyrrolo ring of the modified C nucleotide. In another example, 2-amino-adenine nucleotide-containing modRNAs have an increase in UV absorbance at a higher wavelength due to the presence of an exocyclic amine off the purine ring. Nucleotides that are not transcription-competent and cannot be incorporated into a modRNA have a scrambled UV spectrum indicating no product from the transcription reaction. - Reverse Transfection:
- For experiments performed in a 24-well collagen-coated tissue culture plate, Keratinocytes were seeded at a cell density of 1×105. For experiments performed in a 96-well collagen-coated tissue culture plate, Keratinocytes were seeded at a cell density of 0.5×105. For each modRNA to be transfected, modRNA: RNAiMAX was prepared as described and mixed with the cells in the multi-well plate within a period of time, e.g., 6 hours, of cell seeding before cells had adhered to the tissue culture plate.
- Forward Transfection:
- In a 24-well collagen-coated tissue culture plate, Keratinocytes were seeded at a cell density of 0.7×105. For experiments performed in a 96-well collagen-coated tissue culture plate, Keratinocytes were seeded at a cell density of 0.3×105. Keratinocytes were then grown to a confluency of >70% for over 24 hours. For each modRNA to be transfected, modRNA: RNAiMAX was prepared as described and transfected onto the cells in the multi-well plate over 24 hours after cell seeding and adherence to the tissue culture plate.
- modRNA Translation Screen: G-CSF ELISA
-
FIGS. 2A and 2B show an Enzyme-linked immunosorbent assay (ELISA) for Human Granulocyte-Colony Stimulating Factor (hu-G-CSF) of in vitro transfected Human Keratinocyte cells. Keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70%.FIG. 2A keratinocytes were reverse transfected with 300 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen.FIG. 2B keratinocytes were forward transfected with 300 ng modRNA complexed with RNAiMAX from Invitrogen. The RNA:RNAiMAX complex was formed by first incubating the RNA with Supplement-free EpiLife media in a 5× volumetric dilution for 10 minutes at room temperature. In a second vial, RNAiMAX reagent was incubated with Supplement-free EpiLife Media in a 10× volumetric dilution for 10 minutes at room temperature. The RNA vial was then mixed with the RNAiMAX vial and incubated for 20-30 at room temperature before being added to the cells in a drop-wise fashion. Secreted huG-CSF concentration in the culture medium was measured at 18 hours post-transfection for each of the chemically modified mRNAs in triplicate. Secretion of Human Granulocyte-Colony Stimulating Factor (G-CSF) from transfected human keratinocytes was quantified using an ELISA kit from Invitrogen or R&D Systems (Minneapolis, Minn.) following the manufacturers recommended instructions. These data show that huG-CSF modRNAs comprised of chemically distinct nucleotide analogs (SEQ ID NO: 2) is capable of being translated in Human Keratinocyte cells and that huG-CSF is transported out of the cells and released into the extracellular environment. These data indicate which modified nucleotides were translated into protein when incorporated into a chemically modified mRNA. These data show that modified RNA containing nucleotides with chemical modifications on the major groove face of pyrimidine analogs have the highest levels of secreted hu-G-CSF into the cell culture medium. - modRNA Dose and Duration: G-CSF ELISA
-
FIGS. 3A-N show Enzyme-linked immunosorbent assays (ELISA) for Human Granulocyte-Colony Stimulating Factor (G-CSF) of in vitro transfected Human Keratinocyte cells. Keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70%. Keratinocytes were reverse transfected with 0 ng, 46.875 ng, 93.75 ng, 187.5 ng, 375 ng, 750 ng, or 1500 ng modRNA complexed with RNAiMAX from Invitrogen. The modRNA:RNAiMAX complex was formed as described. Secreted huG-CSF concentration in the culture medium was measured at 0, 6, 12, 24, and 48 hours post-transfection for each concentration of each modRNA in triplicate. Secretion of Human Granulocyte-Colony Stimulating Factor (G-CSF) from transfected human keratinocytes was quantified using an ELISA kit from Invitrogen or R&D Systems following the manufacturers recommended instructions. These data show that huG-CSF modRNAs comprised of chemically distinct nucleotide analogs (SEQ ID NO: X and Table 6) secreted hu-G-CSF protein in a modRNA dose-dependent manner from Human Keratinocyte cells and that huG-CSF is transported out of the cells and released into the extracellular environment. These data indicate which modified RNAs containing modified nucleotide analogs sustain hu-G-CSF expression for the longest and at the highest levels. These data show that modified RNA containing modified nucleotides with chemical modifications on the major groove face of pyrimidine analogs have the highest levels of secreted hu-G-CSF into the cell culture medium and that 750 ng of modRNA elicits the highest level of secreted hu-G-CSF. - IFN-β ELISA and TNF-α ELISA:
-
FIGS. 4A-F show an Enzyme-linked immunosorbent assay (ELISA) for Human Tumor Necrosis Factor-α (TNF-α) (FIGS. 4A and 4B ); Human Interferon-β (IFN-β) (FIGS. 4C and 4D ); and Human Granulocyte-Colony Stimulating Factor (G-CSF) (FIGS. 4E and 4F ) secreted from in vitro-transfected Human Keratinocyte cells. Keratinocytes were grown in EpiLife medium with Human Keratinocyte Growth Supplement in the absence of hydrocortisone from Invitrogen at a confluence of >70%. InFIGS. 4A and 4B , keratinocytes were reverse transfected with Ong, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng or 3000 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen as described in triplicate. Secreted TNF-α in the culture medium was measured 24 hours post-transfection for each of the chemically modified mRNAs using an ELISA kit from Invitrogen according to the manufacturer protocols. - In
FIGS. 4C and 4D , secreted IFN-β in the same culture medium was measured 24 hours post-transfection for each of the chemically modified mRNAs using an ELISA kit from Invitrogen according to the manufacturer protocols. InFIGS. 4E and 4F , secreted hu-G-CSF concentration in the same culture medium was measured at 24 hours post-transfection for each of the chemically modified mRNAs. Secretion of Human Granulocyte-Colony Stimulating Factor (G-CSF) from transfected human keratinocytes was quantified using an ELISA kit from Invitrogen or R&D Systems (Minneapolis, Minn.) following the manufacturers recommended instructions. These data indicate which modified RNAs containing modified nucleotides were capable of eliciting a reduced cellular innate immune response in comparison to natural and other chemically modified nucleotides by measuring exemplary type I cytokines TNF-α and IFN-β. These data show that modified RNAs containing modified nucleotides with chemical modifications on the major groove face of pyrimidine analogs have the lowest levels of secreted TNF-α and IFN-β into the cell culture medium while maintaining high levels of modRNA-encoding hu-G-CSF secretion into the cell culture medium. -
FIGS. 5A-D show modRNA-encoding hu-G-CSF produced by a human keratinocyte feeder cell layer induced the proliferation of both human myeloblast cells KG-1 and Kasumi-1 that express the G-CSF-receptor where the cell populations are separated by a semi-permeable membrane. - Human keratinocytes were grown in EpiLife medium with Supplement S7 from Invitrogen at a confluence of >70% in a 24-well collagen-coated Transwell® (Corning, Lowell, Mass.) co-culture tissue culture plate. Keratinocytes were reverse transfected with 750 ng of the indicated chemically modified mRNA complexed with RNAiMAX from Invitrogen as described in triplicate. The modRNA:RNAiMAX complex was formed as described. Keratinocyte media was exchanged 6-8 hours post-transfection. 42-hours post-transfection, the 24-well Transwell® plate insert with a 0.4 μm-pore semi-permeable polyester membrane was placed into the hu-G-CSF modRNA-transfected keratinocyte containing culture plate.
FIG. 5A is a table showing the results from an Enzyme-linked immunosorbent assay (ELISA) for human-G-CSF secreted from in vitro-transfected Human Keratinocyte cells sampled from individual wells in a co-culture 24-welltissue culture plate 42 hours post-transfection with 750 ng of each indicated hu-G-CSF-encoding modRNA. - Human myeloblast cells, Kasumi-1 cells (
FIG. 5C ) or KG-1 (FIG. 5D ) (0.2×105 cells), were seeded into the insert well and cell proliferation was quantified 42 hours post-co-culture initiation using the CyQuant Direct Cell Proliferation Assay (Invitrogen) in a 100-120 μl volume in a 96-well plate. modRNA-encoding hu-G-CSF-induced myeloblast cell proliferation was expressed as a percent cell proliferation normalized to untransfected keratinocyte/myeloblast co-culture control wells. Secreted hu-G-CSF concentration in both the keratinocyte and myeloblast insert co-culture wells was measured at 42 hours post-co-culture initiation for each modRNA in duplicate. Secretion of Human Granulocyte-Colony Stimulating Factor (G-CSF) was quantified using an ELISA kit from Invitrogen following the manufacturers recommended instructions. - Transfected hu-G-CSF modRNA in human keratinocyte feeder cells and untransfected human myeloblast cells were detected by RT-PCR. Total RNA from sample cells was extracted and lysed using RNeasy kit (Qiagen, Valencia, Calif.) according to the manufacturer instructions. Extracted total RNA was submitted to RT-PCR for specific amplification of modRNA-G-CSF using ProtoScript® M-MuLV Taq RT-PCR kit (New England BioLabs, Ipswich, Mass.) according to the manufacturer instructions with hu-G-CSF-specific primers (see below). RT-PCR products were visualized by 1.2% agarose gel electrophoresis (
FIG. 5B ). Table 6 below shows which modRNAs were run on the agarose gel. -
TABLE 6 RT-PCR hu-G-CSF Lane Cell type modRNA Target 1 Keratinocyte KG-1 Feeder Vehicle 2 Keratinocyte KG-1 Feeder Scramble RNA 3 Keratinocyte KG-1 Feeder No Modification 4 Keratinocyte KG-1 Feeder Chem 7 5 Keratinocyte KG-1 Feeder Chem 6 6 Keratinocyte KG-1 Feeder Chem 37 7 Keratinocyte Kasumi-1 Feeder Vehicle 8 Keratinocyte Kasumi-1 Feeder Scramble RNA 9 Keratinocyte Kasumi-1 Feeder No Modification 10 Keratinocyte Kasumi-1 Feeder Chem 7 11 Keratinocyte Kasumi-1 Feeder Chem 6 12 Keratinocyte Kasumi-1 Feeder Chem 37 13 Keratinocyte KG-1 Feeder Chem 46 14 Keratinocyte KG-1 Feeder Chem 48 15 Keratinocyte KG-1 Feeder Chem 49 16 Keratinocyte KG-1 Feeder Chem 53 17 Keratinocyte Kasumi-1 Feeder Chem 46 18 Keratinocyte Kasumi-1 Feeder Chem 48 19 Keratinocyte Kasumi-1 Feeder Chem 49 20 Keratinocyte Kasumi-1 Feeder Chem 53 21 Kasumi-1 Vehicle 22 KG-1 Vehicle 23 Kasumi-1 Vehicle 24 Kasumi-1 Scramble RNA 25 Kasumi-1 No Modification 26 Kasumi-1 Chem 7 27 Kasumi-1 Chem 6 28 Kasumi-1 Chem 37 29 Kasumi-1 Chem 46 30 Kasumi-1 Chem 48 31 Kasumi-1 Chem 49 32 Kasumi-1 Chem 53 33 KG-1 Vehicle 34 KG-1 Scramble RNA 35 KG-1 No Modification 36 KG-1 Chem 7 37 Empty Empty 38 Empty Empty 39 Empty Empty 40 Empty Empty 41 Empty Empty 42 Empty Empty 43 Empty Empty 44 Empty Empty - These data show that human keratinocyte cells containing hu-G-CSF modRNAs comprised of chemically distinct nucleotide analogs secreted hu-G-CSF protein and that the secreted hu-G-CSF was physiologically-active in inducing the proliferation of human myeloblast cells expressing the G-CSF receptor. These data also show the secreted hu-G-CSF protein was permeable across a semi-permeable membrane and acted on a different non-G-CSF-producing cell population. Additionally, these data show that hu-G-CSF modRNA-transfected into human keratinocyte cells in a co-culture environment was present in only the transfected keratinocyte cells and not the un-transfected myeloblast cells. Further, these data show that the modified nucleotide chemical composition of hu-G-CSF modRNA did not affect resultant protein activity.
- Cytotoxicity and Apoptosis:
- This experiment demonstrates cellular viability, cytotoxity and apoptosis for distinct modRNA-in vitro transfected Human Keratinocyte cells. Keratinocytes are grown in EpiLife medium with Human Keratinocyte Growth Supplement in the absence of hydrocortisone from Invitrogen at a confluence of >70%. Keratinocytes are reverse transfected with Ong, 46.875 ng, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng, 3000 ng, or 6000 ng of modRNA complexed with RNAiMAX from Invitrogen. The modRNA:RNAiMAX complex is formed. Secreted huG-CSF concentration in the culture medium is measured at 0, 6, 12, 24, and 48 hours post-transfection for each concentration of each modRNA in triplicate. Secretion of Human Granulocyte-Colony Stimulating Factor (G-CSF) from transfected human keratinocytes is quantified using an ELISA kit from Invitrogen or R&D Systems following the manufacturers recommended instructions. Cellular viability, cytotoxicity and apoptosis is measured at 0, 12, 48, 96, and 192 hours post-transfection using the ApoToxGlo kit from Promega (Madison, Wis.) according to manufacturer instructions.
- The modified mRNA comprised of chemically-distinct modified nucleotides encoding human Granulocyte-Colony Stimulating Factor (G-CSF) may stimulate the cellular proliferation of a transfection incompetent cell in co-culture environment. The co-culture includes a highly transfectable cell type such as a human keratinocyte and a transfection incompetent cell type such as a white blood cell (WBC). The modified mRNA encoding G-CSF may be transfected into the highly transfectable cell allowing for the production and secretion of G-CSF protein into the extracellular environment where G-CSF acts in a paracrine-like manner to stimulate the white blood cell expressing the G-CSF receptor to proliferate. The expanded WBC population may be used to treat immune-compromised patients or partially reconstitute the WBC population of an immunosuppressed patient and thus reduce the risk of opportunistic infections.
- Another example, a highly transfectable cell such as a fibroblast may be transfected with certain growth factors to support and simulate the growth, maintenance, or differentiation of poorly transfectable embryonic stem cells or induced pluripotent stem cells.
- The cloning, gene synthesis and vector sequencing was performed by DNA2.0 Inc. (Menlo Park, Calif.). Sequence and insert sequence are set forth herein. The ORF was restriction digested using XbaI and used for cDNA synthesis using tailed- or tail-less-PCR. The tailed-PCR cDNA product was used as the template for the modified mRNA synthesis reaction using 25 mM mixture each modified nucleotide (all modified nucleotides were custom synthesized or purchased from TriLink Biotech, San Diego, Calif. except pyrrolo-C triphosphate purchased from Glen Research, Sterling Va.; unmodified nucleotides were purchased from Epicenter Biotechnologies, Madison, Wis.) and CellScript MegaScript™ (Epicenter Biotechnologies, Madison, Wis.) complete mRNA synthesis kit. The in vitro transcription reaction was run for 4 hours at 37° C. modRNAs incorporating adenosine analogs were poly (A) tailed using yeast Poly (A) Polymerase (Affymetrix, Santa Clara, Calif.). PCR reaction used
HiFi PCR 2× Master Mix™ (Kapa Biosystems, Woburn, Mass.). modRNAs were post-transcriptionally capped using recombinant Vaccinia Virus Capping Enzyme (New England BioLabs, Ipswich, Mass.) and a recombinant 2′-O-methyltransferase (Epicenter Biotechnologies, Madison, Wis.) to generate the 5′-guanosine Cap 1 structure.Cap 2 structure andCap 3 structures may be generated using additional 2′-O-methyltransferases. The in vitro transcribed mRNA product was run on an agarose gel and visualized. modRNA was purified with Ambion/Applied Biosystems (Austin, Tex.) MEGAClear RNA™ purification kit. PCR used PureLink™ PCR purification kit (Invitrogen, Carlsbad, Calif.). The product was quantified on Nanodrop™ UV Absorbance (ThermoFisher, Waltham, Mass.). Quality, UV absorbance quality and visualization of the product was performed on an 1.2% agarose gel. The product was resuspended in TE buffer. - 5′ Capping Modified Nucleic Acid (mRNA) Structure:
- 5′-modRNA capping may be completed concomitantly during the in vitro-transcription reaction using the following chemical RNA cap analogs to generate the 5′-guanosine cap structure according to manufacturer protocols: 3′-O-Me-m7G(5′)ppp(5′)G; G(5′)ppp(5′)A; G(5′)ppp(5′)G; m7G(5′)ppp(5′)A; m7G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.). 5′-modRNA capping may be completed post-transcriptionally using a Vaccinia Virus Capping Enzyme to generate the “
Cap 0” structure: m7G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.).Cap 1 structure may be generated using both Vaccinia Virus Capping Enzyme and a 2′-O methyl-transferase to generate: m7G(5′)ppp(5′)G-2′-O-methyl.Cap 2 structure may be generated from theCap 1 structure followed by the 2′-O-methylation of the 5′-antepenultimate nucleotide using a 2′-O methyl-transferase.Cap 3 structure may be generated from theCap 2 structure followed by the 2′-O-methylation of the 5′-preantepenultimate nucleotide using a 2′-O methyl-transferase. Enzymes are preferably derived from a recombinant source. -
Sequences: G-CSF cDNA: (SEQ ID NO: 1) agcttttggaccctcgtacagaagctaatacgactcactatagggaaata agagagaaaagaagagtaagaagaaatataagagccaccatggccggtcc cgcgacccaaagccccatgaaacttatggccctgcagttgctgctttggc actcggccctctggacagtccaagaagcgactcctcteggacctgcctca tcgttgccgcagtcattccttttgaagtgtctggagcaggtgcgaaagat tcagggcgatggagccgcactccaagagaagctctgcgcgacatacaaac tttgccatcccgaggagctcgtactgctcgggcacagcttggggattccc tgggctcctctctcgtcctgtccgtcgcaggctttgcagttggcagggtg cctttcccagctccactccggtttgttcttgtatcagggactgctgcaag cccttgagggaatctcgccagaattgggcccgacgctggacacgttgcag ctcgacgtggcggatttcgcaacaaccatctggcagcagatggaggaact ggggatggcacccgcgctgcagcccacgcagggggcaatgccggcctttg cgtccgcgatcagcgcagggegggtggagtcctcgtagcgagccaccttc aatcatttttggaagtctcgtaccgggtgctgagacatcttgcgcagccg tgaagcgctgccttctgcggggcttgccttctggccatgcccttcttctc tcccttgcacctgtacctcttggtctttgaataaagcctgagtaggaagg cggccgctcgagcatgcatctagagggcccaattcgccctattcgaagtc g G-CSF mRNA: (SEQ ID NO: 2) agcuuuuggacccucguacagaagcuaauacgacucacuauagggaaaua agagagaaaagaagaguaagaagaaauauaagagccaccauggccggucc cgcgacccaaagccccaugaaacuuauggcccugcaguugcugcuuuggc acucggcccucuggacaguccaagaagcgacuccucucggaccugccuca ucguugccgcagucauuccuuuugaagugucuggagcaggugcgaaagau ucagggcgauggagccgcacuccaagagaagcucugcgcgacauacaaac uuugccaucccgaggagcucguacugcucgggcacagcuuggggauuccc ugggcuccucucucguccuguccgucgcaggcuuugcaguuggcagggug ccuuucccagcuccacuccgguuuguucuuguaucagggacugcugcaag cccuugagggaaucucgccagaauugggcccgacgcuggacacguugcag cucgacguggcggauuucgcaacaaccaucuggcagcagauggaggaacu ggggauggcacccgcgcugcagcccacgcagggggcaaugccggccuuug cguccgcguuucagcgcagggcggguggaguccucguagcgagccaccuu caaucauuuuuggaagucucguaccgggugcugagacaucuugcgcagcc gugaagcgcugccuucugcggggcuugccuucuggccaugcccuucuucu cucccuugcaccuguaccucuuggucuuugaauaaagccugaguaggaag gcggccgcucgagcaugcaucuagagggcccaauucgcccuauucgaagu cg G-CSF protein: (SEQ ID NO: 3) MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQ VRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQ ALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTI WQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV LRHLAQP cDNA synthesis primers: Forward Primer: (SEQ ID NO: 4) 5′-TTG GAC CCT CGT ACA GAA GCT AAT ACG Reverse Primer for template Poly (A) tailing: (SEQ ID NO: 5) 5′-T(120)CT TCC TAC TCA GGC TTT ATT CAA AGA CCA Reverse Primer for post-transcriptional Poly (A) Polymerase tailing: (SEQ ID NO: 6) 5′-CTT CCT ACT CAG GCT TTA TTC AAA GAC CA G-CSF modRNA RT-PCR primers: Forward Primer: (SEQ ID NO: 7) 5′-TGG CCG GTC CCG CGA CCC AA Reverse Primer: (SEQ ID NO: 8) 5′-GCT TCA CGG CTG CGC AAG AT - It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.
Claims (56)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/481,127 US20130102034A1 (en) | 2010-10-01 | 2012-05-25 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US13/739,212 US9334328B2 (en) | 2010-10-01 | 2013-01-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/143,364 US9657295B2 (en) | 2010-10-01 | 2016-04-29 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/493,829 US10064959B2 (en) | 2010-10-01 | 2017-04-21 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US16/047,574 US20190160185A1 (en) | 2010-10-01 | 2018-07-27 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US18/045,805 US20240033379A1 (en) | 2010-10-01 | 2022-10-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US18/820,804 US12357708B2 (en) | 2010-10-01 | 2024-08-30 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US40441310P | 2010-10-01 | 2010-10-01 | |
| US201113251840A | 2011-10-03 | 2011-10-03 | |
| US13/481,127 US20130102034A1 (en) | 2010-10-01 | 2012-05-25 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US201113251840A Continuation | 2010-10-01 | 2011-10-03 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/739,212 Continuation US9334328B2 (en) | 2010-10-01 | 2013-01-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20130102034A1 true US20130102034A1 (en) | 2013-04-25 |
Family
ID=45893552
Family Applications (12)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/252,049 Abandoned US20120237975A1 (en) | 2010-10-01 | 2011-10-03 | Engineered nucleic acids and methods of use thereof |
| US13/481,127 Abandoned US20130102034A1 (en) | 2010-10-01 | 2012-05-25 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US13/739,212 Active 2031-12-18 US9334328B2 (en) | 2010-10-01 | 2013-01-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US13/897,363 Abandoned US20130244282A1 (en) | 2010-10-01 | 2013-05-18 | Method of producing antibodies |
| US14/535,484 Active US9701965B2 (en) | 2010-10-01 | 2014-11-07 | Engineered nucleic acids and methods of use thereof |
| US15/143,364 Active US9657295B2 (en) | 2010-10-01 | 2016-04-29 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/493,829 Active US10064959B2 (en) | 2010-10-01 | 2017-04-21 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/611,490 Abandoned US20180112221A1 (en) | 2010-10-01 | 2017-06-01 | Engineered Nucleic Acids and Methods of Use Thereof |
| US16/047,574 Abandoned US20190160185A1 (en) | 2010-10-01 | 2018-07-27 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US16/930,720 Abandoned US20210236655A1 (en) | 2010-10-01 | 2020-07-16 | Engineered Nucleic Acids and Methods of Use Thereof |
| US18/045,805 Pending US20240033379A1 (en) | 2010-10-01 | 2022-10-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US18/820,804 Active US12357708B2 (en) | 2010-10-01 | 2024-08-30 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/252,049 Abandoned US20120237975A1 (en) | 2010-10-01 | 2011-10-03 | Engineered nucleic acids and methods of use thereof |
Family Applications After (10)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/739,212 Active 2031-12-18 US9334328B2 (en) | 2010-10-01 | 2013-01-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US13/897,363 Abandoned US20130244282A1 (en) | 2010-10-01 | 2013-05-18 | Method of producing antibodies |
| US14/535,484 Active US9701965B2 (en) | 2010-10-01 | 2014-11-07 | Engineered nucleic acids and methods of use thereof |
| US15/143,364 Active US9657295B2 (en) | 2010-10-01 | 2016-04-29 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/493,829 Active US10064959B2 (en) | 2010-10-01 | 2017-04-21 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US15/611,490 Abandoned US20180112221A1 (en) | 2010-10-01 | 2017-06-01 | Engineered Nucleic Acids and Methods of Use Thereof |
| US16/047,574 Abandoned US20190160185A1 (en) | 2010-10-01 | 2018-07-27 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US16/930,720 Abandoned US20210236655A1 (en) | 2010-10-01 | 2020-07-16 | Engineered Nucleic Acids and Methods of Use Thereof |
| US18/045,805 Pending US20240033379A1 (en) | 2010-10-01 | 2022-10-11 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US18/820,804 Active US12357708B2 (en) | 2010-10-01 | 2024-08-30 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Country Status (27)
| Country | Link |
|---|---|
| US (12) | US20120237975A1 (en) |
| EP (8) | EP2857499A1 (en) |
| JP (1) | JP2013543381A (en) |
| CN (3) | CN104531812A (en) |
| AU (2) | AU2011308496A1 (en) |
| BR (1) | BR112013007862A2 (en) |
| CA (3) | CA2821992A1 (en) |
| CY (1) | CY1125421T1 (en) |
| DE (1) | DE19177059T1 (en) |
| DK (2) | DK3590949T3 (en) |
| ES (4) | ES2925251T3 (en) |
| FI (1) | FI4108671T3 (en) |
| HR (2) | HRP20220796T1 (en) |
| HU (2) | HUE069586T2 (en) |
| IL (1) | IL225493A0 (en) |
| LT (2) | LT4108671T (en) |
| MX (1) | MX2013003681A (en) |
| NZ (1) | NZ608972A (en) |
| PL (2) | PL4108671T3 (en) |
| PT (2) | PT4108671T (en) |
| RS (2) | RS63430B1 (en) |
| RU (1) | RU2013120302A (en) |
| SG (2) | SG10201508149TA (en) |
| SI (2) | SI4108671T1 (en) |
| SM (2) | SMT202400513T1 (en) |
| WO (2) | WO2012045082A2 (en) |
| ZA (2) | ZA201303161B (en) |
Cited By (76)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8664194B2 (en) | 2011-12-16 | 2014-03-04 | Moderna Therapeutics, Inc. | Method for producing a protein of interest in a primate |
| US8710200B2 (en) | 2011-03-31 | 2014-04-29 | Moderna Therapeutics, Inc. | Engineered nucleic acids encoding a modified erythropoietin and their expression |
| US8822663B2 (en) | 2010-08-06 | 2014-09-02 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US8999380B2 (en) | 2012-04-02 | 2015-04-07 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| WO2015095351A1 (en) | 2013-12-19 | 2015-06-25 | Novartis Ag | LEPTIN mRNA COMPOSITIONS AND FORMULATIONS |
| US9107886B2 (en) | 2012-04-02 | 2015-08-18 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding basic helix-loop-helix family member E41 |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| US9334328B2 (en) | 2010-10-01 | 2016-05-10 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9376669B2 (en) | 2012-11-01 | 2016-06-28 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9422577B2 (en) | 2011-12-05 | 2016-08-23 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US9428535B2 (en) | 2011-10-03 | 2016-08-30 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9512456B2 (en) | 2012-08-14 | 2016-12-06 | Modernatx, Inc. | Enzymes and polymerases for the synthesis of RNA |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9597380B2 (en) | 2012-11-26 | 2017-03-21 | Modernatx, Inc. | Terminally modified RNA |
| WO2017098468A1 (en) | 2015-12-09 | 2017-06-15 | Novartis Ag | Label-free analysis of rna capping efficiency using rnase h, probes and liquid chromatography/mass spectrometry |
| US9751925B2 (en) | 2014-11-10 | 2017-09-05 | Modernatx, Inc. | Alternative nucleic acid molecules containing reduced uracil content and uses thereof |
| US9770489B2 (en) | 2014-01-31 | 2017-09-26 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| US10137206B2 (en) | 2016-08-17 | 2018-11-27 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10207010B2 (en) | 2015-12-10 | 2019-02-19 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US10258698B2 (en) | 2013-03-14 | 2019-04-16 | Modernatx, Inc. | Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions |
| US10272150B2 (en) | 2015-10-22 | 2019-04-30 | Modernatx, Inc. | Combination PIV3/hMPV RNA vaccines |
| US10273269B2 (en) | 2017-02-16 | 2019-04-30 | Modernatx, Inc. | High potency immunogenic zika virus compositions |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US10323076B2 (en) | 2013-10-03 | 2019-06-18 | Modernatx, Inc. | Polynucleotides encoding low density lipoprotein receptor |
| US10383937B2 (en) | 2015-10-22 | 2019-08-20 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US10449244B2 (en) | 2015-07-21 | 2019-10-22 | Modernatx, Inc. | Zika RNA vaccines |
| US10465190B1 (en) | 2015-12-23 | 2019-11-05 | Modernatx, Inc. | In vitro transcription methods and constructs |
| US10493143B2 (en) | 2015-10-22 | 2019-12-03 | Modernatx, Inc. | Sexually transmitted disease vaccines |
| US10501404B1 (en) | 2019-07-30 | 2019-12-10 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US10517940B2 (en) | 2015-10-22 | 2019-12-31 | Modernatx, Inc. | Zika virus RNA vaccines |
| US10526629B2 (en) | 2017-08-18 | 2020-01-07 | Modernatx, Inc. | RNA polymerase variants |
| US10653767B2 (en) | 2017-09-14 | 2020-05-19 | Modernatx, Inc. | Zika virus MRNA vaccines |
| US10653712B2 (en) | 2016-09-14 | 2020-05-19 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US10695419B2 (en) | 2016-10-21 | 2020-06-30 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US10709779B2 (en) | 2014-04-23 | 2020-07-14 | Modernatx, Inc. | Nucleic acid vaccines |
| US10730924B2 (en) | 2016-05-18 | 2020-08-04 | Modernatx, Inc. | Polynucleotides encoding relaxin |
| US10815291B2 (en) | 2013-09-30 | 2020-10-27 | Modernatx, Inc. | Polynucleotides encoding immune modulating polypeptides |
| US10849920B2 (en) | 2015-10-05 | 2020-12-01 | Modernatx, Inc. | Methods for therapeutic administration of messenger ribonucleic acid drugs |
| US10925958B2 (en) | 2016-11-11 | 2021-02-23 | Modernatx, Inc. | Influenza vaccine |
| US11045540B2 (en) | 2017-03-15 | 2021-06-29 | Modernatx, Inc. | Varicella zoster virus (VZV) vaccine |
| US11103578B2 (en) | 2016-12-08 | 2021-08-31 | Modernatx, Inc. | Respiratory virus nucleic acid vaccines |
| US11241505B2 (en) | 2015-02-13 | 2022-02-08 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US11351242B1 (en) | 2019-02-12 | 2022-06-07 | Modernatx, Inc. | HMPV/hPIV3 mRNA vaccine composition |
| US11364292B2 (en) | 2015-07-21 | 2022-06-21 | Modernatx, Inc. | CHIKV RNA vaccines |
| US11384352B2 (en) | 2016-12-13 | 2022-07-12 | Modernatx, Inc. | RNA affinity purification |
| US11406703B2 (en) | 2020-08-25 | 2022-08-09 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11464848B2 (en) | 2017-03-15 | 2022-10-11 | Modernatx, Inc. | Respiratory syncytial virus vaccine |
| US11485960B2 (en) | 2019-02-20 | 2022-11-01 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US11497807B2 (en) | 2017-03-17 | 2022-11-15 | Modernatx, Inc. | Zoonotic disease RNA vaccines |
| US11524023B2 (en) | 2021-02-19 | 2022-12-13 | Modernatx, Inc. | Lipid nanoparticle compositions and methods of formulating the same |
| US11547673B1 (en) | 2020-04-22 | 2023-01-10 | BioNTech SE | Coronavirus vaccine |
| US11564893B2 (en) | 2015-08-17 | 2023-01-31 | Modernatx, Inc. | Methods for preparing particles and related compositions |
| US11576961B2 (en) | 2017-03-15 | 2023-02-14 | Modernatx, Inc. | Broad spectrum influenza virus vaccine |
| US11643441B1 (en) | 2015-10-22 | 2023-05-09 | Modernatx, Inc. | Nucleic acid vaccines for varicella zoster virus (VZV) |
| US11744801B2 (en) | 2017-08-31 | 2023-09-05 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US11752206B2 (en) | 2017-03-15 | 2023-09-12 | Modernatx, Inc. | Herpes simplex virus vaccine |
| US11786607B2 (en) | 2017-06-15 | 2023-10-17 | Modernatx, Inc. | RNA formulations |
| US11851694B1 (en) | 2019-02-20 | 2023-12-26 | Modernatx, Inc. | High fidelity in vitro transcription |
| US11866696B2 (en) | 2017-08-18 | 2024-01-09 | Modernatx, Inc. | Analytical HPLC methods |
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
| US11905525B2 (en) | 2017-04-05 | 2024-02-20 | Modernatx, Inc. | Reduction of elimination of immune responses to non-intravenous, e.g., subcutaneously administered therapeutic proteins |
| US11911453B2 (en) | 2018-01-29 | 2024-02-27 | Modernatx, Inc. | RSV RNA vaccines |
| US11912982B2 (en) | 2017-08-18 | 2024-02-27 | Modernatx, Inc. | Methods for HPLC analysis |
| US12070495B2 (en) | 2019-03-15 | 2024-08-27 | Modernatx, Inc. | HIV RNA vaccines |
| US12090235B2 (en) | 2018-09-20 | 2024-09-17 | Modernatx, Inc. | Preparation of lipid nanoparticles and methods of administration thereof |
| US12128113B2 (en) | 2016-05-18 | 2024-10-29 | Modernatx, Inc. | Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome |
| US12151029B2 (en) | 2018-09-19 | 2024-11-26 | Modernatx, Inc. | PEG lipids and uses thereof |
| US12150980B2 (en) | 2015-07-30 | 2024-11-26 | Modernatx, Inc. | Concatemeric peptide epitope RNAs |
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| US12227768B2 (en) | 2011-12-05 | 2025-02-18 | Factor Bioscience Inc. | Methods and products for transfection |
| US12329811B2 (en) | 2021-01-11 | 2025-06-17 | Modernatx, Inc. | Seasonal RNA influenza virus vaccines |
| US12344572B2 (en) | 2019-07-03 | 2025-07-01 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US12383508B2 (en) | 2018-09-19 | 2025-08-12 | Modernatx, Inc. | High-purity peg lipids and uses thereof |
| US12428577B2 (en) | 2021-05-14 | 2025-09-30 | Modernatx, Inc. | Methods of monitoring in vitro transcription of mRNA and/or post-in vitro transcription processes |
Families Citing this family (165)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DE10347710B4 (en) | 2003-10-14 | 2006-03-30 | Johannes-Gutenberg-Universität Mainz | Recombinant vaccines and their use |
| US9012219B2 (en) | 2005-08-23 | 2015-04-21 | The Trustees Of The University Of Pennsylvania | RNA preparations comprising purified modified RNA for reprogramming cells |
| DE102005046490A1 (en) | 2005-09-28 | 2007-03-29 | Johannes-Gutenberg-Universität Mainz | New nucleic acid molecule comprising promoter, a transcriptable nucleic acid sequence, a first and second nucleic acid sequence for producing modified RNA with transcriptional stability and translational efficiency |
| HUE038039T2 (en) | 2009-12-01 | 2018-09-28 | Translate Bio Inc | Delivery of mrna for the augmentation of proteins and enzymes in human genetic diseases |
| HUE047165T2 (en) | 2009-12-07 | 2020-04-28 | Univ Pennsylvania | Rna preparations comprising purified modified rna for reprogramming cells |
| US9006417B2 (en) | 2010-06-30 | 2015-04-14 | Protiva Biotherapeutics, Inc. | Non-liposomal systems for nucleic acid delivery |
| CA2804396C (en) | 2010-07-06 | 2021-06-29 | Novartis Ag | Liposomes with lipids having an advantageous pka-value for rna delivery |
| DK2591114T3 (en) | 2010-07-06 | 2016-08-29 | Glaxosmithkline Biologicals Sa | Immunization of large mammals with low doses of RNA |
| PT3243526T (en) | 2010-07-06 | 2020-03-04 | Glaxosmithkline Biologicals Sa | DISTRIBUTION OF RNA TO DISPOLISH MULTIPLE IMMUNITY ROUTES |
| RS63329B1 (en) | 2010-08-31 | 2022-07-29 | Glaxosmithkline Biologicals Sa | Pegylated liposomes for delivery of immunogen-encoding rna |
| ES2716243T3 (en) | 2010-10-11 | 2019-06-11 | Glaxosmithkline Biologicals Sa | Antigen Supply Platforms |
| WO2012075040A2 (en) | 2010-11-30 | 2012-06-07 | Shire Human Genetic Therapies, Inc. | mRNA FOR USE IN TREATMENT OF HUMAN GENETIC DISEASES |
| EP3235508B1 (en) * | 2011-03-16 | 2020-12-30 | Sanofi | Compositions comprising a dual v region antibody-like protein |
| HUE046152T2 (en) | 2011-05-24 | 2020-02-28 | Biontech Rna Pharmaceuticals Gmbh | Individualized vaccines for cancer |
| PL2717893T3 (en) | 2011-06-08 | 2019-12-31 | Translate Bio, Inc. | Lipid nanoparticle compositions and methods for mRNA delivery |
| WO2013006838A1 (en) | 2011-07-06 | 2013-01-10 | Novartis Ag | Immunogenic combination compositions and uses thereof |
| AU2012352455B2 (en) | 2011-12-12 | 2016-01-21 | The Trustees Of The University Of Pennsylvania | Proteins comprising MRSA PBP2a and fragments thereof, nucleic acids encoding the same, and compositions and their use to prevent and treat MRSA infections |
| WO2013143555A1 (en) | 2012-03-26 | 2013-10-03 | Biontech Ag | Rna formulation for immunotherapy |
| WO2013185067A1 (en) | 2012-06-08 | 2013-12-12 | Shire Human Genetic Therapies, Inc. | Nuclease resistant polynucleotides and uses thereof |
| JP6561378B2 (en) | 2012-06-08 | 2019-08-21 | トランスレイト バイオ, インコーポレイテッド | Transpulmonary delivery of mRNA to non-pulmonary target cells |
| US20150307542A1 (en) | 2012-10-03 | 2015-10-29 | Moderna Therapeutics, Inc. | Modified nucleic acid molecules and uses thereof |
| WO2014082729A1 (en) | 2012-11-28 | 2014-06-05 | Biontech Ag | Individualized vaccines for cancer |
| CA2897941A1 (en) | 2013-01-17 | 2014-07-24 | Moderna Therapeutics, Inc. | Signal-sensor polynucleotides for the alteration of cellular phenotypes |
| WO2014124457A1 (en) * | 2013-02-11 | 2014-08-14 | University Of Louisville Research Foundation, Inc. | Methods for producing antibodies |
| WO2014159813A1 (en) | 2013-03-13 | 2014-10-02 | Moderna Therapeutics, Inc. | Long-lived polynucleotide molecules |
| MX2015011947A (en) * | 2013-03-14 | 2015-12-01 | Shire Human Genetic Therapies | Methods and compositions for delivering mrna coded antibodies. |
| AU2014236396A1 (en) | 2013-03-14 | 2015-08-13 | Shire Human Genetic Therapies, Inc. | Methods for purification of messenger RNA |
| IL290953B2 (en) | 2013-03-14 | 2024-01-01 | Ethris Gmbh | Cftr mrna compositions and related methods and uses |
| EP4279610A3 (en) | 2013-03-15 | 2024-01-03 | ModernaTX, Inc. | Ribonucleic acid purification |
| HUE071526T2 (en) | 2013-03-15 | 2025-09-28 | Translate Bio Inc | Synergistic enhancement of the delivery of nucleic acids via blended formulations |
| WO2014152027A1 (en) | 2013-03-15 | 2014-09-25 | Moderna Therapeutics, Inc. | Manufacturing methods for production of rna transcripts |
| WO2014144767A1 (en) | 2013-03-15 | 2014-09-18 | Moderna Therapeutics, Inc. | Ion exchange purification of mrna |
| US10077439B2 (en) | 2013-03-15 | 2018-09-18 | Modernatx, Inc. | Removal of DNA fragments in mRNA production process |
| DE102013005361A1 (en) | 2013-03-28 | 2014-10-02 | Eberhard Karls Universität Tübingen Medizinische Fakultät | polyribonucleotide |
| WO2014180490A1 (en) | 2013-05-10 | 2014-11-13 | Biontech Ag | Predicting immunogenicity of t cell epitopes |
| PT3019619T (en) | 2013-07-11 | 2021-11-11 | Modernatx Inc | COMPOSITIONS COMPRISING SYNTHETIC POLYNUCLEOTIDES ENCODING SYNTHETIC CRISPR AND SGARN-RELATED PROTEINS AND METHODS OF USE |
| US20160194368A1 (en) * | 2013-09-03 | 2016-07-07 | Moderna Therapeutics, Inc. | Circular polynucleotides |
| WO2015051169A2 (en) | 2013-10-02 | 2015-04-09 | Moderna Therapeutics, Inc. | Polynucleotide molecules and uses thereof |
| CN106413811A (en) | 2013-10-22 | 2017-02-15 | 夏尔人类遗传性治疗公司 | Mrna therapy for argininosuccinate synthetase deficiency |
| KR102096796B1 (en) | 2013-10-22 | 2020-05-27 | 샤이어 휴먼 지네틱 테라피즈 인크. | Lipid formulations for delivery of messenger rna |
| EP4036241A1 (en) | 2013-10-22 | 2022-08-03 | Translate Bio, Inc. | Cns delivery of mrna and uses thereof |
| EA201992208A1 (en) | 2013-10-22 | 2020-07-31 | Транслейт Био, Инк. | TREATMENT OF PHENYLKETONURIA USING mRNA |
| SG11201608725YA (en) | 2014-04-25 | 2016-11-29 | Shire Human Genetic Therapies | Methods for purification of messenger rna |
| CA3211902A1 (en) | 2014-05-30 | 2015-12-03 | Translate Bio, Inc. | Biodegradable lipids for delivery of nucleic acids |
| US10286086B2 (en) | 2014-06-19 | 2019-05-14 | Modernatx, Inc. | Alternative nucleic acid molecules and uses thereof |
| PE20171238A1 (en) | 2014-06-24 | 2017-08-24 | Shire Human Genetic Therapies | STEREOCHEMICALLY ENRICHED COMPOSITIONS FOR NUCLEIC ACIDS ADMINISTRATION |
| EP3164112A1 (en) | 2014-07-02 | 2017-05-10 | Shire Human Genetic Therapies, Inc. | Encapsulation of messenger rna |
| AU2015289656A1 (en) | 2014-07-16 | 2017-02-16 | Modernatx, Inc. | Circular polynucleotides |
| WO2016045732A1 (en) | 2014-09-25 | 2016-03-31 | Biontech Rna Pharmaceuticals Gmbh | Stable formulations of lipids and liposomes |
| GB201418965D0 (en) * | 2014-10-24 | 2014-12-10 | Ospedale San Raffaele And Fond Telethon | |
| EP3884964A1 (en) | 2014-12-05 | 2021-09-29 | Translate Bio, Inc. | Messenger rna therapy for treatment of articular disease |
| WO2016128060A1 (en) | 2015-02-12 | 2016-08-18 | Biontech Ag | Predicting t cell epitopes useful for vaccination |
| WO2016130943A1 (en) | 2015-02-13 | 2016-08-18 | Rana Therapeutics, Inc. | Hybrid oligonucleotides and uses thereof |
| CA2979695A1 (en) | 2015-03-19 | 2016-09-22 | Translate Bio, Inc. | Mrna therapy for pompe disease |
| WO2016180430A1 (en) | 2015-05-08 | 2016-11-17 | Curevac Ag | Method for producing rna |
| DE202016009003U1 (en) | 2015-05-29 | 2021-05-28 | Curevac Real Estate Gmbh | Composition comprising in vitro transcribed RNA obtainable by a method for the production and purification of RNA with at least one step with a tangential flow filtration |
| ES2908449T3 (en) | 2015-09-17 | 2022-04-29 | Modernatx Inc | Polynucleotides that contain a stabilizing tail region |
| WO2017049286A1 (en) | 2015-09-17 | 2017-03-23 | Moderna Therapeutics, Inc. | Polynucleotides containing a morpholino linker |
| WO2017059902A1 (en) | 2015-10-07 | 2017-04-13 | Biontech Rna Pharmaceuticals Gmbh | 3' utr sequences for stabilization of rna |
| MA56219A (en) | 2015-10-14 | 2022-04-20 | Translate Bio Inc | MODIFICATION OF RNA-RELATED ENZYMES FOR ENHANCED PRODUCTION |
| EP3368089A4 (en) | 2015-10-26 | 2019-05-29 | Translate Bio Ma, Inc. | NANOPARTICLE FORMULATIONS FOR ADMINISTRATION OF NUCLEIC ACID COMPLEXES |
| US20210206818A1 (en) | 2016-01-22 | 2021-07-08 | Modernatx, Inc. | Messenger ribonucleic acids for the production of intracellular binding polypeptides and methods of use thereof |
| TW201738256A (en) * | 2016-04-04 | 2017-11-01 | 日產化學工業股份有限公司 | Production method of protein |
| AU2017248189B2 (en) | 2016-04-08 | 2021-04-29 | Translate Bio, Inc. | Multimeric coding nucleic acid and uses thereof |
| US20180126003A1 (en) * | 2016-05-04 | 2018-05-10 | Curevac Ag | New targets for rna therapeutics |
| EP3241905A1 (en) * | 2016-05-06 | 2017-11-08 | Miltenyi Biotec GmbH | Method for introducing nucleic acids into a cell |
| WO2017218524A1 (en) | 2016-06-13 | 2017-12-21 | Rana Therapeutics, Inc. | Messenger rna therapy for the treatment of ornithine transcarbamylase deficiency |
| WO2017223176A1 (en) | 2016-06-24 | 2017-12-28 | Modernatx, Inc. | Methods and apparatus for filtration |
| US20190161730A1 (en) | 2016-07-07 | 2019-05-30 | Rubius Therapeutics, Inc. | Compositions and methods related to therapeutic cell systems expressing exogenous rna |
| WO2018035380A1 (en) | 2016-08-17 | 2018-02-22 | Solstice Biologics, Ltd. | Polynucleotide constructs |
| US11390899B2 (en) * | 2016-09-26 | 2022-07-19 | SOLA Biosciences, LLC | Cell-associated secretion-enhancing fusion proteins |
| AU2017347837A1 (en) | 2016-10-26 | 2019-06-06 | Modernatx, Inc. | Messenger ribonucleic acids for enhancing immune responses and methods of use thereof |
| AU2018207440B2 (en) | 2017-01-11 | 2022-06-02 | The Board Of Trustees Of The Leland Stanford Junior University | R-spondin (RSPO) surrogate molecules |
| CN110234662A (en) | 2017-01-26 | 2019-09-13 | 瑟罗泽恩公司 | Tissue specificity WNT signal enhancing molecule and its purposes |
| US10093706B2 (en) | 2017-01-30 | 2018-10-09 | Indiana University Research And Technology Corporation | Dominant positive hnRNP-E1 polypeptide compositions and methods |
| US20190351039A1 (en) | 2017-02-01 | 2019-11-21 | Modernatx, Inc. | Immunomodulatory therapeutic mrna compositions encoding activating oncogene mutation peptides |
| WO2018157154A2 (en) | 2017-02-27 | 2018-08-30 | Translate Bio, Inc. | Novel codon-optimized cftr mrna |
| TW201842921A (en) | 2017-02-28 | 2018-12-16 | 法商賽諾菲公司 | Therapeutic rna |
| CN106929513A (en) * | 2017-04-07 | 2017-07-07 | 东南大学 | The nano antibody of mRNA codings and its application |
| US11173190B2 (en) | 2017-05-16 | 2021-11-16 | Translate Bio, Inc. | Treatment of cystic fibrosis by delivery of codon-optimized mRNA encoding CFTR |
| EP3625345B1 (en) | 2017-05-18 | 2023-05-24 | ModernaTX, Inc. | Modified messenger rna comprising functional rna elements |
| WO2018217897A1 (en) * | 2017-05-23 | 2018-11-29 | David Weiner | Compositions and method for inducing an immune response |
| WO2018224166A1 (en) | 2017-06-09 | 2018-12-13 | Biontech Rna Pharmaceuticals Gmbh | Methods for predicting the usefulness of disease specific amino acid modifications for immunotherapy |
| WO2019006455A1 (en) | 2017-06-30 | 2019-01-03 | Solstice Biologics, Ltd. | Chiral phosphoramidite auxiliaries and methods of their use |
| WO2019010224A1 (en) * | 2017-07-03 | 2019-01-10 | Torque Therapeutics, Inc. | Fusion molecules targeting immune regulatory cells and uses thereof |
| WO2019126593A1 (en) | 2017-12-20 | 2019-06-27 | Translate Bio, Inc. | Improved composition and methods for treatment of ornithine transcarbamylase deficiency |
| EP3735270A1 (en) | 2018-01-05 | 2020-11-11 | Modernatx, Inc. | Polynucleotides encoding anti-chikungunya virus antibodies |
| EP3746052A1 (en) | 2018-01-30 | 2020-12-09 | Modernatx, Inc. | Compositions and methods for delivery of agents to immune cells |
| WO2019200171A1 (en) | 2018-04-11 | 2019-10-17 | Modernatx, Inc. | Messenger rna comprising functional rna elements |
| CN119286871A (en) | 2018-04-19 | 2025-01-10 | 查美特制药公司 | Synthetic RIG-I-like receptor agonists |
| EP3841208A1 (en) | 2018-08-24 | 2021-06-30 | Translate Bio, Inc. | Methods for purification of messenger rna |
| JP7450945B2 (en) | 2018-08-30 | 2024-03-18 | テナヤ セラピューティクス, インコーポレイテッド | Cardiac cell reprogramming using myocardin and ASCL1 |
| US20230081530A1 (en) | 2018-09-14 | 2023-03-16 | Modernatx, Inc. | Methods and compositions for treating cancer using mrna therapeutics |
| US12331320B2 (en) | 2018-10-10 | 2025-06-17 | The Research Foundation For The State University Of New York | Genome edited cancer cell vaccines |
| US20220001026A1 (en) | 2018-11-08 | 2022-01-06 | Modernatx, Inc. | Use of mrna encoding ox40l to treat cancer in human patients |
| WO2020106946A1 (en) | 2018-11-21 | 2020-05-28 | Translate Bio, Inc. | TREATMENT OF CYSTIC FIBROSIS BY DELIVERY OF NEBULIZED mRNA ENCODING CFTR |
| JP2022531461A (en) | 2019-05-07 | 2022-07-06 | モデルナティエックス インコーポレイテッド | Polynucleotides that disrupt immune cell activity and how to use them |
| US20230086537A1 (en) | 2019-05-07 | 2023-03-23 | Modernatx, Inc. | Differentially expressed immune cell micrornas for regulation of protein expression |
| EP3986480A1 (en) | 2019-06-24 | 2022-04-27 | ModernaTX, Inc. | Messenger rna comprising functional rna elements and uses thereof |
| MA56539A (en) | 2019-06-24 | 2022-04-27 | Modernatx Inc | ENDONUCLEASE RESISTANT MESSENGER RNA AND USES THEREOF |
| US20230137971A1 (en) | 2019-07-11 | 2023-05-04 | Tenaya Therapeutics Inc. | Cardiac cell reprogramming with micrornas and other factors |
| WO2021050986A1 (en) | 2019-09-11 | 2021-03-18 | Modernatx, Inc. | Lnp-formulated mrna therapeutics and use thereof for treating human subjects |
| CA3155202A1 (en) | 2019-10-23 | 2021-04-29 | Arthur M. Krieg | Synthetic rig-i-like receptor agonists |
| US11241493B2 (en) | 2020-02-04 | 2022-02-08 | Curevac Ag | Coronavirus vaccine |
| US12194089B2 (en) | 2020-02-04 | 2025-01-14 | CureVac SE | Coronavirus vaccine |
| EP4114421A1 (en) | 2020-03-02 | 2023-01-11 | Tenaya Therapeutics, Inc. | Gene vector control by cardiomyocyte-expressed micrornas |
| BR112022017713A2 (en) * | 2020-03-04 | 2022-11-16 | Flagship Pioneering Innovations Vi Llc | METHODS AND COMPOSITIONS TO MODULATE A GENOME |
| EP4132478A1 (en) | 2020-04-09 | 2023-02-15 | Finncure Oy | Mimetic nanoparticles for preventing the spreading and lowering the infection rate of novel coronaviruses |
| US12194157B2 (en) | 2020-04-09 | 2025-01-14 | Finncure Oy | Carrier for targeted delivery to a host |
| WO2021243207A1 (en) | 2020-05-28 | 2021-12-02 | Modernatx, Inc. | Use of mrnas encoding ox40l, il-23 and il-36gamma for treating cancer |
| CA3187138A1 (en) * | 2020-06-26 | 2021-12-30 | Carisma Therapeutics Inc. | Mrna transfection of immune cells |
| BR112023001955A2 (en) | 2020-08-06 | 2023-04-11 | Modernatx Inc | COMPOSITIONS FOR THE DELIVERY OF PAYLOAD MOLECULES TO THE AIRWAY EPITHELIUM |
| US12419948B2 (en) | 2020-08-31 | 2025-09-23 | The Broad Institute, Inc. | Immunogenic compositions and use thereof |
| KR20230109668A (en) | 2020-11-16 | 2023-07-20 | 서로젠 오퍼레이팅, 인크. | Liver-Specific Wnt Signaling Enhancer Molecules and Uses Thereof |
| CA3200234A1 (en) | 2020-11-25 | 2022-06-02 | Daryl C. Drummond | Lipid nanoparticles for delivery of nucleic acids, and related methods of use |
| IL303457A (en) | 2020-12-09 | 2023-08-01 | BioNTech SE | Production of RNA |
| KR20230164648A (en) | 2020-12-22 | 2023-12-04 | 큐어백 에스이 | RNA vaccines against SARS-CoV-2 variants |
| WO2022155404A1 (en) * | 2021-01-14 | 2022-07-21 | Translate Bio, Inc. | Methods and compositions for delivering mrna coded antibodies |
| AU2021421391A1 (en) | 2021-01-24 | 2023-07-20 | Michael David FORREST | Inhibitors of atp synthase - cosmetic and therapeutic uses |
| US12343375B2 (en) | 2021-02-09 | 2025-07-01 | University Of Louisville Research Foundation, Inc. | Spray dried formulation of a cholera toxin B subunit variant |
| AU2022242828A1 (en) | 2021-03-23 | 2023-10-12 | Recode Therapeutics, Inc. | Polynucleotide compositions, related formulations, and methods of use thereof |
| WO2022212191A1 (en) * | 2021-04-01 | 2022-10-06 | Modernatx, Inc. | Mucosal expression of antibody structures and isotypes by mrna |
| TW202320736A (en) | 2021-07-26 | 2023-06-01 | 美商現代公司 | Processes for preparing lipid nanoparticle compositions |
| CN118019526A (en) | 2021-07-26 | 2024-05-10 | 摩登纳特斯有限公司 | Methods for preparing lipid nanoparticle compositions for delivering payload molecules to airway epithelium |
| CN113736768B (en) * | 2021-08-18 | 2023-06-23 | 新发药业有限公司 | Pseudo uridine synthetase mutant, mutant gene and application thereof in preparation of vitamin B2 |
| CN117999355A (en) | 2021-08-24 | 2024-05-07 | 生物技术欧洲股份公司 | In vitro transcription technology |
| WO2023064469A1 (en) | 2021-10-13 | 2023-04-20 | Modernatx, Inc. | Compositions of mrna-encoded il15 fusion proteins and methods of use thereof |
| US20240417805A1 (en) | 2021-10-21 | 2024-12-19 | Curevac Netherlands B.V. | Cancer neoantigens |
| JP2024539512A (en) | 2021-10-22 | 2024-10-28 | セイル バイオメディシンズ インコーポレイテッド | MRNA Vaccine Compositions |
| US20250049727A1 (en) | 2021-11-12 | 2025-02-13 | Modernatx, Inc. | Compositions for the delivery of payload molecules to airway epithelium |
| CA3238764A1 (en) | 2021-11-23 | 2023-06-01 | Siddharth Patel | A bacteria-derived lipid composition and use thereof |
| JP2025500373A (en) | 2021-12-20 | 2025-01-09 | セイル バイオメディシンズ インコーポレイテッド | Composition for MRNA treatment |
| TW202345863A (en) | 2022-02-09 | 2023-12-01 | 美商現代公司 | Mucosal administration methods and formulations |
| WO2023196898A1 (en) | 2022-04-07 | 2023-10-12 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Beta globin mimetic peptides and their use |
| WO2023196988A1 (en) | 2022-04-07 | 2023-10-12 | Modernatx, Inc. | Methods of use of mrnas encoding il-12 |
| IL316370A (en) | 2022-04-15 | 2024-12-01 | Smartcella Solutions Ab | Compositions and methods for exosome-mediated delivery of messenger RNA factors |
| IL317109A (en) | 2022-05-25 | 2025-01-01 | Akagera Medicines Inc | Lipid nanoparticles for delivery of nucleic acids and methods of use thereof |
| WO2024010841A2 (en) | 2022-07-06 | 2024-01-11 | Molecular Axiom, Llc | Compositions and methods for treating pancreatic cancer |
| EP4577553A2 (en) * | 2022-08-26 | 2025-07-02 | TriLink BioTechnologies, LLC | Efficient method for making highly purified 5'-capped oligonucleotides |
| WO2024083345A1 (en) | 2022-10-21 | 2024-04-25 | BioNTech SE | Methods and uses associated with liquid compositions |
| EP4608442A1 (en) | 2022-10-28 | 2025-09-03 | GlaxoSmithKline Biologicals S.A. | Nucleic acid based vaccine |
| WO2024102434A1 (en) | 2022-11-10 | 2024-05-16 | Senda Biosciences, Inc. | Rna compositions comprising lipid nanoparticles or lipid reconstructed natural messenger packs |
| WO2024107827A1 (en) | 2022-11-16 | 2024-05-23 | The Broad Institute, Inc. | Therapeutic exploitation of sting channel activity |
| CN120380160A (en) * | 2022-12-23 | 2025-07-25 | 赛诺菲巴斯德有限公司 | Optimized tailing of messenger RNA |
| WO2024158824A1 (en) | 2023-01-23 | 2024-08-02 | Yale University | Antibody oligonucleotide conjugates |
| WO2024159172A1 (en) | 2023-01-27 | 2024-08-02 | Senda Biosciences, Inc. | A modified lipid composition and uses thereof |
| WO2024178305A1 (en) | 2023-02-24 | 2024-08-29 | Modernatx, Inc. | Compositions of mrna-encoded il-15 fusion proteins and methods of use thereof for treating cancer |
| WO2024189583A1 (en) | 2023-03-15 | 2024-09-19 | Kyoto Prefectural Public University Corporation | Peptide expression constructs and uses thereof |
| WO2024197307A1 (en) | 2023-03-23 | 2024-09-26 | Modernatx, Inc. | Peg targeting compounds for delivery of therapeutics |
| WO2024197309A1 (en) | 2023-03-23 | 2024-09-26 | Modernatx, Inc. | Peg targeting compounds for delivery of therapeutics |
| WO2024197310A1 (en) | 2023-03-23 | 2024-09-26 | Modernatx, Inc. | Peg targeting compounds for delivery of therapeutics |
| WO2024220712A2 (en) | 2023-04-19 | 2024-10-24 | Sail Biomedicines, Inc. | Vaccine compositions |
| WO2024220752A2 (en) | 2023-04-19 | 2024-10-24 | Sail Biomedicines, Inc. | Rna therapeutic compositions |
| WO2024220625A1 (en) | 2023-04-19 | 2024-10-24 | Sail Biomedicines, Inc. | Delivery of polynucleotides from lipid nanoparticles comprising rna and ionizable lipids |
| WO2024238726A1 (en) | 2023-05-16 | 2024-11-21 | Omega Therapeutics, Inc. | Methods and compositions for modulating methylation of a target gene |
| WO2024238723A1 (en) | 2023-05-16 | 2024-11-21 | Omega Therapeutics, Inc. | Methods and compositions for modulating pcsk9 expression |
| WO2025019742A1 (en) | 2023-07-19 | 2025-01-23 | Omega Therapeutics, Inc. | Methods and compositions for modulating ctnnb1 expression |
| WO2025059215A1 (en) | 2023-09-12 | 2025-03-20 | Aadigen, Llc | Methods and compositions for treating or preventing cancer |
| WO2025072383A1 (en) | 2023-09-25 | 2025-04-03 | The Broad Institute, Inc. | Viral open reading frames, uses thereof, and methods of detecting the same |
| WO2025068553A1 (en) | 2023-09-28 | 2025-04-03 | Universität Basel | Catalytic moieties for treating cancer |
| WO2025076013A1 (en) | 2023-10-01 | 2025-04-10 | Vaccine Company, Inc. | Engineered middle east respiratory syndrome proteins and related methods |
| WO2025097055A2 (en) | 2023-11-02 | 2025-05-08 | The Broad Institute, Inc. | Compositions and methods of use of t cells in immunotherapy |
| WO2025129158A1 (en) | 2023-12-15 | 2025-06-19 | The Broad Institute, Inc. | Engineered arc delivery vesicles and uses thereof |
| WO2025144938A1 (en) | 2023-12-26 | 2025-07-03 | Emmune, Inc. | Systems for nucleic acid transfer |
| WO2025194138A1 (en) | 2024-03-14 | 2025-09-18 | Tessera Therapeutics, Inc. | St1cas9 compositions and methods for modulating a genome |
Family Cites Families (1162)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2008526A (en) | 1932-11-03 | 1935-07-16 | Wappler Frederick Charles | Method and means for treating living tissue |
| US3467096A (en) | 1966-04-12 | 1969-09-16 | Ferrell S Horn | Multiple hypodermic syringe arrangement |
| BE757653A (en) | 1969-10-21 | 1971-04-16 | Ugine Kuhlmann | NEW DRUGS DERIVED FROM NUCLEIC ACIDS AND METHODS FOR THEIR PREPARATION |
| BE786542A (en) | 1971-07-22 | 1973-01-22 | Dow Corning | SUCTION DEVICE ALLOWING TO OBTAIN CELL SAMPLES |
| US3906092A (en) | 1971-11-26 | 1975-09-16 | Merck & Co Inc | Stimulation of antibody response |
| US4270537A (en) | 1979-11-19 | 1981-06-02 | Romaine Richard A | Automatic hypodermic syringe |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5132418A (en) | 1980-02-29 | 1992-07-21 | University Patents, Inc. | Process for preparing polynucleotides |
| US4458066A (en) | 1980-02-29 | 1984-07-03 | University Patents, Inc. | Process for preparing polynucleotides |
| US4500707A (en) | 1980-02-29 | 1985-02-19 | University Patents, Inc. | Nucleosides useful in the preparation of polynucleotides |
| US4411657A (en) | 1980-05-19 | 1983-10-25 | Anibal Galindo | Hypodermic needle |
| US4668777A (en) | 1981-03-27 | 1987-05-26 | University Patents, Inc. | Phosphoramidite nucleoside compounds |
| US4973679A (en) | 1981-03-27 | 1990-11-27 | University Patents, Inc. | Process for oligonucleo tide synthesis using phosphormidite intermediates |
| US4415732A (en) | 1981-03-27 | 1983-11-15 | University Patents, Inc. | Phosphoramidite compounds and processes |
| US4401796A (en) | 1981-04-30 | 1983-08-30 | City Of Hope Research Institute | Solid-phase synthesis of polynucleotides |
| US4373071A (en) | 1981-04-30 | 1983-02-08 | City Of Hope Research Institute | Solid-phase synthesis of polynucleotides |
| US4474569A (en) | 1982-06-28 | 1984-10-02 | Denver Surgical Developments, Inc. | Antenatal shunt |
| US4588585A (en) | 1982-10-19 | 1986-05-13 | Cetus Corporation | Human recombinant cysteine depleted interferon-β muteins |
| US4737462A (en) | 1982-10-19 | 1988-04-12 | Cetus Corporation | Structural genes, plasmids and transformed cells for producing cysteine depleted muteins of interferon-β |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4579849A (en) | 1984-04-06 | 1986-04-01 | Merck & Co., Inc. | N-alkylguanine acyclonucleosides as antiviral agents |
| US4957735A (en) | 1984-06-12 | 1990-09-18 | The University Of Tennessee Research Corporation | Target-sensitive immunoliposomes- preparation and characterization |
| US4959314A (en) | 1984-11-09 | 1990-09-25 | Cetus Corporation | Cysteine-depleted muteins of biologically active proteins |
| US5036006A (en) | 1984-11-13 | 1991-07-30 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues and apparatus therefor |
| US5116943A (en) | 1985-01-18 | 1992-05-26 | Cetus Corporation | Oxidation-resistant muteins of Il-2 and other protein |
| CA1288073C (en) | 1985-03-07 | 1991-08-27 | Paul G. Ahlquist | Rna transformation vector |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| EP0204401A1 (en) | 1985-04-09 | 1986-12-10 | Biogen, Inc. | Method of improving the yield of polypeptides produced in a host cell by stabilizing mRNA |
| US5017691A (en) | 1986-07-03 | 1991-05-21 | Schering Corporation | Mammalian interleukin-4 |
| US5153319A (en) | 1986-03-31 | 1992-10-06 | University Patents, Inc. | Process for preparing polynucleotides |
| US4879111A (en) | 1986-04-17 | 1989-11-07 | Cetus Corporation | Treatment of infections with lymphokines |
| CA1283827C (en) | 1986-12-18 | 1991-05-07 | Giorgio Cirelli | Appliance for injection of liquid formulations |
| GB8704027D0 (en) | 1987-02-20 | 1987-03-25 | Owen Mumford Ltd | Syringe needle combination |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US4940460A (en) | 1987-06-19 | 1990-07-10 | Bioject, Inc. | Patient-fillable and non-invasive hypodermic injection device assembly |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US6090591A (en) | 1987-07-31 | 2000-07-18 | The Board Of Trustees Of The Leland Stanford Junior University | Selective amplification of target polynucleotide sequences |
| IE72468B1 (en) | 1987-07-31 | 1997-04-09 | Univ Leland Stanford Junior | Selective amplification of target polynucleotide sequences |
| WO1989006700A1 (en) | 1988-01-21 | 1989-07-27 | Genentech, Inc. | Amplification and detection of nucleic acid sequences |
| CA1340807C (en) | 1988-02-24 | 1999-11-02 | Lawrence T. Malek | Nucleic acid amplification process |
| JP2650159B2 (en) | 1988-02-24 | 1997-09-03 | アクゾ・ノベル・エヌ・ベー | Nucleic acid amplification method |
| WO1989007947A1 (en) | 1988-03-04 | 1989-09-08 | Cancer Research Campaign Technology Limited | Improvements relating to antigens |
| US5339163A (en) | 1988-03-16 | 1994-08-16 | Canon Kabushiki Kaisha | Automatic exposure control device using plural image plane detection areas |
| FI895955A7 (en) | 1988-04-15 | 1989-12-13 | Protein Design Labs Inc | IL-2 receptor-specific "chimeric" antibodies |
| US5168038A (en) | 1988-06-17 | 1992-12-01 | The Board Of Trustees Of The Leland Stanford Junior University | In situ transcription in cells and tissues |
| US5021335A (en) | 1988-06-17 | 1991-06-04 | The Board Of Trustees Of The Leland Stanford Junior University | In situ transcription in cells and tissues |
| US5130238A (en) | 1988-06-24 | 1992-07-14 | Cangene Corporation | Enhanced nucleic acid amplification process |
| US5759802A (en) | 1988-10-26 | 1998-06-02 | Tonen Corporation | Production of human serum alubumin A |
| FR2638359A1 (en) | 1988-11-03 | 1990-05-04 | Tino Dalto | SYRINGE GUIDE WITH ADJUSTMENT OF DEPTH DEPTH OF NEEDLE IN SKIN |
| US5262530A (en) | 1988-12-21 | 1993-11-16 | Applied Biosystems, Inc. | Automated system for polynucleotide synthesis and purification |
| US5047524A (en) | 1988-12-21 | 1991-09-10 | Applied Biosystems, Inc. | Automated system for polynucleotide synthesis and purification |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6867195B1 (en) | 1989-03-21 | 2005-03-15 | Vical Incorporated | Lipid-mediated polynucleotide administration to reduce likelihood of subject's becoming infected |
| US5693622A (en) | 1989-03-21 | 1997-12-02 | Vical Incorporated | Expression of exogenous polynucleotide sequences cardiac muscle of a mammal |
| AU5344190A (en) | 1989-03-21 | 1990-10-22 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
| US6214804B1 (en) | 1989-03-21 | 2001-04-10 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| US6673776B1 (en) | 1989-03-21 | 2004-01-06 | Vical Incorporated | Expression of exogenous polynucleotide sequences in a vertebrate, mammal, fish, bird or human |
| US5012818A (en) | 1989-05-04 | 1991-05-07 | Joishy Suresh K | Two in one bone marrow surgical needle |
| IE66597B1 (en) | 1989-05-10 | 1996-01-24 | Akzo Nv | Method for the synthesis of ribonucleic acid (RNA) |
| US5332671A (en) | 1989-05-12 | 1994-07-26 | Genetech, Inc. | Production of vascular endothelial cell growth factor and DNA encoding same |
| US5240855A (en) | 1989-05-12 | 1993-08-31 | Pioneer Hi-Bred International, Inc. | Particle gun |
| CA2020958C (en) | 1989-07-11 | 2005-01-11 | Daniel L. Kacian | Nucleic acid sequence amplification methods |
| US5545522A (en) | 1989-09-22 | 1996-08-13 | Van Gelder; Russell N. | Process for amplifying a target polynucleotide sequence using a single primer-promoter complex |
| FR2740360B1 (en) | 1995-10-25 | 1997-12-26 | Rhone Poulenc Chimie | WATER REDISPERSABLE GRANULES COMPRISING AN ACTIVE MATERIAL IN LIQUID FORM |
| NO904633L (en) | 1989-11-09 | 1991-05-10 | Molecular Diagnostics Inc | AMPLIFICATION OF NUCLEIC ACIDS BY TRANSCRIPABLE HAIRNEL PROBE. |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5215899A (en) | 1989-11-09 | 1993-06-01 | Miles Inc. | Nucleic acid amplification employing ligatable hairpin probe and transcription |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5633076A (en) | 1989-12-01 | 1997-05-27 | Pharming Bv | Method of producing a transgenic bovine or transgenic bovine embryo |
| US5697901A (en) | 1989-12-14 | 1997-12-16 | Elof Eriksson | Gene delivery by microneedle injection |
| US5194370A (en) | 1990-05-16 | 1993-03-16 | Life Technologies, Inc. | Promoter ligation activated transcription amplification of nucleic acid sequences |
| AU649066B2 (en) | 1990-07-25 | 1994-05-12 | Syngene, Inc. | Circular extension for generating multiple nucleic acid complements |
| US5489677A (en) | 1990-07-27 | 1996-02-06 | Isis Pharmaceuticals, Inc. | Oligonucleoside linkages containing adjacent oxygen and nitrogen atoms |
| US5190521A (en) | 1990-08-22 | 1993-03-02 | Tecnol Medical Products, Inc. | Apparatus and method for raising a skin wheal and anesthetizing skin |
| US6140496A (en) | 1990-10-09 | 2000-10-31 | Benner; Steven Albert | Precursors for deoxyribonucleotides containing non-standard nucleosides |
| US5527288A (en) | 1990-12-13 | 1996-06-18 | Elan Medical Technologies Limited | Intradermal drug delivery device and method for intradermal delivery of drugs |
| US6100024A (en) | 1991-02-08 | 2000-08-08 | Promega Corporation | Methods and compositions for nucleic acid detection by target extension and probe amplification |
| EP0610201B2 (en) | 1991-03-18 | 2007-09-26 | New York University | Monoclonal and chimeric antibodies specific for human tumor necrosis factor |
| US5426180A (en) | 1991-03-27 | 1995-06-20 | Research Corporation Technologies, Inc. | Methods of making single-stranded circular oligonucleotides |
| ES2134212T3 (en) | 1991-04-25 | 1999-10-01 | Chugai Pharmaceutical Co Ltd | HUMAN ANTIBODY RECONSTITUTED AGAINST THE RECEIVER OF INTERLEUKIN 6 HUMAN. |
| US5169766A (en) | 1991-06-14 | 1992-12-08 | Life Technologies, Inc. | Amplification of nucleic acid molecules |
| US5199441A (en) | 1991-08-20 | 1993-04-06 | Hogle Hugh H | Fine needle aspiration biopsy apparatus and method |
| GB9118204D0 (en) | 1991-08-23 | 1991-10-09 | Weston Terence E | Needle-less injector |
| SE9102652D0 (en) | 1991-09-13 | 1991-09-13 | Kabi Pharmacia Ab | INJECTION NEEDLE ARRANGEMENT |
| US5298422A (en) | 1991-11-06 | 1994-03-29 | Baylor College Of Medicine | Myogenic vector systems |
| US5824307A (en) | 1991-12-23 | 1998-10-20 | Medimmune, Inc. | Human-murine chimeric antibodies against respiratory syncytial virus |
| JPH07503372A (en) | 1992-01-23 | 1995-04-13 | バイカル・インコーポレイテッド | In vitro gene transfer |
| US5328483A (en) | 1992-02-27 | 1994-07-12 | Jacoby Richard M | Intradermal injection device with medication and needle guard |
| JP3368603B2 (en) | 1992-02-28 | 2003-01-20 | オリンパス光学工業株式会社 | Gene therapy treatment device |
| US6174666B1 (en) | 1992-03-27 | 2001-01-16 | The United States Of America As Represented By The Department Of Health And Human Services | Method of eliminating inhibitory/instability regions from mRNA |
| US6132419A (en) | 1992-05-22 | 2000-10-17 | Genetronics, Inc. | Electroporetic gene and drug therapy |
| US5514545A (en) | 1992-06-11 | 1996-05-07 | Trustees Of The University Of Pennsylvania | Method for characterizing single cells based on RNA amplification for diagnostics and therapeutics |
| US6670178B1 (en) | 1992-07-10 | 2003-12-30 | Transkaryotic Therapies, Inc. | In Vivo production and delivery of insulinotropin for gene therapy |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| WO1994003637A1 (en) | 1992-07-31 | 1994-02-17 | Syntex (Usa) Inc. | Method for introducing defined sequences at the 3' end of polynucleotides |
| US5273525A (en) | 1992-08-13 | 1993-12-28 | Btx Inc. | Injection and electroporation apparatus for drug and gene delivery |
| US5240885A (en) | 1992-09-21 | 1993-08-31 | Corning Incorporated | Rare earth-doped, stabilized cadmium halide glasses |
| US5569189A (en) | 1992-09-28 | 1996-10-29 | Equidyne Systems, Inc. | hypodermic jet injector |
| US5334144A (en) | 1992-10-30 | 1994-08-02 | Becton, Dickinson And Company | Single use disposable needleless injector |
| WO1994009838A1 (en) | 1992-11-04 | 1994-05-11 | Denver Biomaterials, Inc. | Apparatus for removal of pleural effusion fluid |
| EP0752248B1 (en) | 1992-11-13 | 2000-09-27 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
| EP0678122B1 (en) | 1993-01-12 | 1999-07-28 | Biogen, Inc. | Recombinant anti-vla4 antibody molecules |
| FR2703253B1 (en) | 1993-03-30 | 1995-06-23 | Centre Nat Rech Scient | APPLICATOR OF ELECTRIC PULSES FOR TREATING BIOLOGICAL TISSUES. |
| US7135312B2 (en) | 1993-04-15 | 2006-11-14 | University Of Rochester | Circular DNA vectors for synthesis of RNA and DNA |
| US5773244A (en) | 1993-05-19 | 1998-06-30 | Regents Of The University Of California | Methods of making circular RNA |
| US5851829A (en) | 1993-07-16 | 1998-12-22 | Dana-Farber Cancer Institute | Method of intracellular binding of target molecules |
| US5672491A (en) | 1993-09-20 | 1997-09-30 | The Leland Stanford Junior University | Recombinant production of novel polyketides |
| US6432711B1 (en) | 1993-11-03 | 2002-08-13 | Diacrin, Inc. | Embryonic stem cells capable of differentiating into desired cell lines |
| US6096503A (en) | 1993-11-12 | 2000-08-01 | The Scripps Research Institute | Method for simultaneous identification of differentially expresses mRNAs and measurement of relative concentrations |
| US7435802B2 (en) | 1994-01-25 | 2008-10-14 | Elan Pharaceuticals, Inc. | Humanized anti-VLA4 immunoglobulins |
| US5840299A (en) | 1994-01-25 | 1998-11-24 | Athena Neurosciences, Inc. | Humanized antibodies against leukocyte adhesion molecule VLA-4 |
| DE69533295T3 (en) | 1994-02-16 | 2009-07-16 | The Government Of The United States Of America, As Represented By The Secretary, The Department Of Health And Human Services | Melanoma-associated antigens, epitopes thereof and melanoma-containing vaccines |
| IL112820A0 (en) | 1994-03-07 | 1995-05-26 | Merck & Co Inc | Coordinate in vivo gene expression |
| WO1995024176A1 (en) | 1994-03-07 | 1995-09-14 | Bioject, Inc. | Ampule filling device |
| US5466220A (en) | 1994-03-08 | 1995-11-14 | Bioject, Inc. | Drug vial mixing and transfer device |
| AU704549B2 (en) | 1994-03-18 | 1999-04-29 | Lynx Therapeutics, Inc. | Oligonucleotide N3'-P5' phosphoramidates: synthesis and compounds; hybridization and nuclease resistance properties |
| WO1995026204A1 (en) | 1994-03-25 | 1995-10-05 | Isis Pharmaceuticals, Inc. | Immune stimulation by phosphorothioate oligonucleotide analogs |
| US5457041A (en) | 1994-03-25 | 1995-10-10 | Science Applications International Corporation | Needle array and method of introducing biological substances into living cells using the needle array |
| US6074642A (en) | 1994-05-02 | 2000-06-13 | Alexion Pharmaceuticals, Inc. | Use of antibodies specific to human complement component C5 for the treatment of glomerulonephritis |
| US6265635B1 (en) | 1994-05-18 | 2001-07-24 | Plantec Biotechnologie Gmbh Forschung & Entwicklung | DNA sequences coding for enzymes capable of facilitating the synthesis of linear α-1,4 glucans in plants, fungi and microorganisms |
| JPH10501136A (en) | 1994-06-02 | 1998-02-03 | カイロン コーポレイション | Nucleic acid immunization using a virus-based infection / transfection system |
| GB9412230D0 (en) | 1994-06-17 | 1994-08-10 | Celltech Ltd | Interleukin-5 specific recombiant antibodies |
| US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| EP0771208B1 (en) | 1994-08-12 | 2005-10-19 | Immunomedics, Inc. | Immunoconjugates and humanized antibodies specific for b-cell lymphoma and leukemia cells |
| US5641665A (en) | 1994-11-28 | 1997-06-24 | Vical Incorporated | Plasmids suitable for IL-2 expression |
| US5665545A (en) | 1994-11-28 | 1997-09-09 | Akzo Nobel N.V. | Terminal repeat amplification method |
| US5588960A (en) | 1994-12-01 | 1996-12-31 | Vidamed, Inc. | Transurethral needle delivery device with cystoscope and method for treatment of urinary incontinence |
| US5807718A (en) | 1994-12-02 | 1998-09-15 | The Scripps Research Institute | Enzymatic DNA molecules |
| US6057494A (en) | 1995-01-06 | 2000-05-02 | Centrum Voor Plantenveredelings-En Reproduktieonderzoek | DNA sequences encoding carbohydrate polymer synthesizing enzymes and method for producing transgenic plants |
| US5599302A (en) | 1995-01-09 | 1997-02-04 | Medi-Ject Corporation | Medical injection system and method, gas spring thereof and launching device using gas spring |
| US5795587A (en) | 1995-01-23 | 1998-08-18 | University Of Pittsburgh | Stable lipid-comprising drug delivery complexes and methods for their production |
| US5824497A (en) | 1995-02-10 | 1998-10-20 | Mcmaster University | High efficiency translation of mRNA molecules |
| DE69629326D1 (en) | 1995-02-15 | 2003-09-11 | Joseph Eldor | Spinal needle with several holes |
| EP0735144B1 (en) | 1995-03-28 | 2002-06-05 | Japan Science and Technology Corporation | Method for molecular indexing of genes using restriction enzymes |
| US5869230A (en) | 1995-03-30 | 1999-02-09 | Beth Israel Hospital Association | Gene transfer into the kidney |
| US5986054A (en) | 1995-04-28 | 1999-11-16 | The Hospital For Sick Children, Hsc Research And Development Limited Partnership | Genetic sequences and proteins related to alzheimer's disease |
| FR2733762B1 (en) | 1995-05-02 | 1997-08-01 | Genset Sa | METHOD FOR THE SPECIFIC COUPLING OF THE HAIR OF THE 5 'END OF A RNAM FRAGMENT AND PREPARATION OF RNAM AND COMPLETE DNA |
| US5700642A (en) | 1995-05-22 | 1997-12-23 | Sri International | Oligonucleotide sizing using immobilized cleavable primers |
| US5730723A (en) | 1995-10-10 | 1998-03-24 | Visionary Medical Products Corporation, Inc. | Gas pressured needle-less injection device and method |
| US6111095A (en) | 1995-06-07 | 2000-08-29 | Merck & Co., Inc. | Capped synthetic RNA, analogs, and aptamers |
| US6051429A (en) | 1995-06-07 | 2000-04-18 | Life Technologies, Inc. | Peptide-enhanced cationic lipid transfections |
| US5889136A (en) | 1995-06-09 | 1999-03-30 | The Regents Of The University Of Colorado | Orthoester protecting groups in RNA synthesis |
| US5766903A (en) | 1995-08-23 | 1998-06-16 | University Technology Corporation | Circular RNA and uses thereof |
| US6265389B1 (en) | 1995-08-31 | 2001-07-24 | Alkermes Controlled Therapeutics, Inc. | Microencapsulation and sustained release of oligonucleotides |
| WO1997011085A1 (en) | 1995-09-19 | 1997-03-27 | University Of Massachusetts | Inhibited biological degradation of oligodeoxynucleotides |
| US5830879A (en) | 1995-10-02 | 1998-11-03 | St. Elizabeth's Medical Center Of Boston, Inc. | Treatment of vascular injury using vascular endothelial growth factor |
| US6265387B1 (en) | 1995-10-11 | 2001-07-24 | Mirus, Inc. | Process of delivering naked DNA into a hepatocyte via bile duct |
| US6132988A (en) | 1995-10-27 | 2000-10-17 | Takeda Chemical Industries, Ltd. | DNA encoding a neuronal cell-specific receptor protein |
| CU22584A1 (en) | 1995-11-17 | 1999-11-03 | Centro Inmunologia Molecular | PHARMACEUTICAL COMPOSITIONS CONTAINING A MONOCLONAL ANTIBODY THAT RECOGNIZES THE CD6 HUMAN LEUKOCYTARY DIFFERENTIATION ANTIGEN AND ITS USES FOR THE DIAGNOSIS AND TREATMENT OF PSORIASIS |
| US6090382A (en) | 1996-02-09 | 2000-07-18 | Basf Aktiengesellschaft | Human antibodies that bind human TNFα |
| US5962271A (en) | 1996-01-03 | 1999-10-05 | Cloutech Laboratories, Inc. | Methods and compositions for generating full-length cDNA having arbitrary nucleotide sequence at the 3'-end |
| US5893397A (en) | 1996-01-12 | 1999-04-13 | Bioject Inc. | Medication vial/syringe liquid-transfer apparatus |
| US6395292B2 (en) | 1996-02-02 | 2002-05-28 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| US6261584B1 (en) | 1996-02-02 | 2001-07-17 | Alza Corporation | Sustained delivery of an active agent using an implantable system |
| AU1874397A (en) | 1996-02-16 | 1997-09-02 | Stichting Rega Vzw | Hexitol containing oligonucleotides and their use in antisense strategies |
| US6534312B1 (en) | 1996-02-22 | 2003-03-18 | Merck & Co., Inc. | Vaccines comprising synthetic genes |
| US6090391A (en) | 1996-02-23 | 2000-07-18 | Aviron | Recombinant tryptophan mutants of influenza |
| US6300487B1 (en) | 1996-03-19 | 2001-10-09 | Cell Therapuetics, Inc. | Mammalian lysophosphatidic acid acyltransferase |
| SE9601245D0 (en) | 1996-03-29 | 1996-03-29 | Pharmacia Ab | Chimeric superantigens and their use |
| TW517061B (en) | 1996-03-29 | 2003-01-11 | Pharmacia & Amp Upjohn Ab | Modified/chimeric superantigens and their use |
| GB9607549D0 (en) | 1996-04-11 | 1996-06-12 | Weston Medical Ltd | Spring-powered dispensing device |
| US5712127A (en) | 1996-04-29 | 1998-01-27 | Genescape Inc. | Subtractive amplification |
| US5853719A (en) | 1996-04-30 | 1998-12-29 | Duke University | Methods for treating cancers and pathogen infections using antigen-presenting cells loaded with RNA |
| US7329741B2 (en) | 1996-06-05 | 2008-02-12 | Chiron Corporation | Polynucleotides that hybridize to DP-75 and their use |
| WO1997046680A1 (en) | 1996-06-05 | 1997-12-11 | Chiron Corporation | Dna encoding dp. 75 and a process for its use |
| EP0912607A2 (en) | 1996-06-21 | 1999-05-06 | Merck & Co., Inc. | Vaccines comprising synthetic genes |
| EP0925088A2 (en) | 1996-06-28 | 1999-06-30 | Sontra Medical, L.P. | Ultrasound enhancement of transdermal transport |
| US5677124A (en) | 1996-07-03 | 1997-10-14 | Ambion, Inc. | Ribonuclease resistant viral RNA standards |
| US5939262A (en) | 1996-07-03 | 1999-08-17 | Ambion, Inc. | Ribonuclease resistant RNA preparation and utilization |
| US7288266B2 (en) | 1996-08-19 | 2007-10-30 | United States Of America As Represented By The Secretary, Department Of Health And Human Services | Liposome complexes for increased systemic delivery |
| US5849546A (en) | 1996-09-13 | 1998-12-15 | Epicentre Technologies Corporation | Methods for using mutant RNA polymerases with reduced discrimination between non-canonical and canonical nucleoside triphosphates |
| US6114148C1 (en) | 1996-09-20 | 2012-05-01 | Gen Hospital Corp | High level expression of proteins |
| US6433155B1 (en) | 1996-09-24 | 2002-08-13 | Tanox, Inc. | Family of genes encoding apoptosis-related peptides, peptides encoded thereby and methods of use thereof |
| US6214966B1 (en) | 1996-09-26 | 2001-04-10 | Shearwater Corporation | Soluble, degradable poly(ethylene glycol) derivatives for controllable release of bound molecules into solution |
| EP0930893B1 (en) | 1996-10-11 | 2005-04-13 | The Regents of The University of California | Immunostimulatory polynucleotide/immunomodulatory molecule conjugates |
| EP0839912A1 (en) | 1996-10-30 | 1998-05-06 | Instituut Voor Dierhouderij En Diergezondheid (Id-Dlo) | Infectious clones of RNA viruses and vaccines and diagnostic assays derived thereof |
| GB9623051D0 (en) | 1996-11-06 | 1997-01-08 | Schacht Etienne H | Delivery of DNA to target cells in biological systems |
| US5980887A (en) | 1996-11-08 | 1999-11-09 | St. Elizabeth's Medical Center Of Boston | Methods for enhancing angiogenesis with endothelial progenitor cells |
| US6143559A (en) * | 1996-11-18 | 2000-11-07 | Arch Development Corporation | Methods for the production of chicken monoclonal antibodies |
| US5759179A (en) | 1996-12-31 | 1998-06-02 | Johnson & Johnson Medical, Inc. | Needle and valve assembly for use with a catheter |
| ES2268763T3 (en) | 1997-01-21 | 2007-03-16 | The General Hospital Corporation | SELECTION OF PROTEINS USING ARN-PROTEIN FUSIONS. |
| EP0855184A1 (en) | 1997-01-23 | 1998-07-29 | Grayson B. Dr. Lipford | Pharmaceutical composition comprising a polynucleotide and an antigen especially for vaccination |
| US6696291B2 (en) | 1997-02-07 | 2004-02-24 | Merck & Co., Inc. | Synthetic HIV gag genes |
| US6228640B1 (en) | 1997-02-07 | 2001-05-08 | Cem Cezayirli | Programmable antigen presenting cell of CD34 lineage |
| JP2001512308A (en) | 1997-02-07 | 2001-08-21 | メルク エンド カンパニー インコーポレーテッド | Synthetic HIV GAG gene |
| US6251665B1 (en) | 1997-02-07 | 2001-06-26 | Cem Cezayirli | Directed maturation of stem cells and production of programmable antigen presenting dentritic cells therefrom |
| US6406705B1 (en) | 1997-03-10 | 2002-06-18 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant |
| US6306393B1 (en) | 1997-03-24 | 2001-10-23 | Immunomedics, Inc. | Immunotherapy of B-cell malignancies using anti-CD22 antibodies |
| US6261281B1 (en) | 1997-04-03 | 2001-07-17 | Electrofect As | Method for genetic immunization and introduction of molecules into skeletal muscle and immune cells |
| US5914269A (en) | 1997-04-04 | 1999-06-22 | Isis Pharmaceuticals, Inc. | Oligonucleotide inhibition of epidermal growth factor receptor expression |
| AU6972798A (en) | 1997-04-18 | 1998-11-13 | University Of Medicine And Dentistry Of New Jersey | Inhibition of hiv-1 replication by a tat rna-binding domain peptide analog |
| US5958688A (en) | 1997-04-28 | 1999-09-28 | The Trustees Of The University Of Pennsylvania | Characterization of mRNA patterns in neurites and single cells for medical diagnosis and therapeutics |
| US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5989911A (en) | 1997-05-09 | 1999-11-23 | University Of Massachusetts | Site-specific synthesis of pseudouridine in RNA |
| US5993412A (en) | 1997-05-19 | 1999-11-30 | Bioject, Inc. | Injection apparatus |
| US6124091A (en) | 1997-05-30 | 2000-09-26 | Research Corporation Technologies, Inc. | Cell growth-controlling oligonucleotides |
| EP0986572B2 (en) | 1997-06-06 | 2007-06-13 | Dynavax Technologies Corporation | Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof |
| US6589940B1 (en) | 1997-06-06 | 2003-07-08 | Dynavax Technologies Corporation | Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof |
| WO1999001579A1 (en) | 1997-07-01 | 1999-01-14 | Isis Pharmaceuticals, Inc. | Compositions and methods for the delivery of oligonucleotides via the alimentary canal |
| US5994511A (en) | 1997-07-02 | 1999-11-30 | Genentech, Inc. | Anti-IgE antibodies and methods of improving polypeptides |
| WO1999004820A2 (en) | 1997-07-21 | 1999-02-04 | Pharmacia & Upjohn Ab | Cytolysis of target cells by superantigen conjugates inducing t-cell activation |
| WO1999006073A1 (en) | 1997-07-31 | 1999-02-11 | St. Elizabeth's Medical Center Of Boston, Inc. | Method for the treatment of grafts |
| PT2044950E (en) | 1997-09-18 | 2012-09-18 | Univ Pennsylvania | Attenuated vif dna immunization cassettes for genetic vaccines |
| US20030083272A1 (en) | 1997-09-19 | 2003-05-01 | Lahive & Cockfield, Llp | Sense mrna therapy |
| US6004573A (en) | 1997-10-03 | 1999-12-21 | Macromed, Inc. | Biodegradable low molecular weight triblock poly(lactide-co-glycolide) polyethylene glycol copolymers having reverse thermal gelation properties |
| CA2305785A1 (en) | 1997-10-07 | 1999-04-15 | University Of Maryland Biotechnology Institute | Method for introducing and expressing rna in animal cells |
| CN1179048C (en) | 1997-10-20 | 2004-12-08 | Gtc生物治疗学公司 | Modified MSP-1 nucleic acid sequences and methods for increasing mRNA levels and protein expression in cellular systems |
| US6019747A (en) | 1997-10-21 | 2000-02-01 | I-Flow Corporation | Spring-actuated infusion syringe |
| JP2001520889A (en) | 1997-10-24 | 2001-11-06 | バレンティス,インコーポレイティド | Methods for preparing polynucleotide transfection complexes |
| JP2001523480A (en) | 1997-11-20 | 2001-11-27 | バイカル インコーポレイテッド | Treatment of cancer with cytokine-expressed polynucleotides and their compositions |
| US7655777B2 (en) | 1997-11-24 | 2010-02-02 | Monsanto Technology Llc | Nucleic acid molecules associated with the tocopherol pathway |
| US6517869B1 (en) | 1997-12-12 | 2003-02-11 | Expression Genetics, Inc. | Positively charged poly(alpha-(omega-aminoalkyl)lycolic acid) for the delivery of a bioactive agent via tissue and cellular uptake |
| WO1999029758A1 (en) | 1997-12-12 | 1999-06-17 | Samyang Corporation | Positively-charged poly[alpha-(omega-aminoalkyl)glycolic acid] for the delivery of a bioactive agent via tissue and cellular uptake |
| JP2002500010A (en) | 1997-12-23 | 2002-01-08 | カイロン コーポレイション | Human Genes and Gene Expression Products I |
| US6383811B2 (en) | 1997-12-30 | 2002-05-07 | Mirus Corporation | Polyampholytes for delivering polyions to a cell |
| US6835393B2 (en) | 1998-01-05 | 2004-12-28 | University Of Washington | Enhanced transport using membrane disruptive agents |
| JP2002500075A (en) | 1998-01-08 | 2002-01-08 | ソントラ メディカル, インコーポレイテッド | Transdermal transport enhanced by ultrasound transmission |
| US8287483B2 (en) | 1998-01-08 | 2012-10-16 | Echo Therapeutics, Inc. | Method and apparatus for enhancement of transdermal transport |
| IT1298087B1 (en) | 1998-01-08 | 1999-12-20 | Fiderm S R L | DEVICE FOR CHECKING THE PENETRATION DEPTH OF A NEEDLE, IN PARTICULAR APPLICABLE TO A SYRINGE FOR INJECTIONS |
| US6365346B1 (en) | 1998-02-18 | 2002-04-02 | Dade Behring Inc. | Quantitative determination of nucleic acid amplification products |
| US5955310A (en) | 1998-02-26 | 1999-09-21 | Novo Nordisk Biotech, Inc. | Methods for producing a polypeptide in a bacillus cell |
| US6432925B1 (en) | 1998-04-16 | 2002-08-13 | John Wayne Cancer Institute | RNA cancer vaccine and methods for its use |
| US6429301B1 (en) | 1998-04-17 | 2002-08-06 | Whitehead Institute For Biomedical Research | Use of a ribozyme to join nucleic acids and peptides |
| GB9808327D0 (en) | 1998-04-20 | 1998-06-17 | Chiron Spa | Antidiotypic compounds |
| US6395253B2 (en) | 1998-04-23 | 2002-05-28 | The Regents Of The University Of Michigan | Microspheres containing condensed polyanionic bioactive agents and methods for their production |
| EP2116600B1 (en) | 1998-04-23 | 2013-09-18 | Takara Bio Inc. | Method for synthesizing DNA |
| US20020064517A1 (en) | 1998-04-30 | 2002-05-30 | Stewart A. Cederholm-Williams | Fibrin sealant as a transfection/transformation vehicle for gene therapy |
| US20090208418A1 (en) | 2005-04-29 | 2009-08-20 | Innexus Biotechnology Internaltional Ltd. | Superantibody synthesis and use in detection, prevention and treatment of disease |
| CA2329147A1 (en) | 1998-05-20 | 1999-11-25 | Feng Liu | A hepatocyte targeting polyethylene glyco-grafted poly-l-lysine polymeric gene carrier |
| US6503231B1 (en) | 1998-06-10 | 2003-01-07 | Georgia Tech Research Corporation | Microneedle device for transport of molecules across tissue |
| US7091192B1 (en) | 1998-07-01 | 2006-08-15 | California Institute Of Technology | Linear cyclodextrin copolymers |
| EP1117720A4 (en) | 1998-07-13 | 2001-11-14 | Expression Genetics Inc | Polyester analogue of poly-l-lysine as a soluble, biodegradable gene delivery carrier |
| US6222030B1 (en) | 1998-08-03 | 2001-04-24 | Agilent Technologies, Inc. | Solid phase synthesis of oligonucleotides using carbonate protecting groups and alpha-effect nucleophile deprotection |
| KR101023367B1 (en) | 1998-08-11 | 2011-03-18 | 바이오겐 아이덱 인크. | Drugs Comprising Anti-CD20 Antibodies for Treating Cell-Cell Lymphomas |
| GB9817662D0 (en) | 1998-08-13 | 1998-10-07 | Crocker Peter J | Substance delivery |
| US20090148906A1 (en) | 1998-09-29 | 2009-06-11 | Shire Human Genetic Therapies, Inc. A Delaware Corporation | Optimized messenger rna |
| US6924365B1 (en) | 1998-09-29 | 2005-08-02 | Transkaryotic Therapies, Inc. | Optimized messenger RNA |
| EP1133513A4 (en) | 1998-11-03 | 2002-07-03 | Univ Yale | MOLECULAR SENSORS CONSISTING OF SEVERAL DOMAINS OF POLYNUCLEOTIDES |
| ES2338287T3 (en) | 1998-11-09 | 2010-05-05 | Biogen Idec Inc. | TREATMENT OF ANTI-CD20 PATIENTS ANTIBODIES RECEIVING TRANSPLANTS OF OSEA MEDULA GRAFT OR MOTHER PERIPHERAL BLOOD CELLS. |
| EP2055313B1 (en) | 1998-11-09 | 2015-04-29 | Biogen Idec Inc. | Treatment of hematologic malignancies associated with circulating tumor cells using chimeric anti-CD20 antibody |
| WO2000027340A2 (en) | 1998-11-12 | 2000-05-18 | The Children's Medical Center Corporation | USE OF t-RNA AND FRAGMENTS FOR INHIBITING ANGIOGENESIS AND COMPOSITIONS THEREOF |
| US6210931B1 (en) | 1998-11-30 | 2001-04-03 | The United States Of America As Represented By The Secretary Of Agriculture | Ribozyme-mediated synthesis of circular RNA |
| US20040171980A1 (en) | 1998-12-18 | 2004-09-02 | Sontra Medical, Inc. | Method and apparatus for enhancement of transdermal transport |
| WO2000039327A1 (en) | 1998-12-23 | 2000-07-06 | Human Genome Sciences, Inc. | Peptidoglycan recognition proteins |
| CA2364921A1 (en) | 1999-02-22 | 2000-08-31 | European Molecular Biology Laboratory | Translation system |
| US6255476B1 (en) | 1999-02-22 | 2001-07-03 | Pe Corporation (Ny) | Methods and compositions for synthesis of labelled oligonucleotides and analogs on solid-supports |
| US7629311B2 (en) | 1999-02-24 | 2009-12-08 | Edward Lewis Tobinick | Methods to facilitate transmission of large molecules across the blood-brain, blood-eye, and blood-nerve barriers |
| JP2002537102A (en) | 1999-02-26 | 2002-11-05 | カイロン コーポレイション | Microemulsion with adsorbed polymer and fine particles |
| WO2000029561A2 (en) | 1999-03-29 | 2000-05-25 | Statens Serum Institut | Nucleotide construct with optimised codons for an hiv genetic vaccine based on a primary, early hiv isolate and synthetic envelope |
| US7217762B1 (en) | 1999-04-09 | 2007-05-15 | Invitrogen Corporation | Process for the preparation of monodisperse polymer particles |
| EP1637160A3 (en) | 1999-05-07 | 2006-05-03 | Genentech, Inc. | Treatment of autoimmune diseases with antagonists which bind to B cell surface markers |
| KR20020011985A (en) | 1999-05-07 | 2002-02-09 | 파르마솔 게엠베하 | Lipid particles on the basis of mixtures of liquid and solid lipids and method for producing same |
| US6346382B1 (en) | 1999-06-01 | 2002-02-12 | Vanderbilt University | Human carbamyl phosphate synthetase I polymorphism and diagnostic methods related thereto |
| US6743211B1 (en) | 1999-11-23 | 2004-06-01 | Georgia Tech Research Corporation | Devices and methods for enhanced microneedle penetration of biological barriers |
| US6611707B1 (en) | 1999-06-04 | 2003-08-26 | Georgia Tech Research Corporation | Microneedle drug delivery device |
| WO2000075356A1 (en) | 1999-06-04 | 2000-12-14 | Lin Shi Lung | Rna polymerase chain reaction |
| US6303573B1 (en) | 1999-06-07 | 2001-10-16 | The Burnham Institute | Heart homing peptides and methods of using same |
| AU776268B2 (en) | 1999-06-08 | 2004-09-02 | Aventis Pasteur | Immunostimulant oligonucleotide |
| EP2289551A1 (en) | 1999-06-09 | 2011-03-02 | Immunomedics, Inc. | Immunotherapy of autoimmune disorders using antibodies which target B-cells |
| US6949245B1 (en) | 1999-06-25 | 2005-09-27 | Genentech, Inc. | Humanized anti-ErbB2 antibodies and treatment with anti-ErbB2 antibodies |
| BR0012099A (en) | 1999-06-30 | 2003-07-29 | Advanced Cell Tech Inc | Cytoplasmic transfer to de-differentiate recipient cells |
| US6514948B1 (en) | 1999-07-02 | 2003-02-04 | The Regents Of The University Of California | Method for enhancing an immune response |
| BR0012325A (en) | 1999-07-09 | 2002-05-21 | American Home Prod | Methods and compositions for preventing the formation of abnormal RNA during the transcription of a plasmid sequence |
| US8557244B1 (en) | 1999-08-11 | 2013-10-15 | Biogen Idec Inc. | Treatment of aggressive non-Hodgkins lymphoma with anti-CD20 antibody |
| KR20020047132A (en) | 1999-08-24 | 2002-06-21 | 메다렉스, 인코포레이티드 | Human ctla-4 antibodies and their uses |
| US20050112141A1 (en) | 2000-08-30 | 2005-05-26 | Terman David S. | Compositions and methods for treatment of neoplastic disease |
| US20040106567A1 (en) | 1999-09-07 | 2004-06-03 | Hagstrom James E. | Intravascular delivery of non-viral nucleic acid |
| EP1818409A1 (en) | 1999-09-09 | 2007-08-15 | CureVac GmbH | Transfer of mRNAusing polycationic compounds |
| AU7398200A (en) | 1999-09-17 | 2001-04-24 | Aventis Pasteur Limited | Chlamydia antigens and corresponding dna fragments and uses thereof |
| US6623457B1 (en) | 1999-09-22 | 2003-09-23 | Becton, Dickinson And Company | Method and apparatus for the transdermal administration of a substance |
| WO2002064799A2 (en) | 1999-09-28 | 2002-08-22 | Transkaryotic Therapies, Inc. | Optimized messenger rna |
| IL148922A0 (en) | 1999-10-06 | 2002-09-12 | Quark Biotech Inc | Method for enrichment of natural antisense messenger rna |
| US7060291B1 (en) | 1999-11-24 | 2006-06-13 | Transave, Inc. | Modular targeted liposomal delivery system |
| US6613026B1 (en) | 1999-12-08 | 2003-09-02 | Scimed Life Systems, Inc. | Lateral needle-less injection apparatus and method |
| US6277974B1 (en) | 1999-12-14 | 2001-08-21 | Cogent Neuroscience, Inc. | Compositions and methods for diagnosing and treating conditions, disorders, or diseases involving cell death |
| US6245929B1 (en) | 1999-12-20 | 2001-06-12 | General Electric Company | Catalyst composition and method for producing diaryl carbonates, using bisphosphines |
| JP4758583B2 (en) | 1999-12-22 | 2011-08-31 | バセル テクノロジー カンパニー ビー.ブイ. | Alpha-olefin polymerization catalyst system containing aromatic silane compound |
| WO2001051092A2 (en) | 2000-01-07 | 2001-07-19 | University Of Washington | Enhanced transport of agents using membrane disruptive agents |
| WO2001051661A2 (en) | 2000-01-13 | 2001-07-19 | Amsterdam Support Diagnostics B.V. | A universal nucleic acid amplification system for nucleic acids in a sample |
| AU2001231245A1 (en) | 2000-01-31 | 2001-08-07 | The Regents Of The University Of California | Immunomodulatory polynucleotides in treatment of an infection by an intracellular pathogen |
| CA2395811A1 (en) | 2000-01-31 | 2001-08-02 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
| WO2001062827A2 (en) | 2000-02-22 | 2001-08-30 | Shearwater Corporation | N-maleimidyl polymer derivatives |
| WO2001062801A2 (en) | 2000-02-24 | 2001-08-30 | Washington University | Humanized antibodies that sequester amyloid beta peptide |
| BR0108962A (en) | 2000-03-03 | 2002-12-24 | Valentis Inc | Nucleic acid formulations for gene distribution and methods of use |
| WO2001075166A2 (en) | 2000-03-31 | 2001-10-11 | Genentech, Inc. | Compositions and methods for detecting and quantifying gene expression |
| BR0109705A (en) | 2000-03-31 | 2005-01-11 | Idec Pharma Corp | Combined use of anti-cytokine and anticd20 antibodies or antagonists for the treatment of B-cell lymphoma |
| US6565572B2 (en) | 2000-04-10 | 2003-05-20 | Sdgi Holdings, Inc. | Fenestrated surgical screw and method |
| US6368801B1 (en) | 2000-04-12 | 2002-04-09 | Molecular Staging, Inc. | Detection and amplification of RNA using target-mediated ligation of DNA by RNA ligase |
| JP2003530838A (en) | 2000-04-12 | 2003-10-21 | ヒューマン ゲノム サイエンシズ インコーポレイテッド | Albumin fusion protein |
| US20010046496A1 (en) | 2000-04-14 | 2001-11-29 | Brettman Lee R. | Method of administering an antibody |
| US6375972B1 (en) | 2000-04-26 | 2002-04-23 | Control Delivery Systems, Inc. | Sustained release drug delivery devices, methods of use, and methods of manufacturing thereof |
| US7871598B1 (en) | 2000-05-10 | 2011-01-18 | Novartis Ag | Stable metal ion-lipid powdered pharmaceutical compositions for drug delivery and methods of use |
| US20040229271A1 (en) | 2000-05-19 | 2004-11-18 | Williams Richard B. | Compositions and methods for the identification and selection of nucleic acids and polypeptides |
| WO2001092523A2 (en) | 2000-05-30 | 2001-12-06 | Curagen Corporation | Human polynucleotides and polypeptides encoded thereby |
| JP2004530629A (en) | 2000-06-07 | 2004-10-07 | バイオシネクサス インコーポレーテッド | Immunostimulatory RNA / DNA hybrid molecule |
| ATE343589T1 (en) | 2000-06-23 | 2006-11-15 | Wyeth Corp | MODOFIED MORBILLIVIRUS V PROTEINS |
| US20040005667A1 (en) | 2000-07-03 | 2004-01-08 | Giuloi Ratti | Immunisation against chlamydia pneumoniae |
| US6440096B1 (en) | 2000-07-14 | 2002-08-27 | Becton, Dickinson And Co. | Microdevice and method of manufacturing a microdevice |
| BR0112637A (en) | 2000-07-21 | 2003-06-10 | Glaxo Group Ltd | Codon-optimized Papilloma Virus Sequences |
| US6902734B2 (en) | 2000-08-07 | 2005-06-07 | Centocor, Inc. | Anti-IL-12 antibodies and compositions thereof |
| US6696038B1 (en) | 2000-09-14 | 2004-02-24 | Expression Genetics, Inc. | Cationic lipopolymer as biocompatible gene delivery agent |
| US20040142474A1 (en) | 2000-09-14 | 2004-07-22 | Expression Genetics, Inc. | Novel cationic lipopolymer as a biocompatible gene delivery agent |
| AU2001290078A1 (en) | 2000-09-20 | 2002-04-02 | Ruggero Della Bitta | Stem cell therapy |
| US6733994B2 (en) | 2000-10-04 | 2004-05-11 | The Trustees Of The University Of Pennsylvania | Highly expressible genes |
| US6998115B2 (en) | 2000-10-10 | 2006-02-14 | Massachusetts Institute Of Technology | Biodegradable poly(β-amino esters) and uses thereof |
| US7202226B2 (en) | 2000-10-23 | 2007-04-10 | Detroit R & D | Augmentation of wound healing by elF-4E mRNA and EGF mRNA |
| US20030077604A1 (en) | 2000-10-27 | 2003-04-24 | Yongming Sun | Compositions and methods relating to breast specific genes and proteins |
| US20020132788A1 (en) | 2000-11-06 | 2002-09-19 | David Lewis | Inhibition of gene expression by delivery of small interfering RNA to post-embryonic animal cells in vivo |
| US7521054B2 (en) | 2000-11-17 | 2009-04-21 | The United States Of America As Represented By The Department Of Health And Human Services | Reduction of the nonspecific animal toxicity of immunotoxins by mutating the framework regions of the Fv to lower the isoelectric point |
| AU2002227365A1 (en) | 2000-12-07 | 2002-06-18 | Chiron Corporation | Endogenous retroviruses up-regulated in prostate cancer |
| US7708915B2 (en) | 2004-05-06 | 2010-05-04 | Castor Trevor P | Polymer microspheres/nanospheres and encapsulating therapeutic proteins therein |
| US20020130430A1 (en) | 2000-12-29 | 2002-09-19 | Castor Trevor Percival | Methods for making polymer microspheres/nanospheres and encapsulating therapeutic proteins and other products |
| EP1224943A1 (en) | 2001-01-19 | 2002-07-24 | Crucell Holland B.V. | Fibronectin as a tumor marker detected by phage antibodies |
| CN101921732A (en) | 2001-01-19 | 2010-12-22 | 维洛诺瓦蒂夫公司 | A virus causing respiratory tract illness in susceptible mammals |
| US20040110191A1 (en) | 2001-01-31 | 2004-06-10 | Winkler Matthew M. | Comparative analysis of nucleic acids using population tagging |
| CA2437737A1 (en) | 2001-02-14 | 2002-08-22 | Stephen D. Ginsberg | Methods and compositions of amplifying rna |
| US6652886B2 (en) | 2001-02-16 | 2003-11-25 | Expression Genetics | Biodegradable cationic copolymers of poly (alkylenimine) and poly (ethylene glycol) for the delivery of bioactive agents |
| DE10109897A1 (en) | 2001-02-21 | 2002-11-07 | Novosom Ag | Optional cationic liposomes and their use |
| US7232425B2 (en) | 2001-03-02 | 2007-06-19 | Sorenson Development, Inc. | Apparatus and method for specific interstitial or subcutaneous diffusion and dispersion of medication |
| KR100917939B1 (en) | 2001-03-09 | 2009-09-21 | 진 스트림 피티와이 리미티드 | Novel expression vectors |
| JP2002262882A (en) | 2001-03-12 | 2002-09-17 | Nisshinbo Ind Inc | RNA amplification method |
| FR2822164B1 (en) | 2001-03-19 | 2004-06-18 | Centre Nat Rech Scient | POLYPEPTIDES DERIVED FROM POLYMERASE RNAS, AND USES THEREOF |
| US6520949B2 (en) | 2001-04-02 | 2003-02-18 | Martin St. Germain | Method and apparatus for administering fluid to animals subcutaneously |
| DE10119005A1 (en) | 2001-04-18 | 2002-10-24 | Roche Diagnostics Gmbh | Process for protein expression starting from stabilized linear short DNA in cell-free in vitro transcription / translation systems with exonuclease-containing lysates or in a cellular system containing exonucleases |
| US20030171253A1 (en) | 2001-04-19 | 2003-09-11 | Averil Ma | Methods and compositions relating to modulation of A20 |
| ATE278796T1 (en) | 2001-04-23 | 2004-10-15 | Amaxa Gmbh | BUFFER SOLUTION FOR ELECTROPORATION AND METHOD COMPRISING THE USE OF THE SAME |
| US7560424B2 (en) | 2001-04-30 | 2009-07-14 | Zystor Therapeutics, Inc. | Targeted therapeutic proteins |
| US6777187B2 (en) | 2001-05-02 | 2004-08-17 | Rubicon Genomics, Inc. | Genome walking by selective amplification of nick-translate DNA library and amplification from complex mixtures of templates |
| WO2002090225A2 (en) | 2001-05-08 | 2002-11-14 | Magnatech International, L.P. | Electronic length control wire pay-off system and method |
| US20050137155A1 (en) | 2001-05-18 | 2005-06-23 | Sirna Therapeutics, Inc. | RNA interference mediated treatment of Parkinson disease using short interfering nucleic acid (siNA) |
| US8137911B2 (en) | 2001-05-22 | 2012-03-20 | Cellscript, Inc. | Preparation and use of single-stranded transcription substrates for synthesis of transcription products corresponding to target sequences |
| CA2449054C (en) | 2001-05-30 | 2011-01-04 | The Scripps Research Institute | Integrin targeting liposome for nucleic acid delivery |
| EP1903054A3 (en) | 2001-06-05 | 2008-07-23 | CureVac GmbH | Pharmaceutical compound containing a stabilised mRNA which is optimised for translation in its coded areas |
| EP1402035A2 (en) | 2001-06-18 | 2004-03-31 | Novartis AG | G-protein coupled receptors and dna sequences thereof |
| US7547551B2 (en) | 2001-06-21 | 2009-06-16 | University Of Antwerp. | Transfection of eukaryontic cells with linear polynucleotides by electroporation |
| US7785610B2 (en) | 2001-06-21 | 2010-08-31 | Dynavax Technologies Corporation | Chimeric immunomodulatory compounds and methods of using the same—III |
| EP1404716A2 (en) | 2001-06-26 | 2004-04-07 | Novartis AG | Novel g protein-coupled receptors and dna sequences thereof |
| SE0102327D0 (en) | 2001-06-28 | 2001-06-28 | Active Biotech Ab | A novel engineered superantigen for human therapy |
| US20040236092A1 (en) | 2001-07-13 | 2004-11-25 | Roman Dziarski | Peptidologlycan recognition protein encoding nucleic acids and methods of use thereof |
| US6586524B2 (en) | 2001-07-19 | 2003-07-01 | Expression Genetics, Inc. | Cellular targeting poly(ethylene glycol)-grafted polymeric gene carrier |
| ATE481497T1 (en) | 2001-08-01 | 2010-10-15 | Univ Utah | N-TERMINUS TRUNCATED ISOFORMS OF CYCLIC PHOSPHODIESTERASES PDE3A |
| JP2005502344A (en) | 2001-08-27 | 2005-01-27 | ノバルティス アクチエンゲゼルシャフト | Novel G protein coupled receptor and DNA sequence thereof |
| US20040142325A1 (en) | 2001-09-14 | 2004-07-22 | Liat Mintz | Methods and systems for annotating biomolecular sequences |
| AR045702A1 (en) | 2001-10-03 | 2005-11-09 | Chiron Corp | COMPOSITIONS OF ASSISTANTS. |
| DE10148886A1 (en) | 2001-10-04 | 2003-04-30 | Avontec Gmbh | Inhibition of STAT-1 |
| US7276489B2 (en) | 2002-10-24 | 2007-10-02 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5′ ends |
| ATE427992T1 (en) | 2001-11-14 | 2009-04-15 | Toyo Boseki | DNA SYNTHESIS PROMOTORS, DNA POLYMERASE ASSOCIATED FACTORS AND USE THEREOF |
| WO2003044482A2 (en) | 2001-11-16 | 2003-05-30 | The University Of Tennessee Research Corporation | Recombinant antibody fusion proteins and methods for detection of apoptotic cells |
| EP1454145A2 (en) | 2001-11-29 | 2004-09-08 | Novartis AG | Method for the assessment and prognosis of sarcoidosis |
| CA2409775C (en) | 2001-12-03 | 2010-07-13 | F. Hoffmann-La Roche Ag | Reversibly modified thermostable enzymes for dna synthesis and amplification in vitro |
| EP2208736A3 (en) | 2001-12-07 | 2010-10-27 | Novartis Vaccines and Diagnostics, Inc. | Endogenous retrovirus up-regulated in prostate cancer |
| CA2469049A1 (en) | 2001-12-07 | 2003-06-19 | Chiron Corporation | Endogenous retrovirus polypeptides linked to oncogenic transformation |
| US20060275747A1 (en) | 2001-12-07 | 2006-12-07 | Hardy Stephen F | Endogenous retrovirus up-regulated in prostate cancer |
| AU2002361429A1 (en) | 2001-12-17 | 2003-06-30 | Novartis Ag | Novel g-protein coupled receptors and dna sequences thereof |
| DE10162480A1 (en) | 2001-12-19 | 2003-08-07 | Ingmar Hoerr | The application of mRNA for use as a therapeutic agent against tumor diseases |
| US20050003014A1 (en) | 2001-12-21 | 2005-01-06 | Ketelson Howard Allen | Use of synthetic inorganic nanoparticles as carriers for ophthalmic and otic drugs |
| AU2003235707A1 (en) | 2002-01-18 | 2003-07-30 | Curevac Gmbh | Immunogenic preparations and vaccines on the basis of mrna |
| AU2003203079B9 (en) | 2002-02-04 | 2009-01-15 | Oncothyreon Inc. | Immunostimulatory, covalently lipidated oligonucleotides |
| CA2473144C (en) | 2002-02-05 | 2013-05-28 | Genentech, Inc. | Protein purification |
| FR2835749B1 (en) | 2002-02-08 | 2006-04-14 | Inst Nat Sante Rech Med | PHARMACEUTICAL COMPOSITION IMPROVING IN VIVO GENE TRANSFER |
| DE10207178A1 (en) | 2002-02-19 | 2003-09-04 | Novosom Ag | Components for the production of amphoteric liposomes |
| AR038568A1 (en) | 2002-02-20 | 2005-01-19 | Hoffmann La Roche | ANTI-A BETA ANTIBODIES AND ITS USE |
| US7354742B2 (en) | 2002-02-22 | 2008-04-08 | Ortho-Mcneil Pharmaceutical, Inc. | Method for generating amplified RNA |
| CA2481479C (en) | 2002-02-26 | 2012-12-11 | Maxygen, Inc. | Novel flavivirus antigens |
| WO2003075840A2 (en) | 2002-03-04 | 2003-09-18 | Imclone Systems Incorporated | Human antibodies specific to kdr and uses thereof |
| WO2003075892A1 (en) | 2002-03-13 | 2003-09-18 | Novartis Ag | Pharmaceutical microparticles |
| US7074596B2 (en) | 2002-03-25 | 2006-07-11 | Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Synthesis and use of anti-reverse mRNA cap analogues |
| AU2003230806B2 (en) | 2002-04-04 | 2009-05-07 | Zoetis Belgium S.A. | Immunostimulatory G,U-containing oligoribonucleotides |
| US7399583B2 (en) | 2002-04-17 | 2008-07-15 | Novartis Ag | Method for the identification of inhibitors of the binding of ARE-containing mRNA and a HuR protein |
| GB0209539D0 (en) | 2002-04-26 | 2002-06-05 | Avecia Ltd | Monomer Polymer and process |
| EP1361277A1 (en) | 2002-04-30 | 2003-11-12 | Centre National De La Recherche Scientifique (Cnrs) | Optimization of transgene expression in mammalian cells |
| PL224150B1 (en) | 2002-05-02 | 2016-11-30 | Wyeth Corp | Composition containing drug conjugate including the calicheamicin derivatives and the antibody, and the pharmaceutical composition containing it |
| US7374930B2 (en) | 2002-05-21 | 2008-05-20 | Expression Genetics, Inc. | GLP-1 gene delivery for the treatment of type 2 diabetes |
| US20040018525A1 (en) | 2002-05-21 | 2004-01-29 | Bayer Aktiengesellschaft | Methods and compositions for the prediction, diagnosis, prognosis, prevention and treatment of malignant neoplasma |
| DE10224200C1 (en) | 2002-05-31 | 2003-08-21 | Artus Ges Fuer Molekularbiolog | Replicating RNA, useful, after reverse transcription, for analysis on microarrays, comprises conversion to cDNA then reverse transcription of this to form antisense sequences |
| US7198899B2 (en) | 2002-06-03 | 2007-04-03 | Chiron Corporation | Use of NRG4, or inhibitors thereof, in the treatment of colon and pancreatic cancers |
| SE0201907D0 (en) | 2002-06-19 | 2002-06-19 | Atos Medical Ab | Patches for tracheostoma valves |
| WO2004002453A1 (en) | 2002-06-28 | 2004-01-08 | Protiva Biotherapeutics Ltd. | Method and apparatus for producing liposomes |
| US20040122216A1 (en) | 2002-07-01 | 2004-06-24 | Jacob Nielsen | Recombinant tissue protective cytokines and encoding nucleic acids thereof for protection, restoration, and enhancement of responsive cells, tissues, and organs |
| DE10229872A1 (en) | 2002-07-03 | 2004-01-29 | Curevac Gmbh | Immune stimulation through chemically modified RNA |
| GB0215509D0 (en) | 2002-07-04 | 2002-08-14 | Novartis Ag | Marker genes |
| AR040575A1 (en) | 2002-07-16 | 2005-04-13 | Advisys Inc | OPTIMIZED SYNTHETIC PLASMIDS IN EXPRESSION CODONS IN MAMMERS |
| CA2493808A1 (en) | 2002-07-24 | 2004-01-29 | Ptc Therapeutics, Inc. | Methods for identifying small molecules that modulate premature translation termination and nonsense mediated mrna decay |
| EP1393745A1 (en) | 2002-07-29 | 2004-03-03 | Hybridon, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5'ends |
| EP1386925A1 (en) | 2002-07-31 | 2004-02-04 | Girindus AG | Method for preparing oligonucleotides |
| US6653468B1 (en) | 2002-07-31 | 2003-11-25 | Isis Pharmaceuticals, Inc. | Universal support media for synthesis of oligomeric compounds |
| EP1873180B1 (en) | 2002-08-14 | 2014-05-07 | Novartis AG | Ophthalmic device made from a radiation-curable prepolymer |
| KR101476067B1 (en) | 2002-09-06 | 2014-12-23 | 인설트 테라페틱스, 인코퍼레이티드 | Cyclodextrin-based polymers for delivering the therapeutic agents covalently bound thereto |
| CA2497980C (en) | 2002-09-09 | 2011-06-21 | Nektar Therapeutics Al, Corporation | Method for preparing water-soluble polymer derivatives bearing a terminal carboxylic acid |
| US7534872B2 (en) | 2002-09-27 | 2009-05-19 | Syngen, Inc. | Compositions and methods for the use of FMOC derivatives in DNA/RNA synthesis |
| KR20110140142A (en) | 2002-10-17 | 2011-12-30 | 젠맵 에이/에스 | Human monoclonal antibodies against CD20 |
| EP1561814B1 (en) | 2002-10-22 | 2010-12-22 | Eisai R&D Management Co., Ltd. | Gene specifically expressed in postmitotic dopaminergic neuron precursor cells |
| AU2003297557B2 (en) | 2002-11-21 | 2009-02-26 | Cellscript, Inc. | Methods for using primers that encode one strand of a double-stranded promoter |
| US7491234B2 (en) | 2002-12-03 | 2009-02-17 | Boston Scientific Scimed, Inc. | Medical devices for delivery of therapeutic agents |
| EP2301966A1 (en) | 2002-12-16 | 2011-03-30 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| AU2003302743B2 (en) | 2002-12-23 | 2008-09-04 | Dynavax Technologies Corporation | Branched immunomodulatory compounds and methods of using the same |
| US7169892B2 (en) | 2003-01-10 | 2007-01-30 | Astellas Pharma Inc. | Lipid-peptide-polymer conjugates for long blood circulation and tumor specific drug delivery systems |
| WO2004067728A2 (en) | 2003-01-17 | 2004-08-12 | Ptc Therapeutics | Methods and systems for the identification of rna regulatory sequences and compounds that modulate their function |
| US9068234B2 (en) | 2003-01-21 | 2015-06-30 | Ptc Therapeutics, Inc. | Methods and agents for screening for compounds capable of modulating gene expression |
| US8460864B2 (en) | 2003-01-21 | 2013-06-11 | Ptc Therapeutics, Inc. | Methods for identifying compounds that modulate untranslated region-dependent gene expression and methods of using same |
| US8426194B2 (en) | 2003-01-21 | 2013-04-23 | Ptc Therapeutics, Inc. | Methods and agents for screening for compounds capable of modulating VEGF expression |
| US20040147027A1 (en) | 2003-01-28 | 2004-07-29 | Troy Carol M. | Complex for facilitating delivery of dsRNA into a cell and uses thereof |
| PT2236154T (en) | 2003-02-10 | 2018-06-26 | Biogen Ma Inc | Immunoglobulin formulation and method of preparation thereof |
| US20040167090A1 (en) | 2003-02-21 | 2004-08-26 | Monahan Sean D. | Covalent modification of RNA for in vitro and in vivo delivery |
| CA2450289A1 (en) | 2003-03-20 | 2005-05-19 | Imclone Systems Incorporated | Method of producing an antibody to epidermal growth factor receptor |
| US7320961B2 (en) | 2003-03-24 | 2008-01-22 | Abbott Laboratories | Method for treating a disease, disorder or adverse effect caused by an elevated serum concentration of an UGT1A1 substrate |
| ATE459710T1 (en) | 2003-03-25 | 2010-03-15 | Stratagene California | DNA POLYMERASE FUSIONS AND USES THEREOF |
| WO2004092329A2 (en) | 2003-04-08 | 2004-10-28 | Galenica Pharmaceuticals, Inc. | Semi-synthetic saponin analogs with carrier and immune stimulatory activities for dna and rna vaccines |
| UA91961C2 (en) | 2003-04-09 | 2010-09-27 | Дженентек, Инк. | Therapy of autoimmune disease in a patient with an inadequate response to a tnf-alpha inhibitor |
| JP2006525405A (en) | 2003-05-05 | 2006-11-09 | ベン‐グリオン ユニバーシティ オブ ザ ネゲヴ リサーチ アンド デベロップメント オーソリティ | Injectable cross-linked polymer preparations and their use |
| US7348004B2 (en) | 2003-05-06 | 2008-03-25 | Syntonix Pharmaceuticals, Inc. | Immunoglobulin chimeric monomer-dimer hybrids |
| EP3552627A1 (en) | 2003-05-06 | 2019-10-16 | Bioverativ Therapeutics Inc. | Clotting factor-fc chimeric proteins to treat hemophilia |
| TWI353991B (en) | 2003-05-06 | 2011-12-11 | Syntonix Pharmaceuticals Inc | Immunoglobulin chimeric monomer-dimer hybrids |
| US9567591B2 (en) | 2003-05-15 | 2017-02-14 | Mello Biotechnology, Inc. | Generation of human embryonic stem-like cells using intronic RNA |
| GB0313132D0 (en) | 2003-06-06 | 2003-07-09 | Ich Productions Ltd | Peptide ligands |
| EP1636385A4 (en) | 2003-06-24 | 2010-06-02 | Mirus Bio Corp | Inhibition of gene function by delivery of polynucleotide-based gene expression inhibitors to mammalian cells in vivo |
| GB0316089D0 (en) | 2003-07-09 | 2003-08-13 | Xo Bioscience Ltd | Differentiation method |
| US8592197B2 (en) | 2003-07-11 | 2013-11-26 | Novavax, Inc. | Functional influenza virus-like particles (VLPs) |
| US7575572B2 (en) | 2003-07-15 | 2009-08-18 | Spinal Generations, Llc | Method and device for delivering medicine to bone |
| US20050013870A1 (en) | 2003-07-17 | 2005-01-20 | Toby Freyman | Decellularized extracellular matrix of conditioned body tissues and uses thereof |
| DK1648998T3 (en) | 2003-07-18 | 2015-01-05 | Amgen Inc | Specific binding agents for hepatocyte growth factor |
| DE10335833A1 (en) | 2003-08-05 | 2005-03-03 | Curevac Gmbh | Transfection of blood cells with mRNA for immune stimulation and gene therapy |
| US20050048112A1 (en) | 2003-08-28 | 2005-03-03 | Jorg Breitenbach | Solid pharmaceutical dosage form |
| US8668926B1 (en) | 2003-09-15 | 2014-03-11 | Shaker A. Mousa | Nanoparticle and polymer formulations for thyroid hormone analogs, antagonists, and formulations thereof |
| US7135010B2 (en) | 2003-09-30 | 2006-11-14 | Damage Control Surgical Technologies, Inc. | Method and apparatus for rapid deployment chest drainage |
| JP2007507460A (en) | 2003-10-06 | 2007-03-29 | ノバルティス アクチエンゲゼルシャフト | Use of genetic polymorphisms associated with therapeutic efficacy in inflammatory diseases |
| US20050130201A1 (en) | 2003-10-14 | 2005-06-16 | Dharmacon, Inc. | Splint-assisted enzymatic synthesis of polyribounucleotides |
| DE10347710B4 (en) | 2003-10-14 | 2006-03-30 | Johannes-Gutenberg-Universität Mainz | Recombinant vaccines and their use |
| DE602004026470D1 (en) | 2003-11-05 | 2010-05-20 | Roche Glycart Ag | FC RECEPTOR AND EFFECTOR FUNCTION |
| WO2005047536A2 (en) | 2003-11-13 | 2005-05-26 | Novartis Ag | Detection of genomic amplification and deletion in cancer |
| US20070054278A1 (en) | 2003-11-18 | 2007-03-08 | Applera Corporation | Polymorphisms in nucleic acid molecules encoding human enzyme proteins, methods of detection and uses thereof |
| US7699852B2 (en) | 2003-11-19 | 2010-04-20 | Zimmer Spine, Inc. | Fenestrated bone tap and method |
| WO2007062495A1 (en) | 2005-11-30 | 2007-06-07 | Roy Rabindranauth Sooknanan | Selective terminal tagging of nucleic acids |
| US20050153333A1 (en) | 2003-12-02 | 2005-07-14 | Sooknanan Roy R. | Selective terminal tagging of nucleic acids |
| EP1691746B1 (en) | 2003-12-08 | 2015-05-27 | Gel-Del Technologies, Inc. | Mucoadhesive drug delivery devices and methods of making and using thereof |
| US7674884B2 (en) | 2003-12-10 | 2010-03-09 | Novimmune S.A. | Neutralizing antibodies and methods of use thereof |
| US8372966B2 (en) | 2003-12-19 | 2013-02-12 | University Of Cincinnati | Oligonucleotide decoys and methods of use |
| JP4851944B2 (en) | 2003-12-23 | 2012-01-11 | ジェネンテック, インコーポレイテッド | Novel anti-IL13 antibody and use thereof |
| EP1713514B1 (en) | 2004-01-28 | 2021-11-24 | Johns Hopkins University | Drugs and gene carrier particles that rapidly move through mucous barriers |
| ES2329807T3 (en) | 2004-01-30 | 2009-12-01 | Maxygen Holdings Ltd. | REGULATED TRANSLECTURE OF TERMINATION CODONS. |
| US7309487B2 (en) | 2004-02-09 | 2007-12-18 | George Inana | Methods and compositions for detecting and treating retinal diseases |
| CA2556027C (en) | 2004-02-12 | 2015-11-24 | Morphotek, Inc. | Monoclonal antibodies that specifically block biological activity of a tumor antigen |
| US20070265220A1 (en) * | 2004-03-15 | 2007-11-15 | City Of Hope | Methods and compositions for the specific inhibition of gene expression by double-stranded RNA |
| EP3269738A1 (en) | 2004-03-24 | 2018-01-17 | Chugai Seiyaku Kabushiki Kaisha | Subtypes of humanized antibody against interleukin-6 receptor |
| WO2005098433A2 (en) | 2004-04-01 | 2005-10-20 | Novartis Ag | Diagnostic assays for alzheimer’s disease |
| JP5848861B2 (en) | 2004-04-20 | 2016-01-27 | ジェンマブ エー/エスGenmab A/S | Human monoclonal antibody against CD20 |
| ES2246694B1 (en) | 2004-04-29 | 2007-05-01 | Instituto Cientifico Y Tecnologico De Navarra, S.A. | PEGILATED NANOPARTICLES. |
| WO2005108411A2 (en) | 2004-05-05 | 2005-11-17 | Isis Pharmaceuticals, Inc. | Substituted pixyl protecting groups for oligonucleotide synthesis |
| ES2313350T3 (en) | 2004-05-12 | 2009-03-01 | Baxter International Inc. | MICROSPHERAS OF NUCLEIC ACID, PRODUCTION AND SUPPLY OF THE SAME. |
| US8012747B2 (en) | 2004-06-01 | 2011-09-06 | San Diego State University Foundation | Expression system |
| ATE536418T1 (en) | 2004-06-07 | 2011-12-15 | Protiva Biotherapeutics Inc | LIPID ENCAPSULATED INTERFERENCE RNA |
| US7745651B2 (en) | 2004-06-07 | 2010-06-29 | Protiva Biotherapeutics, Inc. | Cationic lipids and methods of use |
| CA3075158A1 (en) | 2004-06-11 | 2005-12-29 | Trustees Of Tufts College | Silk-based drug delivery system |
| WO2006046978A2 (en) | 2004-06-28 | 2006-05-04 | Argos Therapeutics, Inc. | Cationic peptide-mediated transformation |
| WO2006005058A2 (en) | 2004-06-30 | 2006-01-12 | Nektar Therapeutics Al, Corporation | Polymer-factor ix moiety conjugates |
| DE102004035227A1 (en) | 2004-07-21 | 2006-02-16 | Curevac Gmbh | mRNA mixture for vaccination against tumor diseases |
| AU2005328382C1 (en) | 2004-07-21 | 2013-01-24 | Alnylam Pharmaceuticals, Inc. | Oligonucleotides comprising a modified or non-natural nucleobase |
| US7603349B1 (en) | 2004-07-29 | 2009-10-13 | Yahoo! Inc. | User interfaces for search systems using in-line contextual queries |
| GB0417487D0 (en) | 2004-08-05 | 2004-09-08 | Novartis Ag | Organic compound |
| SE0402025D0 (en) | 2004-08-13 | 2004-08-13 | Active Biotech Ab | Treatment of hyperproliferative disease with superantigens in combination with another anticancer agent |
| US7291208B2 (en) | 2004-08-13 | 2007-11-06 | Gore Enterprise Holdings, Inc. | Grooved active and passive adsorbent filters |
| CA2478458A1 (en) | 2004-08-20 | 2006-02-20 | Michael Panzara | Treatment of pediatric multiple sclerosis |
| DK2386640T3 (en) | 2004-08-26 | 2015-04-27 | Engeneic Molecular Delivery Pty Ltd | The making of functional nucleic acids into mammalian cells via bacterially derived intact minicells |
| DE102004042546A1 (en) | 2004-09-02 | 2006-03-09 | Curevac Gmbh | Combination therapy for immune stimulation |
| US7501486B2 (en) | 2004-09-07 | 2009-03-10 | Burnham Institute For Medical Research | Peptides that selectively home to heart vasculature and related conjugates and methods |
| US8663599B1 (en) | 2004-10-05 | 2014-03-04 | Gp Medical, Inc. | Pharmaceutical composition of nanoparticles |
| EP1811018A4 (en) | 2004-10-12 | 2007-11-28 | Tissue Targeting Japan Inc | Brain disposition marrow progenitor |
| EP2311455B1 (en) | 2004-10-13 | 2015-07-15 | PTC Therapeutics, Inc. | Compounds for nonsense suppression, and methods for their use |
| US8057821B2 (en) | 2004-11-03 | 2011-11-15 | Egen, Inc. | Biodegradable cross-linked cationic multi-block copolymers for gene delivery and methods of making thereof |
| EP1812569A2 (en) | 2004-11-08 | 2007-08-01 | K.U. Leuven Research and Development | Modified nucleosides for rna interference |
| US8946444B2 (en) | 2004-11-23 | 2015-02-03 | Ptc Therapeutics, Inc. | Tetrahydrocarbazoles as active agents for inhibiting VEGF production by translational control |
| US7964571B2 (en) | 2004-12-09 | 2011-06-21 | Egen, Inc. | Combination of immuno gene therapy and chemotherapy for treatment of cancer and hyperproliferative diseases |
| EP1856179B1 (en) | 2004-12-10 | 2013-05-15 | Kala Pharmaceuticals, Inc. | Functionalized poly (ether-anhydride) block copolymers |
| US9068969B2 (en) | 2004-12-28 | 2015-06-30 | Ptc Therapeutics, Inc. | Cell based methods and systems for the identification of RNA regulatory sequences and compounds that modulate their functions |
| US8535702B2 (en) | 2005-02-01 | 2013-09-17 | Boston Scientific Scimed, Inc. | Medical devices having porous polymeric regions for controlled drug delivery and regulated biocompatibility |
| EP2287608B1 (en) | 2005-03-11 | 2014-01-08 | Firalis SAS | Biomarkers for cardiovascular side-effects induced by cox-2 inhibitory compounds |
| US8415325B2 (en) | 2005-03-31 | 2013-04-09 | University Of Delaware | Cell-mediated delivery and targeted erosion of noncovalently crosslinked hydrogels |
| EP2083088A3 (en) | 2005-04-07 | 2009-10-14 | Novartis Vaccines and Diagnostics, Inc. | Cancer-related genes |
| AU2006235276A1 (en) | 2005-04-07 | 2006-10-19 | Novartis Vaccines And Diagnostics Inc. | CACNA1E in cancer diagnosis, detection and treatment |
| EP1885403B1 (en) | 2005-04-12 | 2013-05-08 | Nektar Therapeutics | Poly(ethyleneglycol) conjugates of Lysostaphin |
| EP2295466A3 (en) | 2005-04-25 | 2011-08-17 | Pfizer Inc. | Antibodies to myostatin |
| CA2609788A1 (en) | 2005-04-26 | 2006-11-02 | Coley Pharmaceutical Gmbh | Modified oligoribonucleotide analogs with enhanced immunostimulatory activity |
| CA3151350A1 (en) | 2005-05-09 | 2006-11-16 | E. R. Squibb & Sons, L.L.C. | Human monoclonal antibodies to programmed death 1 (pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| US20070072175A1 (en) | 2005-05-13 | 2007-03-29 | Biogen Idec Ma Inc. | Nucleotide array containing polynucleotide probes complementary to, or fragments of, cynomolgus monkey genes and the use thereof |
| US20060265771A1 (en) | 2005-05-17 | 2006-11-23 | Lewis David L | Monitoring microrna expression and function |
| DE102005023170A1 (en) | 2005-05-19 | 2006-11-23 | Curevac Gmbh | Optimized formulation for mRNA |
| MX2007015107A (en) | 2005-06-03 | 2008-02-15 | Genentech Inc | Method of producing antibodies with modified fucosylation level. |
| US7550264B2 (en) | 2005-06-10 | 2009-06-23 | Datascope Investment Corporation | Methods and kits for sense RNA synthesis |
| KR101304157B1 (en) | 2005-06-16 | 2013-09-06 | 넥타르 테라퓨틱스 | Conjugates having a degradable linkage and polymeric reagents useful in preparing such conjugates |
| AU2006282042B2 (en) | 2005-06-17 | 2011-12-22 | The University Of North Carolina At Chapel Hill | Nanoparticle fabrication methods, systems, and materials |
| US8202835B2 (en) | 2005-06-17 | 2012-06-19 | Yitzchak Hillman | Disease treatment via antimicrobial peptides or their inhibitors |
| US8101385B2 (en) | 2005-06-30 | 2012-01-24 | Archemix Corp. | Materials and methods for the generation of transcripts comprising modified nucleotides |
| CA2613442C (en) | 2005-06-30 | 2016-08-23 | Archemix Corp. | Materials and methods for the generation of fully 2'-modified nucleic acid transcripts |
| US20080220471A1 (en) | 2005-07-27 | 2008-09-11 | Genentech, Inc. | Vectors and Methods Using Same |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US9012219B2 (en) | 2005-08-23 | 2015-04-21 | The Trustees Of The University Of Pennsylvania | RNA preparations comprising purified modified RNA for reprogramming cells |
| ES2735531T3 (en) | 2005-08-23 | 2019-12-19 | Univ Pennsylvania | RNA containing modified nucleosides and methods of use thereof |
| US20070048741A1 (en) | 2005-08-24 | 2007-03-01 | Getts Robert C | Methods and kits for sense RNA synthesis |
| HRP20110348T1 (en) | 2005-09-01 | 2011-07-31 | Celgene Corporation | IMMUNOLOGICAL APPLICATIONS OF IMMUNOMODULATORY COMPOUNDS FOR THE VACCINE AND FOR THE TREATMENT OF INFECTIVE DISEASES |
| AU2006286228A1 (en) | 2005-09-01 | 2007-03-08 | Novartis Vaccines And Diagnostics Gmbh & Co Kg | Multiple vaccination including serogroup C meningococcus |
| US8420605B2 (en) | 2005-09-07 | 2013-04-16 | The University Of Strathclyde | Hydrogel compositions |
| US20120021042A1 (en) | 2005-09-15 | 2012-01-26 | Steffen Panzner | Efficient Method For Loading Amphoteric Liposomes With Nucleic Acid Active Substances |
| DE102005046490A1 (en) | 2005-09-28 | 2007-03-29 | Johannes-Gutenberg-Universität Mainz | New nucleic acid molecule comprising promoter, a transcriptable nucleic acid sequence, a first and second nucleic acid sequence for producing modified RNA with transcriptional stability and translational efficiency |
| US20070087437A1 (en) | 2005-10-14 | 2007-04-19 | Jifan Hu | Methods for rejuvenating cells in vitro and in vivo |
| ATE539765T1 (en) | 2005-11-04 | 2012-01-15 | Novartis Vaccines & Diagnostic | FLU VACCINES WITH PARTICLE ADJUVANTS AND IMMUNE BOOSTERS COMBINATIONS |
| US20070105124A1 (en) | 2005-11-08 | 2007-05-10 | Getts Robert C | Methods and kits for nucleic acid amplification |
| WO2007057167A2 (en) | 2005-11-18 | 2007-05-24 | Bioline Limited | A method for enhancing enzymatic dna polymerase reactions |
| SG10201600950TA (en) | 2005-11-28 | 2016-03-30 | Genmab As | Recombinant monovalent antibodies and methods for production thereof |
| TWI389709B (en) | 2005-12-01 | 2013-03-21 | Novartis Ag | Transdermal therapeutic system |
| US8603457B2 (en) | 2005-12-02 | 2013-12-10 | University Of Rochester | Nonsense suppression and genetic codon alteration by targeted modification |
| WO2008051245A2 (en) | 2005-12-02 | 2008-05-02 | Novartis Ag | Nanoparticles for use in immunogenic compositions |
| US7579318B2 (en) | 2005-12-06 | 2009-08-25 | Centre De La Recherche De La Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| EP1969000A2 (en) | 2005-12-06 | 2008-09-17 | Centre National de la Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| AU2006321602B2 (en) | 2005-12-08 | 2012-03-08 | Novartis Ag | Effects of inhibitors of FGFR3 on gene transcription |
| PT1970446E (en) | 2005-12-13 | 2011-09-01 | Univ Kyoto | Nuclear reprogramming factor |
| JP2009519033A (en) | 2005-12-16 | 2009-05-14 | ディアト | Cell penetrating peptide conjugates for delivering nucleic acids to cells |
| WO2007077042A1 (en) | 2006-01-06 | 2007-07-12 | Topotarget Switzerland Sa | New method for the treatment of gout or pseudogout |
| KR101421745B1 (en) | 2006-01-13 | 2014-07-22 | 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 | Vaccines and immunotherapeutics using codon-optimized IL-15, and methods of using the same |
| US20070178103A1 (en) | 2006-01-30 | 2007-08-02 | Fey Georg H | CD19-specific immunotoxin and treatment method |
| US8476234B2 (en) | 2006-02-03 | 2013-07-02 | Prolor Biotech Inc. | Long-acting coagulation factors and methods of producing same |
| US9458444B2 (en) | 2006-02-03 | 2016-10-04 | Opko Biologics Ltd. | Long-acting coagulation factors and methods of producing same |
| US8946155B2 (en) | 2006-02-03 | 2015-02-03 | Opko Biologics Ltd. | Long-acting polypeptides and methods of producing and administering same |
| DE102006007433A1 (en) | 2006-02-17 | 2007-08-23 | Curevac Gmbh | Adjuvant in the form of a lipid-modified nucleic acid |
| JP5295785B2 (en) | 2006-02-20 | 2013-09-18 | エファ・ユニバーシティ・インダストリー・コラボレイション・ファウンデイション | Cell membrane permeable peptide |
| JP5312050B2 (en) | 2006-02-21 | 2013-10-09 | ネクター セラピューティクス | Split-type degradable polymers and composites produced therefrom |
| CA2643322C (en) | 2006-02-24 | 2015-07-21 | Novartis Ag | Microparticles containing biodegradable polymer and cationic polysaccharide for use in immunogenic compositions |
| US20080038278A1 (en) | 2006-02-24 | 2008-02-14 | Jingsong Cao | GPAT3 encodes a mammalian, microsomal acyl-coa:glycerol 3- phosphate acyltransferase |
| WO2007100770A2 (en) | 2006-02-28 | 2007-09-07 | Elan Pharmaceuticals, Inc. | Methods of treating inflammatory and autoimmune diseases with natalizumab |
| US7910152B2 (en) | 2006-02-28 | 2011-03-22 | Advanced Cardiovascular Systems, Inc. | Poly(ester amide)-based drug delivery systems with controlled release rate and morphology |
| GB0605217D0 (en) | 2006-03-15 | 2006-04-26 | Novartis Ag | Method and compositions for assessing acute rejection |
| EP2012751A4 (en) | 2006-03-21 | 2010-11-24 | Morehouse School Of Medicine | NEW NANOPARTICLES FOR THE ACTIVE COMPOSITION |
| EP2007435B1 (en) | 2006-03-31 | 2019-12-18 | Massachusetts Institute Of Technology | System for targeted delivery of therapeutic agents |
| US8257685B2 (en) | 2006-04-04 | 2012-09-04 | Stc.Unm | Swellable particles for drug delivery |
| AU2007238624B2 (en) | 2006-04-14 | 2012-05-31 | Cellscript, Llc | Kits and methods for generating 5' capped RNA |
| EP1852127A1 (en) | 2006-05-02 | 2007-11-07 | Charité - Universitätsmedizin Berlin | Use of a B-cell-depleting antibody for treatment of polyoma virus infections |
| CA2652280C (en) | 2006-05-15 | 2014-01-28 | Massachusetts Institute Of Technology | Polymers for functional particles |
| MX2008014971A (en) | 2006-05-24 | 2008-12-05 | Serono Lab | CLADRIBINE REGIME TO TREAT MULTIPLE SCLEROSIS. |
| WO2007143574A1 (en) | 2006-06-02 | 2007-12-13 | President And Fellows Of Harvard College | Protein surface remodeling |
| CA2656620C (en) | 2006-07-04 | 2018-03-13 | Genmab A/S | Cd20 binding molecules for the treatment of copd |
| DE602007013559D1 (en) | 2006-07-07 | 2011-05-12 | Univ Aarhus | NANOTEILES FOR THE DISTRIBUTION OF NUCLEIC ACID |
| JP5271902B2 (en) | 2006-07-12 | 2013-08-21 | ノバルティス アーゲー | Actinic crosslinkable copolymers for contact lens manufacture |
| KR20090039748A (en) | 2006-07-20 | 2009-04-22 | 노파르티스 아게 | AMBI-2 inhibitors for the treatment, diagnosis or detection of cancer |
| EP2054036B1 (en) | 2006-07-24 | 2019-12-18 | Singh-Broemer and Company, Inc. | Solid nanoparticle formulation of water insoluble pharmaceutical substances with reduced ostwald ripening |
| JP2009544754A (en) | 2006-07-28 | 2009-12-17 | アプライド バイオシステムズ, エルエルシー | Dinucleotide MRNA cap analog |
| WO2008014979A2 (en) | 2006-07-31 | 2008-02-07 | Curevac Gmbh | NUCLEIC ACID OF FORMULA (I): GIXmGn, OR (II): CIXmCn, IN PARTICULAR AS AN IMMUNE-STIMULATING AGENT/ADJUVANT |
| DE102006035618A1 (en) | 2006-07-31 | 2008-02-07 | Curevac Gmbh | New nucleic acid useful as immuno-stimulating adjuvant for manufacture of a composition for treatment of cancer diseases e.g. colon carcinomas and infectious diseases e.g. influenza and malaria |
| RU2009108289A (en) | 2006-08-07 | 2010-09-20 | Джензим Корпорейшн (Us) | COMBINED THERAPY |
| CA2661093A1 (en) | 2006-08-18 | 2008-02-21 | Nastech Pharmaceutical Company Inc. | Dicer substrate rna peptide conjugates and methods for rna therapeutics |
| US8658211B2 (en) | 2006-08-18 | 2014-02-25 | Arrowhead Madison Inc. | Polyconjugates for in vivo delivery of polynucleotides |
| CN101511382B (en) | 2006-09-06 | 2013-11-13 | 加利福尼亚大学董事会 | Selectively targeted antimicrobial peptides and the use thereof |
| US8192927B2 (en) | 2006-09-07 | 2012-06-05 | Crucell Holland B.V. | Human bind molecules capable of neutralizing influenza virus h5n1 and uses thereof |
| JP2010502713A (en) | 2006-09-08 | 2010-01-28 | ザ・ジョンズ・ホプキンス・ユニバーシティー | Compositions and methods for enhancing transport through mucus |
| US8454948B2 (en) | 2006-09-14 | 2013-06-04 | Medgenics Medical Israel Ltd. | Long lasting drug formulations |
| GB0619182D0 (en) | 2006-09-29 | 2006-11-08 | Leuven K U Res & Dev | Oligonucleotide arrays |
| CA2927045A1 (en) | 2006-10-03 | 2008-04-10 | Muthiah Manoharan | Lipid containing formulations |
| BRPI0715299A2 (en) | 2006-10-05 | 2013-07-23 | The Johns Hopkins University | Method for preparing polymeric nanoparticles, Method for preparing a micellar cup, Reconstitutable polymer micelles, Bioactive polymeric nanoparticle composition, Method for providing a patient a medicament and Method for preparing polymeric nanoparticle compositions |
| DE102006051516A1 (en) * | 2006-10-31 | 2008-05-08 | Curevac Gmbh | (Base) modified RNA to increase the expression of a protein |
| US8414927B2 (en) | 2006-11-03 | 2013-04-09 | Boston Scientific Scimed, Inc. | Cross-linked polymer particles |
| US7999087B2 (en) | 2006-11-15 | 2011-08-16 | Agilent Technologies, Inc. | 2′-silyl containing thiocarbonate protecting groups for RNA synthesis |
| US8242258B2 (en) | 2006-12-03 | 2012-08-14 | Agilent Technologies, Inc. | Protecting groups for RNA synthesis |
| US8399007B2 (en) | 2006-12-05 | 2013-03-19 | Landec Corporation | Method for formulating a controlled-release pharmaceutical formulation |
| PL2121011T3 (en) | 2006-12-06 | 2014-10-31 | Novartis Ag | Vaccines including antigen from four strains of influenza virus |
| US9034348B2 (en) | 2006-12-11 | 2015-05-19 | Chi2Gel Ltd. | Injectable chitosan mixtures forming hydrogels |
| WO2008076437A2 (en) | 2006-12-18 | 2008-06-26 | Acceleron Pharma Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
| EP2104739B1 (en) | 2006-12-21 | 2013-06-19 | Novozymes Inc. | Modified messenger rna stabilizing sequences for expressing genes in bacterial cells |
| EP2120859B1 (en) | 2006-12-21 | 2013-11-20 | Stryker Corporation | Sustained-release formulations comprising bmp-7 crystals |
| WO2008078180A2 (en) | 2006-12-22 | 2008-07-03 | Archemix Corp. | Materials and methods for the generation of transcripts comprising modified nucleotides |
| DE102006061015A1 (en) | 2006-12-22 | 2008-06-26 | Curevac Gmbh | Process for the purification of RNA on a preparative scale by HPLC |
| US8338166B2 (en) | 2007-01-04 | 2012-12-25 | Lawrence Livermore National Security, Llc | Sorting, amplification, detection, and identification of nucleic acid subsequences in a complex mixture |
| DE102007001370A1 (en) * | 2007-01-09 | 2008-07-10 | Curevac Gmbh | RNA-encoded antibodies |
| WO2008091799A2 (en) | 2007-01-22 | 2008-07-31 | The Trustees Of Columbia University In The City Of New York | Cell-based methods for identifying inhibitors of parkinson's disease-associated lrrk2 mutants |
| EP2450368A1 (en) | 2007-01-30 | 2012-05-09 | Epivax, Inc. | Regulatory t cell epitopes, compositions and uses thereof |
| TWI432449B (en) | 2007-02-02 | 2014-04-01 | Acceleron Pharma Inc | Variants derived from ActRIIB and their uses |
| US8859229B2 (en) | 2007-02-02 | 2014-10-14 | Yale University | Transient transfection with RNA |
| WO2008096370A2 (en) | 2007-02-05 | 2008-08-14 | Natco Pharma Limited | An efficient and novel purification method of recombinant hg-csf |
| US8333799B2 (en) | 2007-02-12 | 2012-12-18 | C. R. Bard, Inc. | Highly flexible stent and method of manufacture |
| US8242087B2 (en) | 2007-02-27 | 2012-08-14 | K.U.Leuven Research & Development | Phosphate modified nucleosides useful as substrates for polymerases and as antiviral agents |
| EP1964922A1 (en) * | 2007-03-02 | 2008-09-03 | Boehringer Ingelheim Pharma GmbH & Co. KG | Improvement of protein production |
| PL2126093T3 (en) * | 2007-03-02 | 2013-03-29 | Boehringer Ingelheim Pharma | Improvement of protein production |
| EP2120876B1 (en) | 2007-03-05 | 2015-03-04 | Washington University | Nanoparticle delivery systems for membrane-integrating peptides |
| EP2125892A2 (en) | 2007-03-20 | 2009-12-02 | Millennium Pharmaceuticals, Inc. | Nucleic acids encoding humanized immunoglobulin that binds a4b7 integrin |
| CA2685423C (en) | 2007-04-27 | 2014-02-18 | Echo Therapeutics, Inc. | Skin permeation device for analyte sensing or transdermal drug delivery |
| DK2152290T3 (en) | 2007-04-30 | 2014-08-18 | Glaxosmithkline Llc | PROCEDURES FOR ADMINISTRATION OF ANTI-IL-5 ANTIBODIES |
| WO2008135855A2 (en) | 2007-05-03 | 2008-11-13 | Pfizer Products Inc. | Nanoparticles comprising a cholesteryl ester transfer protein inhibitor and a nonionizable polymer |
| US7682789B2 (en) | 2007-05-04 | 2010-03-23 | Ventana Medical Systems, Inc. | Method for quantifying biomolecules conjugated to a nanoparticle |
| DK2494993T3 (en) | 2007-05-04 | 2018-11-12 | Marina Biotech Inc | Amino acid lipids and uses thereof |
| US8728491B2 (en) | 2007-05-07 | 2014-05-20 | Alba Therapeutics Corporation | Transcutaneous delivery of therapeutic agents |
| JP5296328B2 (en) | 2007-05-09 | 2013-09-25 | 独立行政法人理化学研究所 | Single-stranded circular RNA and method for producing the same |
| PL2476689T3 (en) | 2007-05-10 | 2016-04-29 | Agilent Technologies Inc | Thiocarbon-protecting groups for RNA synthesis |
| SI3072525T1 (en) | 2007-05-14 | 2018-06-29 | Astrazeneca Ab | Methods of reducing basophil levels |
| WO2008144365A2 (en) | 2007-05-17 | 2008-11-27 | Novartis Ag | Method for making dry powder compositions containing ds-rna based on supercritical fluid technology |
| BRPI0812384A2 (en) | 2007-05-22 | 2014-12-02 | Novartis Ag | TREATMENT, DIAGNOSTIC AND DISEASE TREATMENT METHODS ASSOCIATED WITH FGF21 |
| EP2826863B1 (en) | 2007-05-30 | 2017-08-23 | Northwestern University | Nucleic acid functionalized nanoparticles for therapeutic applications |
| EP2164951A2 (en) | 2007-05-30 | 2010-03-24 | The General Hospital Corporation | Methods of generating pluripotent cells from somatic cells |
| PT2167523E (en) | 2007-06-19 | 2014-09-22 | Univ Louisiana State | Synthesis and use of anti-reverse phosphorothioate analogs of the messenger rna cap |
| WO2009006438A2 (en) | 2007-06-29 | 2009-01-08 | Epicentre Technologies Corporation | Copy dna and sense rna |
| WO2009015071A1 (en) | 2007-07-23 | 2009-01-29 | Dharmacon, Inc. | Screening of micro-rna cluster inhibitor pools |
| US20090042825A1 (en) | 2007-08-06 | 2009-02-12 | Majed Matar | Composition, method of preparation & application of concentrated formulations of condensed nucleic acids with a cationic lipopolymer |
| US9144546B2 (en) | 2007-08-06 | 2015-09-29 | Clsn Laboratories, Inc. | Nucleic acid-lipopolymer compositions |
| EP2183390A1 (en) | 2007-08-23 | 2010-05-12 | Novartis Ag | Methods for detecting oligonucleotides |
| WO2009030368A1 (en) | 2007-09-05 | 2009-03-12 | F. Hoffmann-La Roche Ag | Combination therapy with type i and type ii anti-cd20 antibodies |
| WO2009030254A1 (en) | 2007-09-04 | 2009-03-12 | Curevac Gmbh | Complexes of rna and cationic peptides for transfection and for immunostimulation |
| US8506928B2 (en) | 2007-09-07 | 2013-08-13 | The Regents Of The University Of California | Methods and compounds for targeting tissues |
| US20110086904A1 (en) | 2007-09-17 | 2011-04-14 | The Trustees Of The University Of Pennsylvania | GENERATION OF HYPERSTABLE mRNAs |
| US8394763B2 (en) | 2007-09-26 | 2013-03-12 | Oregon Health & Science University | Cyclic undecapeptides and derivatives as multiple sclerosis therapies |
| EP2205618B1 (en) | 2007-09-26 | 2016-11-09 | Intrexon Corporation | Synthetic 5'utrs, expression vectors, and methods for increasing transgene expression |
| EP2042193A1 (en) | 2007-09-28 | 2009-04-01 | Biomay AG | RNA Vaccines |
| PL2644192T3 (en) | 2007-09-28 | 2017-09-29 | Pfizer Inc. | Cancer Cell Targeting Using Nanoparticles |
| US8470560B2 (en) | 2007-10-03 | 2013-06-25 | The United States Of America As Represented By The Secretary Of The Army | CR-2 binding peptide P28 as molecular adjuvant for DNA vaccines |
| WO2009046738A1 (en) | 2007-10-09 | 2009-04-16 | Curevac Gmbh | Composition for treating lung cancer, particularly of non-small lung cancers (nsclc) |
| WO2009046739A1 (en) | 2007-10-09 | 2009-04-16 | Curevac Gmbh | Composition for treating prostate cancer (pca) |
| CA2917512A1 (en) | 2007-10-12 | 2009-04-23 | Massachusetts Institute Of Technology | Vaccine nanotechnology |
| US20090098118A1 (en) | 2007-10-15 | 2009-04-16 | Thomas Friess | Combination therapy of a type ii anti-cd20 antibody with an anti-bcl-2 active agent |
| US20110091473A1 (en) | 2007-10-22 | 2011-04-21 | Genmab A/S | Novel antibody therapies |
| BRPI0818913A2 (en) | 2007-11-01 | 2015-05-12 | Univ Rochester | Recombinant factor viii having high stability |
| CA2705263A1 (en) | 2007-11-09 | 2009-05-14 | Novartis Ag | Combination therapy with an antagonist anti-cd 40 antibody and cyclophosphamide, doxorubicin, vincristine and prednisone (chop) for treatment of b-cell malignancies |
| US8470771B2 (en) | 2007-11-14 | 2013-06-25 | Institute Of Microbiology, Chinese Academy Of Sciences | Method and medicament for inhibiting the infection of influenza virus |
| CA2706419A1 (en) | 2007-11-30 | 2009-06-04 | Glaxo Group Limited | Antigen-binding constructs binding il-13 |
| AU2008335202A1 (en) | 2007-12-10 | 2009-06-18 | Alnylam Pharmaceuticals, Inc. | Compositions and methods for inhibiting expression of Factor VII gene |
| EP2610340B1 (en) | 2007-12-11 | 2014-10-01 | The Scripps Research Institute | Compositions and methods related to mRNA translational enhancer elements |
| EP2229459B1 (en) | 2007-12-13 | 2014-08-27 | Alnylam Pharmaceuticals, Inc. | Methods and compositions for prevention or treatment of RSV infection |
| EP2072618A1 (en) | 2007-12-14 | 2009-06-24 | Johannes Gutenberg-Universität Mainz | Use of RNA for reprogramming somatic cells |
| WO2009086072A2 (en) | 2007-12-21 | 2009-07-09 | Genentech, Inc. | Therapy of rituximab-refractory rheumatoid arthritis patients |
| WO2009093703A1 (en) | 2008-01-23 | 2009-07-30 | Ajinomoto Co., Inc. | Method of producing l-amino acid |
| JPWO2009093384A1 (en) | 2008-01-24 | 2011-05-26 | 独立行政法人産業技術総合研究所 | Polynucleotide, polynucleotide analogue and gene expression control method using the same |
| RU2545701C2 (en) | 2008-01-31 | 2015-04-10 | Куревак Гмбх | NUCLEIC ACIDS OF FORMULA (I) (NuGlXmGnNv)a AND DERIVATIVES THEREOF AS IMMUNOSTIMULATING AGENTS/ADJUVANTS |
| US20100330677A1 (en) | 2008-02-11 | 2010-12-30 | Cambridge Enterprise Limited | Improved Reprogramming of Mammalian Cells, and Cells Obtained |
| WO2009102467A2 (en) | 2008-02-13 | 2009-08-20 | Intarcia Therapeutics, Inc. | Devices, formulations, and methods for delivery of multiple beneficial agents |
| DE102008009920A1 (en) | 2008-02-15 | 2009-08-20 | Aj Innuscreen Gmbh | Mobile device for nucleic acid isolation |
| US20120027813A1 (en) | 2008-02-22 | 2012-02-02 | Novartis Vaccines And Diagnostics Srl | Adjuvanted influenza vaccines for pediatric use |
| US8506966B2 (en) | 2008-02-22 | 2013-08-13 | Novartis Ag | Adjuvanted influenza vaccines for pediatric use |
| WO2009108891A2 (en) | 2008-02-29 | 2009-09-03 | Egen, Inc. | Modified poloxamers for gene expression and associated methods |
| DK2993186T3 (en) | 2008-03-14 | 2019-11-25 | Biocon Ltd | A monoclonal antibody and a method thereof |
| WO2009114854A1 (en) | 2008-03-14 | 2009-09-17 | Egen, Inc. | Biodegradable cross-linked branched poly (alkylene imines) |
| CN102026660A (en) | 2008-03-28 | 2011-04-20 | 葛兰素史密斯克莱有限责任公司 | Methods of treatment |
| NZ588583A (en) | 2008-04-15 | 2012-08-31 | Protiva Biotherapeutics Inc | Novel lipid formulations for nucleic acid delivery |
| WO2009127230A1 (en) * | 2008-04-16 | 2009-10-22 | Curevac Gmbh | MODIFIED (m)RNA FOR SUPPRESSING OR AVOIDING AN IMMUNOSTIMULATORY RESPONSE AND IMMUNOSUPPRESSIVE COMPOSITION |
| EP2288336B8 (en) | 2008-04-25 | 2017-03-22 | Northwestern University | Nanostructures suitable for sequestering cholesterol |
| AU2009243187C1 (en) | 2008-04-28 | 2015-12-24 | President And Fellows Of Harvard College | Supercharged proteins for cell penetration |
| BRPI0913012B1 (en) | 2008-04-30 | 2021-12-14 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services, Centers For Disease Control And Prevention | CHIMERA NUCLEIC ACID CHIMERA, METHODS FOR DETECTING A DENGUE VIRUS ANTIBODY IN A PATIENT SAMPLE, AND FOR PRODUCING VIRAL PARTICLES THAT EXPRESS PRM AND DENGUE VIRUS PROTEINS, USE OF CHIMERIC VIRUS AND FLAVIVIRUSES OR VIRAL PARTICLES |
| US9394538B2 (en) | 2008-05-07 | 2016-07-19 | Shi-Lung Lin | Development of universal cancer drugs and vaccines |
| US8486278B2 (en) | 2008-05-08 | 2013-07-16 | Minipumps, Llc | Drug-delivery pumps and methods of manufacture |
| US8697098B2 (en) | 2011-02-25 | 2014-04-15 | South Dakota State University | Polymer conjugated protein micelles |
| CA2724105C (en) | 2008-05-13 | 2017-09-05 | University Of Washington | Diblock copolymers and polynucleotide complexes thereof for delivery into cells |
| EP2297323A1 (en) | 2008-05-21 | 2011-03-23 | Hartmann, Gunther | 5' triphosphate oligonucleotide with blunt end and uses thereof |
| FR2931824B1 (en) | 2008-05-29 | 2014-11-28 | Centre Nat Rech Scient | PROCESS FOR RNA SYNTHESIS THROUGH CHEMICAL. |
| JP2011520472A (en) | 2008-05-29 | 2011-07-21 | ハナル バイオファーマ カンパニー リミテッド | Modified erythropoietin (EPO) polypeptide exhibiting increased proteolytic enzyme resistance and pharmaceutical composition thereof |
| US20100086922A1 (en) | 2008-05-30 | 2010-04-08 | Millennium Pharmaceuticals, Inc. | Assessment of chromosomal alterations to predict clinical outcome of bortezomib treatment |
| PL215513B1 (en) | 2008-06-06 | 2013-12-31 | Univ Warszawski | New borane phosphate analogs of dinucleotides, their application, RNA particle, method of obtaining RNA and method of obtaining peptides or protein |
| TWI451876B (en) | 2008-06-13 | 2014-09-11 | Lilly Co Eli | Pegylated insulin lispro compounds |
| US20100104645A1 (en) | 2008-06-16 | 2010-04-29 | Bind Biosciences, Inc. | Methods for the preparation of targeting agent functionalized diblock copolymers for use in fabrication of therapeutic targeted nanoparticles |
| AU2009268923B2 (en) | 2008-06-16 | 2015-09-17 | Pfizer Inc. | Drug loaded polymeric nanoparticles and methods of making and using same |
| WO2010005726A2 (en) | 2008-06-16 | 2010-01-14 | Bind Biosciences Inc. | Therapeutic polymeric nanoparticles with mtor inhibitors and methods of making and using same |
| US20100009424A1 (en) | 2008-07-14 | 2010-01-14 | Natasha Forde | Sonoporation systems and methods |
| WO2010009065A2 (en) | 2008-07-15 | 2010-01-21 | Novartis Ag | Amphipathic peptide compositions |
| US20110250237A1 (en) | 2008-07-15 | 2011-10-13 | O'hagan Derek | Immunogenic amphipathic peptide compositions |
| EP2331561A4 (en) | 2008-09-03 | 2013-02-27 | Xenome Ltd | Libraries of peptide conjugates and methods for making them |
| WO2010027512A2 (en) | 2008-09-06 | 2010-03-11 | Chemgenes Corporation | Rna synthesis - phosphoramidites for synthetic rna in the reverse direction, and application in convenient introduction of ligands, chromophores and modifications of synthetic rna at the 3' - end |
| US20120100558A1 (en) | 2008-09-08 | 2012-04-26 | Hanash Samir M | Lung cancer diagnosis |
| WO2010030763A2 (en) | 2008-09-10 | 2010-03-18 | Bind Biosciences, Inc. | High throughput fabrication of nanoparticles |
| TW201438738A (en) | 2008-09-16 | 2014-10-16 | Genentech Inc | Method for treating progressive multiple sclerosis |
| US20120021519A1 (en) | 2008-09-19 | 2012-01-26 | Presidents And Fellows Of Harvard College | Efficient induction of pluripotent stem cells using small molecule compounds |
| WO2010037408A1 (en) | 2008-09-30 | 2010-04-08 | Curevac Gmbh | Composition comprising a complexed (m)rna and a naked mrna for providing or enhancing an immunostimulatory response in a mammal and uses thereof |
| WO2010042490A1 (en) | 2008-10-06 | 2010-04-15 | Boston Medical Center Corporation | A single lentiviral vector system for induced pluripotent (ips) stem cells derivation |
| PL2350043T3 (en) | 2008-10-09 | 2014-09-30 | Tekmira Pharmaceuticals Corp | Improved amino lipids and methods for the delivery of nucleic acids |
| US8535655B2 (en) | 2008-10-10 | 2013-09-17 | Polyactiva Pty Ltd. | Biodegradable polymer—bioactive moiety conjugates |
| US8343498B2 (en) | 2008-10-12 | 2013-01-01 | Massachusetts Institute Of Technology | Adjuvant incorporation in immunonanotherapeutics |
| US8603532B2 (en) | 2008-10-20 | 2013-12-10 | Massachusetts Institute Of Technology | Nanostructures for drug delivery |
| US20120015899A1 (en) | 2008-10-25 | 2012-01-19 | Plant Bioscience, Limited | Modified plant virus particles and uses therefor |
| CN104910025B (en) | 2008-11-07 | 2019-07-16 | 麻省理工学院 | Alkamine lipid and its purposes |
| CN105709229B (en) | 2008-11-10 | 2020-07-28 | 阿布特斯生物制药公司 | Novel lipids and compositions for delivery of therapeutic agents |
| CA2780482A1 (en) | 2008-11-17 | 2010-05-10 | Anil K. Sood | Hdl particles for delivery of nucleic acids |
| EP2191840A1 (en) | 2008-11-28 | 2010-06-02 | Sanofi-Aventis | Antitumor combinations containing antibodies recognizing specifically CD38 and melphalan |
| CA2746514C (en) | 2008-12-10 | 2018-11-27 | Alnylam Pharmaceuticals, Inc. | Gnaq targeted dsrna compositions and methods for inhibiting expression |
| EP2196476A1 (en) | 2008-12-10 | 2010-06-16 | Novartis Ag | Antibody formulation |
| EP2376091A4 (en) | 2008-12-12 | 2012-08-01 | Univ California | NEW TARGETS FOR THE TREATMENT OF HYPERCHOLESTEROLEMIA |
| WO2010068866A2 (en) | 2008-12-12 | 2010-06-17 | Bind Biosciences | Therapeutic particles suitable for parenteral administration and methods of making and using same |
| JP2012512175A (en) | 2008-12-15 | 2012-05-31 | バインド バイオサイエンシズ インコーポレイテッド | Long-circulating nanoparticles for sustained release of therapeutic agents |
| EP2405937A4 (en) | 2009-01-16 | 2012-06-20 | Glaxosmithkline Llc | Treatment of a cancer using a combination of bendamustine and an anti-cd20 antibody |
| WO2010084371A1 (en) | 2009-01-26 | 2010-07-29 | Mitoprod | Novel circular interfering rna molecules |
| AU2010208035B2 (en) | 2009-01-29 | 2016-06-23 | Arbutus Biopharma Corporation | Improved lipid formulation for the delivery of nucleic acids |
| WO2010088927A1 (en) | 2009-02-09 | 2010-08-12 | Curevac Gmbh | Use of pei for the improvement of endosomal release and expression of transfected nucleic acids, complexed with cationic or polycationic compounds |
| US20140141089A1 (en) | 2009-02-11 | 2014-05-22 | Colorado School Of Mines | Nanoparticles, Compositions Thereof, and Methods of Use, and Methods of Making the Same |
| JP5735927B2 (en) | 2009-02-24 | 2015-06-17 | ザ スクリプス リサーチ インスティテュート | Re-engineering the primary structure of mRNA to enhance protein production |
| MX2011009362A (en) | 2009-03-05 | 2011-09-26 | Abbott Lab | Il-17 binding proteins. |
| WO2010102065A1 (en) | 2009-03-05 | 2010-09-10 | Bend Research, Inc. | Pharmaceutical compositions of dextran polymer derivatives |
| WO2010141135A2 (en) | 2009-03-05 | 2010-12-09 | Trustees Of Boston University | Bacteriophages expressing antimicrobial peptides and uses thereof |
| JP2012520085A (en) | 2009-03-13 | 2012-09-06 | エーゲン、インコーポレイテッド | Compositions and methods for delivery of bioactive RNA |
| WO2010108108A2 (en) | 2009-03-20 | 2010-09-23 | Egen, Inc. | Polyamine derivatives |
| US20120095077A1 (en) | 2009-03-23 | 2012-04-19 | University Of Utah Research Foundation | Methods and compositions related to modified guanine bases for controlling off-target effects in rna interference |
| JP5622254B2 (en) | 2009-03-31 | 2014-11-12 | 国立大学法人東京大学 | Double-stranded ribonucleic acid polyion complex |
| KR101773368B1 (en) | 2009-04-03 | 2017-08-31 | 유니버시티 오브 시카고 | Compositions and methods related to Protein A (SpA) variants |
| CA2795906C (en) | 2009-04-13 | 2019-02-26 | Inserm, Institut National De La Sante Et De La Recherche Medicale | Hpv particles and uses thereof |
| CN102573907A (en) | 2009-04-17 | 2012-07-11 | 比奥根艾迪克Ma公司 | Compositions and methods to treat acute myelogenous leukemia |
| US20100273220A1 (en) | 2009-04-22 | 2010-10-28 | Massachusetts Institute Of Technology | Innate immune suppression enables repeated delivery of long rna molecules |
| AR076402A1 (en) | 2009-04-27 | 2011-06-08 | Novartis Ag | COMPOSITIONS AND METHODS TO INCREASE MUSCLE GROWTH |
| WO2010129033A2 (en) | 2009-04-29 | 2010-11-11 | Calmune Corporation | Modified antibodies for passive immunotherapy |
| US8287910B2 (en) | 2009-04-30 | 2012-10-16 | Intezyne Technologies, Inc. | Polymeric micelles for polynucleotide encapsulation |
| US8715736B2 (en) | 2009-04-30 | 2014-05-06 | Florida Agricultural And Mechanical University | Nanoparticle formulations for skin delivery |
| KR20210031549A (en) | 2009-05-05 | 2021-03-19 | 알닐람 파마슈티칼스 인코포레이티드 | Lipid compositions |
| DE202009007116U1 (en) | 2009-05-18 | 2010-10-14 | Amoena Medizin-Orthopädie-Technik GmbH | Anti decubitus cushions |
| US8574835B2 (en) | 2009-05-29 | 2013-11-05 | Life Technologies Corporation | Scaffolded nucleic acid polymer particles and methods of making and using |
| KR102374518B1 (en) | 2009-06-10 | 2022-03-16 | 알닐람 파마슈티칼스 인코포레이티드 | Improved lipid formulation |
| EP2440556A1 (en) | 2009-06-10 | 2012-04-18 | Vertex Pharmaceuticals Incorporated | Inhibitors of phosphatidylinositol 3-kinase |
| WO2010148013A2 (en) | 2009-06-15 | 2010-12-23 | Alnylam Pharmaceuticals, Inc. | Lipid formulated dsrna targeting the pcsk9 gene |
| US20110097329A1 (en) | 2009-06-26 | 2011-04-28 | Massachusetts Institute Of Technology | Compositions and methods for treating cancer and modulating stress granule formation |
| CA2767127A1 (en) | 2009-07-01 | 2011-01-06 | Protiva Biotherapeutics, Inc. | Novel lipid formulations for delivery of therapeutic agents to solid tumors |
| US8569256B2 (en) | 2009-07-01 | 2013-10-29 | Protiva Biotherapeutics, Inc. | Cationic lipids and methods for the delivery of therapeutic agents |
| US20110300205A1 (en) | 2009-07-06 | 2011-12-08 | Novartis Ag | Self replicating rna molecules and uses thereof |
| KR20120097484A (en) | 2009-07-31 | 2012-09-04 | 에트리스 게엠베하 | Rna with a combination of unmodified and modified nucleotides for protein expression |
| EP2281579A1 (en) | 2009-08-05 | 2011-02-09 | BioNTech AG | Vaccine composition comprising 5'-Cap modified RNA |
| US20110053829A1 (en) | 2009-09-03 | 2011-03-03 | Curevac Gmbh | Disulfide-linked polyethyleneglycol/peptide conjugates for the transfection of nucleic acids |
| US20110070227A1 (en) | 2009-09-18 | 2011-03-24 | Anna-Marie Novotney-Barry | Treatment of Autoimmune and Inflammatory Diseases |
| US8859284B2 (en) | 2009-10-22 | 2014-10-14 | The United States Of America, As Represented By The Secretary Of The Navy | Delivery of nanoparticles to neurons |
| US8449916B1 (en) | 2009-11-06 | 2013-05-28 | Iowa State University Research Foundation, Inc. | Antimicrobial compositions and methods |
| WO2011060250A1 (en) | 2009-11-13 | 2011-05-19 | Bend Research, Inc. | Cationic dextran polymer derivatives |
| WO2011062965A2 (en) | 2009-11-18 | 2011-05-26 | University Of Washington Through Its Center For Commercialization | Targeting monomers and polymers having targeting blocks |
| US8530429B2 (en) | 2009-11-24 | 2013-09-10 | Arch Cancer Therapeutics, Inc. | Brain tumor targeting peptides and methods |
| HUE038039T2 (en) | 2009-12-01 | 2018-09-28 | Translate Bio Inc | Delivery of mrna for the augmentation of proteins and enzymes in human genetic diseases |
| US20110245756A1 (en) | 2009-12-03 | 2011-10-06 | Rishi Arora | Devices for material delivery, electroporation, sonoporation, and/or monitoring electrophysiological activity |
| DE102009056884B4 (en) | 2009-12-03 | 2021-03-18 | Novartis Ag | Vaccine Adjuvants and Improved Methods for Making Same |
| EP3326643B1 (en) | 2009-12-06 | 2021-04-07 | Bioverativ Therapeutics Inc. | Factor viii-fc chimeric and hybrid polypeptides, and methods of use thereof |
| US20130189741A1 (en) | 2009-12-07 | 2013-07-25 | Cellscript, Inc. | Compositions and methods for reprogramming mammalian cells |
| AU2010328336B2 (en) | 2009-12-07 | 2017-03-02 | Arbutus Biopharma Corporation | Compositions for nucleic acid delivery |
| HUE047165T2 (en) | 2009-12-07 | 2020-04-28 | Univ Pennsylvania | Rna preparations comprising purified modified rna for reprogramming cells |
| WO2011069529A1 (en) | 2009-12-09 | 2011-06-16 | Curevac Gmbh | Mannose-containing solution for lyophilization, transfection and/or injection of nucleic acids |
| WO2011069528A1 (en) | 2009-12-09 | 2011-06-16 | Curevac Gmbh | Lyophilization of nucleic acids in lactate-containing solutions |
| EP2509634B1 (en) | 2009-12-11 | 2019-03-06 | Pfizer Inc | Stable formulations for lyophilizing therapeutic particles |
| WO2011084518A2 (en) | 2009-12-15 | 2011-07-14 | Bind Biosciences, Inc. | Therapeutic polymeric nanoparticles comprising corticosteroids and methods of making and using same |
| WO2011084513A2 (en) | 2009-12-15 | 2011-07-14 | Bind Biosciences, Inc. | Therapeutic polymeric nanoparticle compositions with high glass transition temperature or high molecular weight copolymers |
| DE102009058769A1 (en) | 2009-12-16 | 2011-06-22 | MagForce Nanotechnologies AG, 10589 | Temperature-dependent activation of catalytic nucleic acids for controlled drug release |
| JP2013514977A (en) | 2009-12-16 | 2013-05-02 | ザ ブリガム アンド ウィメンズ ホスピタル インコーポレイテッド | Particles for delivery of multiple substances |
| AU2010330814B2 (en) | 2009-12-18 | 2017-01-12 | Acuitas Therapeutics Inc. | Methods and compositions for delivery of nucleic acids |
| EP2338520A1 (en) | 2009-12-21 | 2011-06-29 | Ludwig Maximilians Universität | Conjugate with targeting ligand and use of same |
| CN102905763B (en) | 2009-12-23 | 2015-06-17 | 诺华股份有限公司 | Lipids, lipid compositions, and methods of using them |
| US8846631B2 (en) | 2010-01-14 | 2014-09-30 | Regulus Therapeutics Inc. | MicroRNA compositions and methods |
| PT2539451E (en) | 2010-02-24 | 2016-03-28 | Arrowhead Res Corp | Compositions for targeted delivery of sirna |
| US8889193B2 (en) | 2010-02-25 | 2014-11-18 | The Johns Hopkins University | Sustained delivery of therapeutic agents to an eye compartment |
| US20130133483A1 (en) | 2010-03-08 | 2013-05-30 | University Of Rochester | Synthesis of Nanoparticles Using Reducing Gases |
| CN102892809A (en) | 2010-03-16 | 2013-01-23 | 犹他大学研究基金会 | Cleavable modifications to reducible poly (amido ethylenimines)s to enhance nucleotide delivery |
| WO2011116072A1 (en) | 2010-03-16 | 2011-09-22 | Escape Therapeutics, Inc. | Hybrid hydrogel scaffold compositions and methods of use |
| US20110230816A1 (en) | 2010-03-18 | 2011-09-22 | Tyco Healthcare Group Lp | Gels for Transdermal Delivery |
| US9149432B2 (en) | 2010-03-19 | 2015-10-06 | Massachusetts Institute Of Technology | Lipid vesicle compositions and methods of use |
| GB201005005D0 (en) | 2010-03-25 | 2010-05-12 | Angeletti P Ist Richerche Bio | New vaccine |
| JP2013528665A (en) | 2010-03-26 | 2013-07-11 | メルサナ セラピューティックス, インコーポレイテッド | Modified polymers for delivery of polynucleotides, methods for their production, and methods of their use |
| WO2011119262A1 (en) | 2010-03-26 | 2011-09-29 | Cerulean Pharma Inc. | Methods and systems for generating nanoparticles |
| US20110247090A1 (en) | 2010-04-02 | 2011-10-06 | Intrexon Corporation | Synthetic 5'UTRs, Expression Vectors, and Methods for Increasing Transgene Expression |
| EP2555794A4 (en) | 2010-04-05 | 2014-01-15 | Univ Chicago | PROTEIN A (SPA) ANTIBODY COMPOSITIONS AND METHODS AS AN IMMUNE RESPONSE AMPLIFIER |
| BR112012025364A2 (en) | 2010-04-07 | 2015-09-22 | Novartis Ag | parvovirus b19 virus-like particle generation method |
| EP2558074B1 (en) | 2010-04-08 | 2018-06-06 | The Trustees of Princeton University | Preparation of lipid nanoparticles |
| JP6043278B2 (en) | 2010-04-09 | 2016-12-14 | パシラ ファーマシューティカルズ インコーポレーテッド | Method for making multivesicular liposomes, method for preparing large diameter synthetic membrane vesicles, and evaporation apparatus |
| WO2011125469A1 (en) | 2010-04-09 | 2011-10-13 | 国立大学法人東京大学 | Micro-rna-regulated recombinant vaccinia virus and utilization thereof |
| KR101196667B1 (en) | 2010-04-15 | 2012-11-02 | 포항공과대학교 산학협력단 | A DELEVERY SYSTEM OF ANTI-CANCER AGENT USING pH SENSITIVE METAL NANOPARTICLE |
| DK2558577T3 (en) | 2010-04-16 | 2019-04-01 | Nuevolution As | Bi-functional complexes and methods for the preparation and use of such complexes |
| EP3072961A1 (en) | 2010-04-16 | 2016-09-28 | Children's Medical Center Corporation | Sustained polypeptide expression from synthetic, modified rnas and uses thereof |
| EP2377938A1 (en) | 2010-04-16 | 2011-10-19 | Eukarys | Capping-prone RNA polymerase enzymes and their applications |
| US20130260460A1 (en) | 2010-04-22 | 2013-10-03 | Isis Pharmaceuticals Inc | Conformationally restricted dinucleotide monomers and oligonucleotides |
| MX2012012567A (en) | 2010-04-28 | 2012-11-21 | Kimberly Clark Co | Method for increasing permeability of an epithelial barrier. |
| WO2011139911A2 (en) | 2010-04-29 | 2011-11-10 | Isis Pharmaceuticals, Inc. | Lipid formulated single stranded rna |
| PE20130213A1 (en) | 2010-04-30 | 2013-03-19 | Novartis Ag | USEFUL PREDICTIVE MARKERS IN THE TREATMENT OF FRAGILE X SYNDROME (FXS) |
| US9254327B2 (en) | 2010-05-10 | 2016-02-09 | Alnylam Pharmaceuticals, Inc. | Methods and compositions for delivery of active agents |
| US10077232B2 (en) | 2010-05-12 | 2018-09-18 | Arbutus Biopharma Corporation | Cyclic cationic lipids and methods of use |
| WO2011141705A1 (en) | 2010-05-12 | 2011-11-17 | Protiva Biotherapeutics, Inc. | Novel cationic lipids and methods of use thereof |
| EP2387999A1 (en) | 2010-05-21 | 2011-11-23 | CureVac GmbH | Histidine-containing solution for transfection and/or injection of nucleic acids and uses thereof |
| WO2011149733A2 (en) | 2010-05-24 | 2011-12-01 | Merck Sharp & Dohme Corp. | Novel amino alcohol cationic lipids for oligonucleotide delivery |
| JP5957646B2 (en) | 2010-06-04 | 2016-07-27 | サーナ・セラピューティクス・インコーポレイテッドSirna Therapeutics,Inc. | Novel low molecular weight cationic lipids for oligonucleotide delivery |
| WO2011157715A1 (en) | 2010-06-14 | 2011-12-22 | F. Hoffmann-La Roche Ag | Cell-penetrating peptides and uses therof |
| WO2011163121A1 (en) | 2010-06-21 | 2011-12-29 | Alnylam Pharmaceuticals, Inc. | Multifunctional copolymers for nucleic acid delivery |
| WO2011161653A1 (en) | 2010-06-25 | 2011-12-29 | Novartis Ag | Combinations of meningococcal factor h binding proteins |
| CN103079592B (en) | 2010-07-01 | 2015-10-21 | 浦项工科大学校产学协力团 | Methods of treating and diagnosing cancer using microvesicles derived from cells |
| CN103037885B (en) | 2010-07-02 | 2015-08-26 | 芝加哥大学 | The composition relevant to albumin A (SpA) variant and method |
| CA2804396C (en) | 2010-07-06 | 2021-06-29 | Novartis Ag | Liposomes with lipids having an advantageous pka-value for rna delivery |
| RU2625546C2 (en) | 2010-07-06 | 2017-07-14 | Новартис Аг | Cationic emulsions "oil-in-water" |
| DK2591114T3 (en) | 2010-07-06 | 2016-08-29 | Glaxosmithkline Biologicals Sa | Immunization of large mammals with low doses of RNA |
| PT2590676T (en) | 2010-07-06 | 2016-11-04 | Glaxosmithkline Biologicals Sa | Virion-like delivery particles for self-replicating rna molecules |
| US9192661B2 (en) | 2010-07-06 | 2015-11-24 | Novartis Ag | Delivery of self-replicating RNA using biodegradable polymer particles |
| PT3243526T (en) | 2010-07-06 | 2020-03-04 | Glaxosmithkline Biologicals Sa | DISTRIBUTION OF RNA TO DISPOLISH MULTIPLE IMMUNITY ROUTES |
| US9770463B2 (en) | 2010-07-06 | 2017-09-26 | Glaxosmithkline Biologicals Sa | Delivery of RNA to different cell types |
| EP3508573A1 (en) | 2010-07-09 | 2019-07-10 | Bioverativ Therapeutics Inc. | Systems for factor viii processing and methods thereof |
| KR20220097518A (en) | 2010-07-09 | 2022-07-07 | 바이오버라티브 테라퓨틱스 인크. | Factor ix polypeptides and methods of use thereof |
| US20130177523A1 (en) | 2010-07-13 | 2013-07-11 | University Of Utah Research Foundation | Gold particles and methods of making and using the same in cancer treatment |
| GB201012410D0 (en) | 2010-07-23 | 2010-09-08 | Medical Res Council | Intracellular immunity |
| CA2801523C (en) | 2010-07-30 | 2021-08-03 | Curevac Gmbh | Complexation of nucleic acids with disulfide-crosslinked cationic components for transfection and immunostimulation |
| CA2807552A1 (en) | 2010-08-06 | 2012-02-09 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| WO2012021516A2 (en) | 2010-08-09 | 2012-02-16 | The Trustees Of The University Of Pennsylvania | Nanoparticle-oligonucletide hybrid structures and methods of use thereof |
| WO2012019630A1 (en) | 2010-08-13 | 2012-02-16 | Curevac Gmbh | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
| AU2011291582A1 (en) | 2010-08-20 | 2013-03-07 | Cerulean Pharma Inc. | Conjugates, particles, compositions, and related methods |
| EP2605816B1 (en) | 2010-08-20 | 2019-01-23 | University Of Washington | Circumferential aerosol device for delivering drugs to olfactory epithelium and brain |
| ES2531577T3 (en) | 2010-08-20 | 2015-03-17 | Novartis Ag | Needle sets for administration of soluble flu vaccine |
| LT4066819T (en) | 2010-08-31 | 2023-04-11 | Glaxosmithkline Biologicals Sa | Small liposomes for delivery of immunogen-encoding rna |
| RS63329B1 (en) | 2010-08-31 | 2022-07-29 | Glaxosmithkline Biologicals Sa | Pegylated liposomes for delivery of immunogen-encoding rna |
| ES2920140T3 (en) | 2010-08-31 | 2022-08-01 | Theraclone Sciences Inc | Human immunodeficiency virus (HIV) neutralizing antibodies |
| US20130189351A1 (en) | 2010-08-31 | 2013-07-25 | Novartis Ag | Lipids suitable for liposomal delivery of protein coding rna |
| KR20130100278A (en) | 2010-08-31 | 2013-09-10 | 머크 샤프 앤드 돔 코포레이션 | Novel single chemical entities and methods for delivery of oligonucleotides |
| WO2012031205A2 (en) | 2010-09-03 | 2012-03-08 | The Brigham And Women's Hospital, Inc. | Lipid-polymer hybrid particles |
| WO2012034077A2 (en) | 2010-09-09 | 2012-03-15 | The University Of Chicago | Compositions and methods related to attenuated staphylococcal strains |
| JP5793194B2 (en) | 2010-09-09 | 2015-10-14 | ザ・ユニバーシティ・オブ・シカゴThe University Of Chicago | Methods and compositions involving protective staphylococcal antigens |
| US10307372B2 (en) | 2010-09-10 | 2019-06-04 | The Johns Hopkins University | Rapid diffusion of large polymeric nanoparticles in the mammalian brain |
| US8466122B2 (en) | 2010-09-17 | 2013-06-18 | Protiva Biotherapeutics, Inc. | Trialkyl cationic lipids and methods of use thereof |
| EP3144015B1 (en) | 2010-09-20 | 2021-06-02 | Sirna Therapeutics, Inc. | Low molecular weight cationic lipids for oligonucleotide delivery |
| WO2012038448A1 (en) | 2010-09-21 | 2012-03-29 | Riboxx Gmbh | Method for synthesizing rna using dna template |
| US20130280334A1 (en) | 2010-09-24 | 2013-10-24 | Massachusetts Institute Of Technology | Nanostructured Gels Capable of Controlled Release of Encapsulated Agents |
| WO2012050975A2 (en) | 2010-09-29 | 2012-04-19 | The University Of North Carolina At Chapel Hill | Novel circular mammalian rna molecules and uses thereof |
| WO2012044638A1 (en) | 2010-09-30 | 2012-04-05 | Merck Sharp & Dohme Corp. | Low molecular weight cationic lipids for oligonucleotide delivery |
| PL4108671T3 (en) | 2010-10-01 | 2025-02-24 | Modernatx, Inc. | MODIFIED NUCLEOSIDES, NUCLEOTIDES AND NUCLEIC ACIDS AND THEIR USES |
| US10078075B2 (en) | 2011-12-09 | 2018-09-18 | Vanderbilt University | Integrated organ-on-chip systems and applications of the same |
| ES2716243T3 (en) | 2010-10-11 | 2019-06-11 | Glaxosmithkline Biologicals Sa | Antigen Supply Platforms |
| US9492884B2 (en) | 2010-10-19 | 2016-11-15 | Mitsubishi Electric Corporation | Control device and control method for laser processing machine |
| CA2813024A1 (en) | 2010-10-21 | 2012-04-26 | Merck Sharp & Dohme Corp. | Novel low molecular weight cationic lipids for oligonucleotide delivery |
| EP2632485A4 (en) | 2010-10-29 | 2014-05-28 | Merck Sharp & Dohme | RECOMBINANT SUBUNIT VACCINE AGAINST DENGUE VIRUS |
| CA2816977C (en) | 2010-11-05 | 2019-10-29 | The Johns Hopkins University | Compositions and methods relating to reduced mucoadhesion |
| CN103201386A (en) | 2010-11-09 | 2013-07-10 | 加利福尼亚大学董事会 | Skin-penetrating and cell-entry (SPACE) peptides and methods of use thereof |
| KR102557275B1 (en) | 2010-11-12 | 2023-07-19 | 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 | Consensus prostate antigens nucleic acid molecule encoding the same and vaccine and uses comprising the same |
| BR112013012195A2 (en) | 2010-11-16 | 2018-07-10 | Selecta Biosciences Inc | immunostimulatory oligonucleotide |
| WO2012068360A1 (en) | 2010-11-17 | 2012-05-24 | Aduro Biotech | Methods and compositions for inducing an immune response to egfrviii |
| AU2011329668B2 (en) | 2010-11-19 | 2016-07-28 | Idera Pharmaceuticals, Inc. | Immune regulatory oligonucleotide (IRO) compounds to modulate toll-like receptor based immune response |
| WO2012075040A2 (en) | 2010-11-30 | 2012-06-07 | Shire Human Genetic Therapies, Inc. | mRNA FOR USE IN TREATMENT OF HUMAN GENETIC DISEASES |
| WO2012072096A1 (en) | 2010-12-03 | 2012-06-07 | Biontech Ag | Method for cellular rna expression |
| WO2012103985A2 (en) | 2010-12-16 | 2012-08-09 | Steve Pascolo | Pharmaceutical composition consisting of rna having alkali metal as counter ion and formulated with dications |
| US8501930B2 (en) | 2010-12-17 | 2013-08-06 | Arrowhead Madison Inc. | Peptide-based in vivo siRNA delivery system |
| CA2825370A1 (en) | 2010-12-22 | 2012-06-28 | President And Fellows Of Harvard College | Continuous directed evolution |
| EP3147367A1 (en) | 2010-12-29 | 2017-03-29 | F. Hoffmann-La Roche AG | Small molecule conjugates for intracellular delivery of nucleic acids |
| WO2012089225A1 (en) | 2010-12-29 | 2012-07-05 | Curevac Gmbh | Combination of vaccination and inhibition of mhc class i restricted antigen presentation |
| EP2661255B1 (en) | 2011-01-04 | 2021-03-10 | Brown University | Nanotubes as carriers of nucleic acids into cells |
| WO2012094574A2 (en) | 2011-01-06 | 2012-07-12 | The Johns Hopkins University | Stabilized polyribonucleotide nanoparticles |
| US20140080766A1 (en) | 2011-01-07 | 2014-03-20 | Massachusetts Institute Of Technology | Compositions and methods for macromolecular drug delivery |
| DK2663548T3 (en) | 2011-01-11 | 2017-07-24 | Alnylam Pharmaceuticals Inc | PEGYLED LIPIDS AND THEIR USE FOR PHARMACEUTICAL SUPPLY |
| WO2012099805A2 (en) | 2011-01-19 | 2012-07-26 | Ocean Nanotech, Llc | Nanoparticle based immunological stimulation |
| WO2012101235A1 (en) | 2011-01-26 | 2012-08-02 | Cenix Bioscience Gmbh | Delivery system and conjugates for compound delivery via naturally occurring intracellular transport routes |
| US10363309B2 (en) | 2011-02-04 | 2019-07-30 | Case Western Reserve University | Targeted nanoparticle conjugates |
| US20140066363A1 (en) | 2011-02-07 | 2014-03-06 | Arun K. Bhunia | Carbohydrate nanoparticles for prolonged efficacy of antimicrobial peptide |
| WO2012116715A1 (en) | 2011-03-02 | 2012-09-07 | Curevac Gmbh | Vaccination in newborns and infants |
| US20120207840A1 (en) | 2011-02-10 | 2012-08-16 | Aura Biosciences, Inc. | Virion Derived Protein Nanoparticles For Delivering Diagnostic Or Therapeutic Agents For The Treatment Of Non-Melanoma Skin Cancer |
| AU2012217788A1 (en) | 2011-02-14 | 2013-08-29 | Swift Biosciences, Inc. | Polynucleotide primers and probes |
| WO2012112689A1 (en) | 2011-02-15 | 2012-08-23 | The University Of North Carolina At Chapel Hill | Nanoparticle, liposomes, polymers, agents and proteins modified with reversible linkers |
| EP2675918B1 (en) | 2011-02-15 | 2017-11-08 | Merrimack Pharmaceuticals, Inc. | Compositions and methods for delivering nucleic acid to a cell |
| EP2489371A1 (en) | 2011-02-18 | 2012-08-22 | Instituto Nacional de Investigacion y Tecnologia Agraria y Alimentaria | Carrier peptides for drug delivery |
| WO2012113413A1 (en) | 2011-02-21 | 2012-08-30 | Curevac Gmbh | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
| WO2012115980A1 (en) | 2011-02-22 | 2012-08-30 | California Institute Of Technology | Delivery of proteins using adeno-associated virus (aav) vectors |
| US8696637B2 (en) | 2011-02-28 | 2014-04-15 | Kimberly-Clark Worldwide | Transdermal patch containing microneedles |
| WO2012116714A1 (en) | 2011-03-02 | 2012-09-07 | Curevac Gmbh | Vaccination in elderly patients |
| ES2681698T3 (en) | 2011-03-02 | 2018-09-14 | Glaxosmithkline Biologicals Sa | Combination vaccines with lower doses of antigen and / or adjuvant |
| EP2683812A4 (en) | 2011-03-07 | 2014-12-03 | Massachusetts Inst Technology | METHODS FOR TRANSFECTING CELLS WITH NUCLEIC ACIDS |
| WO2012125680A1 (en) | 2011-03-16 | 2012-09-20 | Novartis Ag | Methods of treating vasculitis using an il-17 binding molecule |
| US20140212503A1 (en) | 2011-03-17 | 2014-07-31 | Hyukjin Lee | Delivery system |
| RU2013146242A (en) | 2011-03-17 | 2015-04-27 | Новартис Аг | FGFR AND ITS LIGANDS AS BREAST CANCER BIOMARKERS IN HR-POSITIVE INDIVIDUALS |
| US10357568B2 (en) | 2011-03-24 | 2019-07-23 | Glaxosmithkline Biologicals S.A. | Adjuvant nanoemulsions with phospholipids |
| EP2691443B1 (en) | 2011-03-28 | 2021-02-17 | Massachusetts Institute of Technology | Conjugated lipomers and uses thereof |
| CN103476949A (en) | 2011-03-28 | 2013-12-25 | 诺瓦提斯公司 | Markers associated with cyclin-dependent kinase inhibitors |
| DE12722942T1 (en) | 2011-03-31 | 2021-09-30 | Modernatx, Inc. | RELEASE AND FORMULATION OF MANIPULATED NUCLEIC ACIDS |
| JP2014511694A (en) | 2011-04-03 | 2014-05-19 | ザ ジェネラル ホスピタル コーポレーション ドゥーイング ビジネス アズ マサチューセッツ ジェネラル ホスピタル | Efficient in vivo protein expression using modified RNA (MOD-RNA) |
| ES2587512T3 (en) | 2011-04-04 | 2016-10-25 | The U.S.A. As Represented By The Secretary, Department Of Health And Human Services | 2'-O-aminooxymethyl nucleoside derivatives for use in the synthesis and modification of nucleosides, nucleotides and oligonucleotides |
| WO2012142132A1 (en) | 2011-04-11 | 2012-10-18 | Life Technologies Corporation | Polymer particles and methods of making and using same |
| US11135174B2 (en) | 2011-04-13 | 2021-10-05 | The Trustees Of The University Of Pennsylvania | Coated mesoporous nanoparticles |
| WO2013158127A1 (en) | 2012-04-16 | 2013-10-24 | Molecular Transfer, Inc. | Agents for improved delivery of nucleic acids to eukaryotic cells |
| US20140178894A1 (en) | 2011-04-20 | 2014-06-26 | Novartis Forschungsstiftung, Zweigniederlassung | Culture medium suitable for the culture of undifferentiated cells |
| EA034702B1 (en) | 2011-04-26 | 2020-03-10 | Молекулар Экспресс, Инк. | Liposomal compositions |
| CA2834365A1 (en) | 2011-04-28 | 2012-11-01 | Sandia Corporation | Porous nanoparticle-supported lipid bilayers (protocells) for targeted delivery and methods of using same |
| US20160272697A2 (en) | 2011-04-28 | 2016-09-22 | The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. | Neutralizing Antibodies to Nipah and Hendra Virus |
| WO2012149246A1 (en) | 2011-04-29 | 2012-11-01 | Novartis Ag | Methods of treating squamous cell carcinoma related applications |
| CA3182519A1 (en) | 2011-04-29 | 2012-11-01 | Selecta Biosciences, Inc. | Tolerogenic synthetic nanocarriers for antigen-specific deletion of t effector cells |
| UA116189C2 (en) | 2011-05-02 | 2018-02-26 | Мілленніум Фармасьютікалз, Інк. | COMPOSITION OF ANTI-α4β7 ANTIBODY |
| EP3777538B1 (en) | 2011-05-02 | 2023-06-28 | Wayne State University | A protein-induced pluripotent cell technology and uses thereof |
| US8945588B2 (en) | 2011-05-06 | 2015-02-03 | The University Of Chicago | Methods and compositions involving protective staphylococcal antigens, such as EBH polypeptides |
| US9650745B2 (en) | 2011-05-10 | 2017-05-16 | Basf Se | Oil-in-water emulsions |
| US9283279B2 (en) | 2011-05-11 | 2016-03-15 | Ramot At Tel-Aviv University Ltd. | Targeted polymeric conjugates and uses thereof |
| EP2706983A1 (en) | 2011-05-12 | 2014-03-19 | Helmut Vockner | Novel pharmaceutical formulation |
| EP2706988B1 (en) | 2011-05-12 | 2019-12-04 | Yissum Research Development Company of the Hebrew University of Jerusalem Ltd. | Liposomes comprising polymer-conjugated lipids and related uses |
| LT3275892T (en) | 2011-05-13 | 2020-04-10 | Glaxosmithkline Biologicals S.A. | Pre-fusion rsv f antigens |
| CN103687957A (en) | 2011-05-17 | 2014-03-26 | 现代治疗公司 | Engineered nucleic acids and methods for their use in non-human vertebrates |
| US8691750B2 (en) | 2011-05-17 | 2014-04-08 | Axolabs Gmbh | Lipids and compositions for intracellular delivery of biologically active compounds |
| CN103052757B (en) | 2011-05-20 | 2015-02-25 | 科勒公司 | Toilet installation system and method |
| HUE046152T2 (en) | 2011-05-24 | 2020-02-28 | Biontech Rna Pharmaceuticals Gmbh | Individualized vaccines for cancer |
| CA2836844A1 (en) | 2011-05-25 | 2012-11-29 | Novartis Ag | Biomarkers for lung cancer |
| US20140308363A1 (en) | 2011-05-31 | 2014-10-16 | Bind Therapeutics, Inc. | Drug loaded polymeric nanoparticles and methods of making and using same |
| ES2685333T3 (en) | 2011-06-02 | 2018-10-08 | The Regents Of The University Of California | Membrane encapsulated nanoparticles and method of use |
| CA2837852A1 (en) | 2011-06-02 | 2012-12-06 | Novartis Ag | Biomarkers for hedgehog inhibitor therapy |
| US9181553B2 (en) | 2011-06-06 | 2015-11-10 | Novartis Forschungsstiftung Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Method of treatment of breast cancers over-expressing the SHP2 signature genes |
| DK3336082T3 (en) | 2011-06-08 | 2020-04-27 | Translate Bio Inc | SPLITLY LIPIDS |
| PL2717893T3 (en) † | 2011-06-08 | 2019-12-31 | Translate Bio, Inc. | Lipid nanoparticle compositions and methods for mRNA delivery |
| WO2012168491A1 (en) | 2011-06-10 | 2012-12-13 | Novartis Ag | Pharmaceutical formulations of pcsk9 antagonists |
| US8636696B2 (en) | 2011-06-10 | 2014-01-28 | Kimberly-Clark Worldwide, Inc. | Transdermal device containing microneedles |
| WO2012170607A2 (en) | 2011-06-10 | 2012-12-13 | Novartis Ag | Use of pcsk9 antagonists |
| WO2012170753A2 (en) | 2011-06-10 | 2012-12-13 | Novartis Ag | Bovine vaccines and methods |
| US8916696B2 (en) | 2011-06-12 | 2014-12-23 | City Of Hope | Aptamer-mRNA conjugates for targeted protein or peptide expression and methods for their use |
| WO2012172495A1 (en) | 2011-06-14 | 2012-12-20 | Novartis Ag | Compositions and methods for antibodies targeting tem8 |
| CN103717249B (en) | 2011-06-15 | 2017-03-22 | 克洛恩泰克制药股份公司 | Injection needle and device |
| US20140193408A1 (en) | 2011-06-16 | 2014-07-10 | Novartis Ag | Soluble proteins for use as therapeutics |
| RU2612900C2 (en) | 2011-06-20 | 2017-03-13 | Юниверсити Оф Питтсбург - Оф Зе Коммонвэлс Систем Оф Хайе Эдьюкейшн | H1n1 influenza virus antigens with wide spectrum of activity, optimized using computer tools |
| US9862926B2 (en) | 2011-06-27 | 2018-01-09 | Cellscript, Llc. | Inhibition of innate immune response |
| ES2992120T3 (en) | 2011-06-28 | 2024-12-09 | Inovio Pharmaceuticals Inc | A minimally invasive dermal electroporation device |
| ES2692519T3 (en) | 2011-07-01 | 2018-12-04 | Novartis Ag | Method to treat metabolic disorders |
| WO2013003887A1 (en) | 2011-07-04 | 2013-01-10 | Commonwealth Scientific And Industrial Research Organisation | Nucleic acid complex |
| EP2729126B1 (en) | 2011-07-06 | 2020-12-23 | GlaxoSmithKline Biologicals SA | Liposomes having useful n:p ratio for delivery of rna molecules |
| JP2014520807A (en) | 2011-07-06 | 2014-08-25 | ノバルティス アーゲー | Immunogenic compositions and uses thereof |
| US9655845B2 (en) | 2011-07-06 | 2017-05-23 | Glaxosmithkline Biologicals, S.A. | Oil-in-water emulsions that contain nucleic acids |
| RU2649133C2 (en) | 2011-07-06 | 2018-03-29 | Новартис Аг | Cationic oil-in-water emulsions |
| WO2013006838A1 (en) | 2011-07-06 | 2013-01-10 | Novartis Ag | Immunogenic combination compositions and uses thereof |
| US8975302B2 (en) | 2011-07-07 | 2015-03-10 | Life Technologies Corporation | Polymer particles, nucleic acid polymer particles and methods of making and using the same |
| US20130012566A1 (en) | 2011-07-10 | 2013-01-10 | Aura Biosciences, Inc. | Virion Derived Protein Nanoparticles For Delivering Diagnostic Or Therapeutic Agents For The Treatment of Alopecia |
| US9617392B2 (en) | 2011-07-10 | 2017-04-11 | President And Fellows Of Harvard College | Compositions and methods for self-assembly of polymers with complementary macroscopic and microscopic scale units |
| WO2013009717A1 (en) | 2011-07-10 | 2013-01-17 | Elisabet De Los Pinos | Virion derived protein nanoparticles for delivering diagnostic or therapeutic agents for the treatment of skin-related diseases |
| GB2492999A (en) | 2011-07-20 | 2013-01-23 | Univ Central Lancashire | Neutron detector |
| US20140148503A1 (en) | 2011-07-20 | 2014-05-29 | University Of Iowa Research Foundation | Nucleic acid aptamers |
| CN103732211B (en) | 2011-07-21 | 2017-03-01 | 禾大国际股份公开有限公司 | Branched polyether block polyamides copolymer and its manufacture and use method |
| US9493549B2 (en) | 2011-07-25 | 2016-11-15 | The Rockefeller University | Antibodies directed toward the HIV-1 GP120 CD4 binding site with increased potency and breadth |
| ES2687129T3 (en) | 2011-07-25 | 2018-10-23 | Glaxosmithkline Biologicals Sa | Compositions and methods to evaluate the functional immunogenicity of parvovirus vaccines |
| WO2013019648A1 (en) | 2011-07-29 | 2013-02-07 | Selecta Biosciences, Inc. | Control of antibody responses to synthetic nanocarriers |
| WO2013025834A2 (en) | 2011-08-15 | 2013-02-21 | The University Of Chicago | Compositions and methods related to antibodies to staphylococcal protein a |
| CN104024328A (en) | 2011-08-26 | 2014-09-03 | 箭头研究公司 | Poly(vinyl ester) polymers for in vivo nucleic acid delivery |
| HRP20190032T1 (en) | 2011-08-31 | 2019-02-22 | Glaxosmithkline Biologicals Sa | PEGILATED LIPOSOMS, INTENDED FOR RNA IMPROVEMENT, CODING IMMUNOGEN |
| EP2750712A2 (en) | 2011-08-31 | 2014-07-09 | Mallinckrodt LLC | Nanoparticle peg modification with h-phosphonates |
| US9126966B2 (en) | 2011-08-31 | 2015-09-08 | Protiva Biotherapeutics, Inc. | Cationic lipids and methods of use thereof |
| JP2014525462A (en) | 2011-09-01 | 2014-09-29 | アイアールエム・リミテッド・ライアビリティ・カンパニー | Compounds and compositions as PDGFR kinase inhibitors |
| EP2751272A2 (en) | 2011-09-02 | 2014-07-09 | Novartis AG | Organic compositions to treat hsf1-related diseases |
| EP2755986A4 (en) | 2011-09-12 | 2015-05-20 | Moderna Therapeutics Inc | MODIFIED NUCLEIC ACIDS AND METHODS OF USE |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| WO2013039861A2 (en) | 2011-09-12 | 2013-03-21 | modeRNA Therapeutics | Engineered nucleic acids and methods of use thereof |
| WO2013038375A2 (en) | 2011-09-14 | 2013-03-21 | Novartis Ag | Methods for making saccharide-protein glycoconjugates |
| SG11201400527XA (en) | 2011-09-16 | 2014-04-28 | Univ Pennsylvania | Rna engineered t cells for the treatment of cancer |
| EP2747761A1 (en) | 2011-09-22 | 2014-07-02 | Bind Therapeutics, Inc. | Methods of treating cancers with therapeutic nanoparticles |
| WO2013072929A2 (en) | 2011-09-23 | 2013-05-23 | Indian Institute Of Technology | Nanop article based cosmetic composition |
| US9458214B2 (en) | 2011-09-26 | 2016-10-04 | Novartis Ag | Dual function fibroblast growth factor 21 proteins |
| JO3476B1 (en) | 2011-09-26 | 2020-07-05 | Novartis Ag | Fusion proteins for treating metabolic disorders |
| AU2012315965A1 (en) | 2011-09-27 | 2014-04-03 | Alnylam Pharmaceuticals, Inc. | Di-aliphatic substituted PEGylated lipids |
| WO2013045505A1 (en) | 2011-09-28 | 2013-04-04 | Novartis Ag | Biomarkers for raas combination therapy |
| KR102014061B1 (en) | 2011-10-03 | 2019-08-28 | 모더나 세라퓨틱스, 인코포레이티드 | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| WO2013055971A1 (en) | 2011-10-11 | 2013-04-18 | Arizona Board Of Regents For And On Behalf Of Arizona State University | Polymers for delivering a substance into a cell |
| WO2013055905A1 (en) | 2011-10-11 | 2013-04-18 | Novartis Ag | Recombinant self-replicating polycistronic rna molecules |
| WO2013055331A1 (en) | 2011-10-12 | 2013-04-18 | The Curators Of The University Of Missouri | Pentablock polymers |
| WO2014066811A1 (en) | 2012-10-25 | 2014-05-01 | The Johns Hopkins University | Bioreducible poly (b-amino ester)s for sirna delivery |
| CA2852064A1 (en) | 2011-10-14 | 2013-04-18 | Stc.Unm | Porous nanoparticle-supported lipid bilayers (protocells) for targeted delivery including transdermal delivery of cargo and methods thereof |
| WO2013054307A2 (en) | 2011-10-14 | 2013-04-18 | Novartis Ag | Antibodies and methods for wnt pathway-related diseases |
| ES2745373T3 (en) | 2011-10-18 | 2020-03-02 | Dicerna Pharmaceuticals Inc | Cationic amine lipids and their use |
| CN104093445B (en) | 2011-10-18 | 2016-09-07 | 米歇尔技术公司 | drug delivery medical device |
| AU2012324398A1 (en) | 2011-10-20 | 2014-05-01 | Seqirus UK Limited | Adjuvanted influenza B virus vaccines for pediatric priming |
| EP2768507B1 (en) | 2011-10-20 | 2019-12-11 | Novartis AG | Biomarkers predictive of responsiveness to alpha 7 nicotinic acetylcholine receptor activator treatment |
| CA2853316C (en) | 2011-10-25 | 2018-11-27 | The University Of British Columbia | Limit size lipid nanoparticles and related methods |
| US20130110043A1 (en) | 2011-10-26 | 2013-05-02 | Nanopass Technologies Ltd. | Microneedle Intradermal Drug Delivery Device with Auto-Disable Functionality |
| WO2013063468A1 (en) | 2011-10-27 | 2013-05-02 | Massachusetts Institute Of Technology | Amino acid derivates functionalized on the n- terminal capable of forming drug incapsulating microspheres |
| KR102388880B1 (en) | 2011-10-27 | 2022-04-22 | 소렌토 쎄라퓨틱스, 인코포레이티드 | Transdermal delivery of high viscosity bioactive agents |
| US9364542B2 (en) | 2011-10-28 | 2016-06-14 | Excelse Bio, Inc. | Protein formulations containing amino acids |
| WO2013062140A1 (en) | 2011-10-28 | 2013-05-02 | Kyoto University | Method for efficiently inducing differentiation of pluripotent stem cells into hepatic lineage cells |
| SG10201508662SA (en) | 2011-10-28 | 2015-11-27 | Presage Biosciences Inc | Methods for drug delivery |
| LT3091029T (en) | 2011-10-31 | 2023-02-27 | F. Hoffmann-La Roche Ag | Anti-il13 antibody formulations |
| CN104023793B (en) | 2011-10-31 | 2017-11-24 | 马林克罗特有限公司 | Joint liposome composition for treating cancer |
| CA2853689C (en) | 2011-11-04 | 2020-06-30 | Nitto Denko Corporation | Method of producing lipid nanoparticles for drug delivery |
| US9579338B2 (en) | 2011-11-04 | 2017-02-28 | Nitto Denko Corporation | Method of producing lipid nanoparticles for drug delivery |
| US10449257B2 (en) | 2011-11-04 | 2019-10-22 | Agency For Science, Technology And Research | Self-assembled composite ultrasmall peptide-polymer hydrogels |
| WO2013067537A1 (en) | 2011-11-04 | 2013-05-10 | Univertiy Of Notre Dame Du Lac | Nanoparticle-based drug delivery |
| JP2015502741A (en) | 2011-11-04 | 2015-01-29 | ノバルティス アーゲー | Low density lipoprotein related protein 6 (LRP6)-half-life extended construct |
| US20130115247A1 (en) | 2011-11-05 | 2013-05-09 | Aura Biosciences, Inc. | Virion Derived Protein Nanoparticles For Delivering Radioisotopes For The Diagnosis And Treatment Of Malignant And Systemic Disease And The Monitoring Of Therapy |
| US20130116408A1 (en) | 2011-11-05 | 2013-05-09 | Aura Biosciences, Inc. | Virion Derived Protein Nanoparticles For Delivering Radioisotopes For The Diagnosis And Treatment Of Malignant And Systemic Disease And The Monitoring Of Therapy |
| WO2013068431A1 (en) | 2011-11-08 | 2013-05-16 | Novartis Forschungsstiftung, Zweigniederlassung, Friedrich Miescher Institute For Biomedical Research | New treatment for neurodegenerative diseases |
| US20140287510A1 (en) | 2011-11-08 | 2014-09-25 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute | Rod cell-specific promoter |
| EP2776838A1 (en) | 2011-11-08 | 2014-09-17 | Novartis Forschungsstiftung, Zweigniederlassung Friedrich Miescher Institute For Biomedical Research | Early diagnostic of neurodegenerative diseases |
| US9849087B2 (en) | 2011-11-08 | 2017-12-26 | The Board Of Trustees Of The University Of Arkansas | Methods and compositions for X-ray induced release from pH sensitive liposomes |
| US10203325B2 (en) | 2011-11-09 | 2019-02-12 | Board Of Trustees Of Michigan State University | Metallic nanoparticle synthesis with carbohydrate capping agent |
| KR102301463B1 (en) | 2011-11-11 | 2021-09-14 | 배리에이션 바이오테크놀로지스 아이엔씨. | Compositions and methods for treatment of cytomegalovirus |
| WO2013071047A1 (en) | 2011-11-11 | 2013-05-16 | Children's Medical Center Corporation | Compositions and methods for in vitro transcription of rna |
| AU2012340035A1 (en) | 2011-11-14 | 2014-04-17 | Susan W. Barnett | Immunogenic complexes of polyanionic carbomers and Env polypeptides and methods of manufacture and use thereof |
| CA2855619A1 (en) | 2011-11-15 | 2013-05-23 | Novartis Ag | Combination of a phosphoinositide 3-kinase inhibitor and a modulator of the janus kinase 2 - signal transducer and activator of transcription 5 pathway |
| PL2790681T5 (en) | 2011-11-18 | 2024-02-05 | Regeneron Pharmaceuticals, Inc. | Method of manufacturing an extended release pharmaceutical formulation comprising polymer coated protein microparticles using spray-drying |
| CA2856252A1 (en) | 2011-11-21 | 2013-05-30 | Novartis Ag | Methods of treating psoriatic arthritis (psa) using il-17 antagonists and psa response or non-response alleles |
| WO2013078199A2 (en) | 2011-11-23 | 2013-05-30 | Children's Medical Center Corporation | Methods for enhanced in vivo delivery of synthetic, modified rnas |
| WO2013082111A2 (en) | 2011-11-29 | 2013-06-06 | The University Of North Carolina At Chapel Hill | Geometrically engineered particles and methods for modulating macrophage or immune responses |
| US9364549B2 (en) | 2011-11-30 | 2016-06-14 | Andreas Voigt | Hydrophobic drug-delivery material, method for manufacturing thereof and methods for delivery of a drug-delivery composition |
| CA2857502C (en) | 2011-11-30 | 2019-08-13 | 3M Innovative Properties Company | Microneedle device including a peptide therapeutic agent and an amino acid and methods of making and using the same |
| US20130142781A1 (en) | 2011-12-02 | 2013-06-06 | Invivo Therapeutics Corporation | Peg based hydrogel for peripheral nerve injury applications and compositions and method of use of synthetic hydrogel sealants |
| WO2013082529A1 (en) | 2011-12-02 | 2013-06-06 | Yale University | Enzymatic synthesis of poly(amine-co-esters) and methods of use thereof for gene delivery |
| AU2012345726B2 (en) | 2011-12-02 | 2017-04-13 | Pegasus Laboratories, Inc. | Amphipathic lipid-based sustained release compositions |
| US8497124B2 (en) | 2011-12-05 | 2013-07-30 | Factor Bioscience Inc. | Methods and products for reprogramming cells to a less differentiated state |
| MX382822B (en) | 2011-12-05 | 2025-03-13 | Factor Bioscience Inc | METHODS AND PRODUCTS FOR CELL TRANSFECTION. |
| CN103998536B (en) | 2011-12-05 | 2017-09-15 | 纳诺精密医疗有限公司 | The device with titania nanotube film for medicine delivery |
| GB201121070D0 (en) | 2011-12-07 | 2012-01-18 | Isis Innovation | composition for delivery of biotherapeutics |
| US9463247B2 (en) | 2011-12-07 | 2016-10-11 | Alnylam Pharmaceuticals, Inc. | Branched alkyl and cycloalkyl terminated biodegradable lipids for the delivery of active agents |
| JP6305344B2 (en) | 2011-12-07 | 2018-04-04 | アルニラム・ファーマシューティカルズ・インコーポレーテッド | Biodegradable lipids for delivery of active agents |
| US20140308304A1 (en) | 2011-12-07 | 2014-10-16 | Alnylam Pharmaceuticals, Inc. | Lipids for the delivery of active agents |
| WO2013086486A1 (en) | 2011-12-09 | 2013-06-13 | President And Fellows Of Harvard College | Integrated human organ-on-chip microphysiological systems |
| US10087422B2 (en) | 2011-12-09 | 2018-10-02 | President And Fellows Of Harvard College | Organ chips and uses thereof |
| EP2787977A4 (en) | 2011-12-09 | 2015-05-06 | Univ California | LIPOSOMAL ENCAPSULATION OF MEDICAMENTS |
| JP6182457B2 (en) | 2011-12-12 | 2017-08-16 | 協和発酵キリン株式会社 | Lipid nanoparticles for drug delivery systems containing cationic lipids |
| AU2012352455B2 (en) | 2011-12-12 | 2016-01-21 | The Trustees Of The University Of Pennsylvania | Proteins comprising MRSA PBP2a and fragments thereof, nucleic acids encoding the same, and compositions and their use to prevent and treat MRSA infections |
| US20140045913A1 (en) | 2011-12-12 | 2014-02-13 | Kyowa Hakko Kirin Co., Ltd. | Lipid nano particles comprising combination of cationic lipid |
| US20150000936A1 (en) | 2011-12-13 | 2015-01-01 | Schlumberger Technology Corporation | Energization of an element with a thermally expandable material |
| SG10201601349XA (en) | 2011-12-13 | 2016-03-30 | Engeneic Molecular Delivery Pty Ltd | Bacterially derived, intact minicells for delivery of therapeutic agents to brain tumors |
| EP2604253A1 (en) | 2011-12-13 | 2013-06-19 | Otto Glatter | Water-in-oil emulsions and methods for their preparation |
| EP2791364A4 (en) | 2011-12-14 | 2015-11-11 | Moderna Therapeutics Inc | METHODS OF RESPONSE TO A BIOLOGICAL THREAT |
| US20140343129A1 (en) | 2011-12-14 | 2014-11-20 | Moderna Therapeutics, Inc. | Modified nucleic acids, and acute care uses thereof |
| US20140349320A1 (en) | 2011-12-15 | 2014-11-27 | The Trustees Of The University Of Pennsylvania | Using Adaptive Immunity to Detect Drug Resistance |
| WO2013087083A1 (en) | 2011-12-15 | 2013-06-20 | Biontech Ag | Particles comprising single stranded rna and double stranded rna for immunomodulation |
| CA3018046A1 (en) | 2011-12-16 | 2013-06-20 | Moderna Therapeutics, Inc. | Modified nucleoside, nucleotide, and nucleic acid compositions |
| EP2791172B1 (en) | 2011-12-16 | 2017-07-19 | Synthon Biopharmaceuticals B.V. | Compounds and methods for treating inflammatory diseases |
| RU2014129268A (en) | 2011-12-16 | 2016-02-10 | Аллерган, Инк. | OPHTHALMIC COMPOSITIONS THAT CONTAIN GRAVITY POLYVINYL POLYVINYL PROCALT-POLYVINYL ACETATE-POLYETHYLENE Glycol copolymers |
| EP2790761B1 (en) | 2011-12-16 | 2022-05-11 | Novartis AG | Passive powder aerosolization apparatus |
| IN2014DN05912A (en) | 2011-12-16 | 2015-06-05 | Massachusetts Inst Technology | |
| WO2013090601A2 (en) | 2011-12-16 | 2013-06-20 | Massachusetts Institute Of Technology | Compact nanoparticles for biological applications |
| WO2013091001A1 (en) | 2011-12-19 | 2013-06-27 | The University Of Sydney | A peptide-hydrogel composite |
| US9241829B2 (en) | 2011-12-20 | 2016-01-26 | Abbott Medical Optics Inc. | Implantable intraocular drug delivery apparatus, system and method |
| RU2014129863A (en) | 2011-12-21 | 2016-02-10 | Модерна Терапьютикс, Инк. | WAYS TO INCREASE VITALITY OR INCREASE THE LIFE OF A BODY OR EXPLANATE BODY |
| EP2793941A1 (en) | 2011-12-23 | 2014-10-29 | F.Hoffmann-La Roche Ag | Articles of manufacture and methods for co-administration of antibodies |
| KR101963230B1 (en) | 2011-12-26 | 2019-03-29 | 삼성전자주식회사 | Protein complex comprising multi-specific monoclonal antibodies |
| WO2013101908A1 (en) | 2011-12-27 | 2013-07-04 | Massachusetts Institute Of Technology | Microneedle devices and uses thereof |
| EP2797624A1 (en) | 2011-12-29 | 2014-11-05 | Novartis AG | Adjuvanted combinations of meningococcal factor h binding proteins |
| EP2797634A4 (en) | 2011-12-29 | 2015-08-05 | Moderna Therapeutics Inc | MODIFIED mRNA ENCODING POLYPEPTIDES PENETRATING IN CELLS |
| CA2862377A1 (en) | 2011-12-30 | 2013-07-04 | Cellscript, Llc | Making and using in vitro-synthesized ssrna for introducing into mammalian cells to induce a biological or biochemical effect |
| HK1201452A1 (en) | 2012-01-06 | 2015-09-04 | Gemphire Therapeutics Inc. | Methods of reducing risk of cardiovascular disease |
| WO2013106496A1 (en) | 2012-01-10 | 2013-07-18 | modeRNA Therapeutics | Methods and compositions for targeting agents into and across the blood-brain barrier |
| CN104245925A (en) | 2012-01-26 | 2014-12-24 | 生命科技公司 | Method for increasing viral infectivity |
| KR20140128966A (en) | 2012-01-26 | 2014-11-06 | 라이프 테크놀로지스 코포레이션 | Methods for increasing the infectivity of viruses |
| WO2013113325A1 (en) | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Negatively charged nucleic acid comprising complexes for immunostimulation |
| WO2013113326A1 (en) | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
| EP2623121A1 (en) | 2012-01-31 | 2013-08-07 | Bayer Innovation GmbH | Pharmaceutical composition comprising a polymeric carrier cargo complex and an antigen |
| US9243085B2 (en) | 2012-02-09 | 2016-01-26 | Life Technologies Corporation | Hydrophilic polymeric particles and methods for making and using same |
| HK1205751A1 (en) | 2012-02-22 | 2015-12-24 | Cerulean Pharma Inc. | Conjugates, particles, compositions, and related methods |
| US20130243867A1 (en) | 2012-02-23 | 2013-09-19 | University Of South Florida (A Florida Non-Profit Corporation) | Micelle compositions and methods for their use |
| US20130224268A1 (en) | 2012-02-27 | 2013-08-29 | Newgen Biopharma Corp. | Topical delivery of hormonal and non hormonal nano formulations, methods of making and using the same |
| EP2820047B1 (en) | 2012-03-01 | 2018-04-25 | Amgen Research (Munich) GmbH | Long life polypeptide binding molecules |
| DE112013001457T5 (en) | 2012-03-13 | 2014-12-04 | University Of Kwazulu-Natal | Transdermal application system |
| US10322089B2 (en) | 2012-03-14 | 2019-06-18 | The Board Of Trustees Of The Leland Stanford Junior University | Nanoparticles, nanoparticle delivery methods, and systems of delivery |
| MX354811B (en) | 2012-03-16 | 2018-03-22 | Merck Patent Gmbh | Targeting aminoacid lipids. |
| EP2825207B1 (en) | 2012-03-16 | 2020-08-19 | The Johns Hopkins University | Non-linear multiblock copolymer-drug conjugates for the delivery of active agents |
| US8962577B2 (en) | 2012-03-16 | 2015-02-24 | The Johns Hopkins University | Controlled release formulations for the delivery of HIF-1 inhibitors |
| US9610346B2 (en) | 2012-03-23 | 2017-04-04 | International Aids Vaccine Initiative | Recombinant viral vectors |
| WO2013142349A1 (en) | 2012-03-23 | 2013-09-26 | University Of Chicago | Compositions and methods related to staphylococcal sbi |
| WO2013148186A1 (en) | 2012-03-26 | 2013-10-03 | President And Fellows Of Harvard College | Lipid-coated nucleic acid nanostructures of defined shape |
| WO2013143555A1 (en) | 2012-03-26 | 2013-10-03 | Biontech Ag | Rna formulation for immunotherapy |
| SG10201607966UA (en) | 2012-03-27 | 2016-11-29 | Curevac Ag | Artificial nucleic acid molecules comprising a 5'top utr |
| CA2859452C (en) | 2012-03-27 | 2021-12-21 | Curevac Gmbh | Artificial nucleic acid molecules for improved protein or peptide expression |
| AU2013242403B2 (en) | 2012-03-27 | 2018-10-18 | Curevac Ag | Artificial nucleic acid molecules |
| EP2830594B1 (en) | 2012-03-27 | 2018-05-09 | Sirna Therapeutics, Inc. | DIETHER BASED BIODEGRADABLE CATIONIC LIPIDS FOR siRNA DELIVERY |
| WO2013149141A1 (en) | 2012-03-29 | 2013-10-03 | Shire Human Genetic Therapies, Inc. | Lipid-derived neutral nanoparticles |
| US20150050354A1 (en) | 2012-04-02 | 2015-02-19 | Moderna Therapeutics, Inc. | Modified polynucleotides for the treatment of otic diseases and conditions |
| HK1206636A1 (en) | 2012-04-02 | 2016-01-15 | Modernatx, Inc. | Modified polynucleotides for the production of oncology-related proteins and peptides |
| US20140275229A1 (en) | 2012-04-02 | 2014-09-18 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding udp glucuronosyltransferase 1 family, polypeptide a1 |
| HK1206612A1 (en) | 2012-04-02 | 2016-01-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of secreted proteins |
| US9303079B2 (en) | 2012-04-02 | 2016-04-05 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| WO2013151650A1 (en) | 2012-04-05 | 2013-10-10 | University Of Florida Research Foundation, Inc. | Neurophilic nanoparticles |
| US9107904B2 (en) | 2012-04-05 | 2015-08-18 | Massachusetts Institute Of Technology | Immunostimulatory compositions and methods of use thereof |
| WO2013152351A2 (en) | 2012-04-06 | 2013-10-10 | The Trustees Of Columbia University In The City Of New York | Fusion polypeptides and methods of use thereof |
| WO2013153550A2 (en) | 2012-04-08 | 2013-10-17 | Theracoat Ltd | Reverse thermal hydrogel preparations for use in the treatment of disorders of the urothelium |
| US9078930B2 (en) | 2012-04-11 | 2015-07-14 | Intezyne Technologies, Inc. | Block copolymers for stable micelles |
| WO2013155493A1 (en) | 2012-04-12 | 2013-10-17 | Yale University | Methods of treating inflammatory and autoimmune diseases and disorders |
| WO2013154766A1 (en) | 2012-04-13 | 2013-10-17 | New York University | Microrna control of ldl receptor pathway |
| WO2013155513A1 (en) | 2012-04-13 | 2013-10-17 | President And Fellows Of Harvard College | Devices and methods for in vitro aerosol delivery |
| MX2014001965A (en) | 2012-04-18 | 2014-03-31 | Arrowhead Res Corp | Poly(acrylate) polymers for in vivo nucleic acid delivery. |
| AU2013249548A1 (en) | 2012-04-19 | 2014-11-06 | Sirna Therapeutics, Inc. | Novel diester and triester based low molecular weight, biodegradable cationic lipids for oligonucleotide delivery |
| WO2013163234A1 (en) | 2012-04-23 | 2013-10-31 | Massachusetts Institute Of Technology | Stable layer-by-layer coated particles |
| UA117098C2 (en) | 2012-04-25 | 2018-06-25 | Рег'Юлес Терап'Ютікс Інк. | A COMPOUND CONTAINING MODIFIED OLIGONUCLEOTIDE |
| KR102310775B1 (en) | 2012-05-03 | 2021-10-07 | 칼라 파마슈티컬스, 인크. | Pharmaceutical nanoparticles showing improved mucosal transport |
| JP6392209B2 (en) | 2012-05-04 | 2018-09-19 | ザ・ジョンズ・ホプキンス・ユニバーシティー | Lipid-based drug carriers for rapid permeation through the mucus lining |
| WO2013173657A1 (en) | 2012-05-16 | 2013-11-21 | Micell Technologies, Inc. | Low burst sustained release lipophilic and biologic agent compositions |
| WO2013173582A1 (en) | 2012-05-17 | 2013-11-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Hepatitis c virus neutralizing antibody |
| WO2013173693A1 (en) | 2012-05-18 | 2013-11-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Nanoparticles with enhanced entry into cancer cells |
| BR112014027834A2 (en) | 2012-05-23 | 2017-08-08 | Univ Ohio State | lipid nanoparticle compositions for antisense oligonucleotide delivery |
| ES2719598T3 (en) | 2012-05-25 | 2019-07-11 | Curevac Ag | Reversible immobilization and / or controlled release of nucleic acids contained in nanoparticles by polymeric coatings (biodegradable) |
| NZ702283A (en) | 2012-06-06 | 2016-09-30 | Loma Vista Medical Inc | Inflatable medical devices |
| CN104349794B (en) | 2012-06-08 | 2019-01-04 | 埃泽瑞斯公司 | The lung of mRNA delivers |
| HUE056014T2 (en) | 2012-06-08 | 2022-01-28 | Nitto Denko Corp | Lipids for pharmaceutical preparations |
| JP6561378B2 (en) | 2012-06-08 | 2019-08-21 | トランスレイト バイオ, インコーポレイテッド | Transpulmonary delivery of mRNA to non-pulmonary target cells |
| US20150218252A1 (en) | 2012-06-20 | 2015-08-06 | President And Fellows Of Harvard College | Self-assembling peptides, peptide nanostructures and uses thereof |
| CN104507458B (en) | 2012-06-20 | 2018-05-22 | 滑铁卢大学 | Mucoadhesive nano particle delivery system |
| EP2866833B1 (en) | 2012-06-27 | 2019-05-15 | Merck Sharp & Dohme Corp. | Crystalline anti-human il-23 antibodies |
| US9150841B2 (en) | 2012-06-29 | 2015-10-06 | Shire Human Genetic Therapies, Inc. | Cells for producing recombinant iduronate-2-sulfatase |
| US9415109B2 (en) | 2012-07-06 | 2016-08-16 | Alnylam Pharmaceuticals, Inc. | Stable non-aggregating nucleic acid lipid particle formulations |
| US9956291B2 (en) | 2012-07-10 | 2018-05-01 | Shaker A. Mousa | Nanoformulation and methods of use of thyroid receptor beta1 agonists for liver targeting |
| WO2014014890A1 (en) | 2012-07-16 | 2014-01-23 | Nanoderm Sciences, Inc. | Targeted therapeutic nanoparticles |
| EP2687252A1 (en) | 2012-07-17 | 2014-01-22 | Sanofi-Aventis Deutschland GmbH | Drug delivery device |
| EP2687251A1 (en) | 2012-07-17 | 2014-01-22 | Sanofi-Aventis Deutschland GmbH | Drug delivery device |
| CN112587671A (en) | 2012-07-18 | 2021-04-02 | 博笛生物科技有限公司 | Targeted immunotherapy for cancer |
| WO2014015334A1 (en) | 2012-07-20 | 2014-01-23 | Brown University | System and methods for nanostructure protected delivery of treatment agent and selective release thereof |
| KR20160073936A (en) | 2012-07-24 | 2016-06-27 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | Self-assembly of nucleic acid nanostructures |
| WO2014015422A1 (en) | 2012-07-27 | 2014-01-30 | Ontario Institute For Cancer Research | Cellulose-based nanoparticles for drug delivery |
| GB201213624D0 (en) | 2012-07-27 | 2012-09-12 | Univ Ulster The | Method and system for production of conjugated nanoparticles |
| WO2014025795A1 (en) | 2012-08-07 | 2014-02-13 | Northeastern University | Compositions for the delivery of rna and drugs into cells |
| WO2014024193A1 (en) | 2012-08-07 | 2014-02-13 | Prodel Pharma Ltd. | Compositions and methods for rapid transmucosal delivery of pharmaceutical ingredients |
| SG11201500188YA (en) | 2012-08-08 | 2015-02-27 | Univ Nanyang Tech | Methods of manufacturing hydrogel microparticles having living cells, and compositions for manufacturing a scaffold for tissue engineering |
| AU2013299537A1 (en) | 2012-08-08 | 2015-02-19 | Presage Biosciences, Inc. | Extrusion methods and devices for drug delivery |
| JP2015525799A (en) | 2012-08-10 | 2015-09-07 | ユニバーシティ・オブ・ノース・テキサス・ヘルス・サイエンス・センターUniversity of North Texas Health Science Center | Drug delivery vehicle comprising conjugate of targeting polyamino acid and fatty acid |
| WO2014027006A1 (en) | 2012-08-13 | 2014-02-20 | Edko Pazarlama Tanitim Ticaret Limited Sirketi | Bioadhesive formulations for use in drug delivery |
| CA2884870C (en) | 2012-08-13 | 2022-03-29 | Massachusetts Institute Of Technology | Amine-containing lipidoids and uses thereof |
| EP2884965B1 (en) | 2012-08-14 | 2018-08-08 | Froese, Aaron | Internal structured self assembling liposomes |
| WO2014028209A1 (en) | 2012-08-14 | 2014-02-20 | The Trustees Of The University Of Pennsylvania | Stabilizing shear-thinning hydrogels |
| WO2014028429A2 (en) | 2012-08-14 | 2014-02-20 | Moderna Therapeutics, Inc. | Enzymes and polymerases for the synthesis of rna |
| AU2013302526B2 (en) | 2012-08-15 | 2018-03-22 | The University Of Chicago | Exosome-based therapeutics against neurodegenerative disorders |
| US10179134B2 (en) | 2012-09-05 | 2019-01-15 | Creighton University | Polymeric nanoparticles in a thermosensitive gel for coital-independent vaginal prophylaxis of HIV |
| US8703197B2 (en) | 2012-09-13 | 2014-04-22 | International Business Machines Corporation | Branched polyamines for delivery of biologically active materials |
| NZ705812A (en) | 2012-09-17 | 2018-08-31 | Pfizer | Process for preparing therapeutic nanoparticles |
| WO2014047649A1 (en) | 2012-09-24 | 2014-03-27 | The Regents Of The University Of California | Methods for arranging and packing nucleic acids for unusual resistance to nucleases and targeted delivery for gene therapy |
| WO2014052634A1 (en) | 2012-09-27 | 2014-04-03 | The University Of North Carolina At Chapel Hill | Lipid coated nanoparticles containing agents having low aqueous and lipid solubilities and methods thereof |
| US20150307542A1 (en) | 2012-10-03 | 2015-10-29 | Moderna Therapeutics, Inc. | Modified nucleic acid molecules and uses thereof |
| WO2014053881A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| US20140100178A1 (en) | 2012-10-04 | 2014-04-10 | Aslam Ansari | Composition and methods for site-specific drug delivery to treat malaria and other liver diseases |
| WO2014054026A1 (en) | 2012-10-04 | 2014-04-10 | University Of The Witwatersrand, Johannesburg | Liposomal drug delivery system |
| WO2014053882A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| EP2716655A1 (en) | 2012-10-04 | 2014-04-09 | Institut Pasteur | Neutralizing antibodies directed against Hepatitis C virus ectodomain glycoprotein E2 |
| WO2014053879A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| WO2014053880A1 (en) | 2012-10-04 | 2014-04-10 | Centre National De La Recherche Scientifique | Cell penetrating peptides for intracellular delivery of molecules |
| EP2716689A1 (en) | 2012-10-05 | 2014-04-09 | National University of Ireland, Galway | Polymer comprising a plurality of branches having at least one disulfide group and/or at least one vinyl group |
| WO2014064534A2 (en) | 2012-10-05 | 2014-05-01 | Chrontech Pharma Ab | Injection needle, device, immunogenic compositions and method of use |
| US9931410B2 (en) | 2012-10-09 | 2018-04-03 | The Brigham And Women's Hospital, Inc. | Nanoparticles for targeted delivery of multiple therapeutic agents and methods of use |
| US20140106260A1 (en) | 2012-10-11 | 2014-04-17 | The Trustees Of The University Of Pennsylvania | Core-shell nanoparticulate compositions and methods |
| MX2015004757A (en) | 2012-10-16 | 2015-07-17 | Endocyte Inc | Drug delivery conjugates containing unnatural amino acids and methods for using. |
| EA035012B1 (en) | 2012-10-18 | 2020-04-17 | Рокфеллер Юниверсити (Дзе) | Broadly-neutralizing anti-hiv antibodies |
| AU2013336237A1 (en) | 2012-10-22 | 2015-06-11 | Sabag-Rfa Ltd | A system for delivering therapeutic agents into living cells and cells nuclei |
| WO2014066912A1 (en) | 2012-10-26 | 2014-05-01 | Vanderbilt University | Polymeric nanoparticles |
| MX2015005328A (en) | 2012-10-26 | 2015-09-25 | Nlife Therapeutics S L | COMPOSITIONS AND METHODS FOR SELECTIVE ADMINISTRATION OF OLIGONUCLEOTID MOLECULES TO TYPES OF CELLS. |
| US20150272900A1 (en) | 2012-10-26 | 2015-10-01 | The Johns Hopkins University | Layer-By-Layer Approach to Co-Deliver DNA and siRNA via AuNPs: A Potential Platform for Modifying Release Kinetics |
| WO2014067551A1 (en) | 2012-10-29 | 2014-05-08 | Technische Universität Dortmund | T7 rna polymerase variants and methods of using the same |
| BR122019025681B1 (en) | 2012-11-01 | 2023-04-18 | Factor Bioscience Inc | METHOD FOR INSERTING A NUCLEIC ACID SEQUENCE INTO A SECURE LOCATION OF A GENOME OF A CELL |
| WO2014071072A2 (en) | 2012-11-02 | 2014-05-08 | Pungente Michael D | Novel cationic carotenoid-based lipids for cellular nucleic acid uptake |
| WO2014068542A1 (en) | 2012-11-05 | 2014-05-08 | Fondazione Centro San Raffaele | Novel targets in multiple myeloma and other disorders |
| BR112015010253A2 (en) | 2012-11-06 | 2017-07-11 | Rochal Ind Llc | delivery of biologically active agents using hydrophobic and volatile solvents |
| WO2014074597A1 (en) | 2012-11-06 | 2014-05-15 | President And Fellows Of Harvard College | Compositions and methods relating to complex nucleic acid nanostructures |
| WO2014072997A1 (en) | 2012-11-07 | 2014-05-15 | Council Of Scientific & Industrial Research | Nanocomplex containing amphipathic peptide useful for efficient transfection of biomolecules |
| US9572893B2 (en) | 2012-11-07 | 2017-02-21 | Council Of Scientific And Industrial Research | Nanocomplex containing cationic peptide for biomolecule delivery |
| JP6487328B2 (en) | 2012-11-08 | 2019-03-20 | アルブミディクス リミティド | Albumin variant |
| KR20210133321A (en) | 2012-11-08 | 2021-11-05 | 클리어사이드 바이오메디컬, 인코포레이드 | Methods and devices for the treatment of ocular disease in human subjects |
| HK1211599A1 (en) | 2012-11-08 | 2016-05-27 | Eleven Biotherapeutics, Inc. | Il-6 antagonists and uses thereof |
| TW201428101A (en) | 2012-11-08 | 2014-07-16 | Inviragen Inc | Compositions, methods and uses for dengue virus serotype-4 constructs |
| TR201809547T4 (en) | 2012-11-09 | 2018-07-23 | Biontech Rna Pharmaceuticals Gmbh | Method for cellular RNA expression. |
| WO2014072468A1 (en) | 2012-11-09 | 2014-05-15 | Velin-Pharma A/S | Compositions for pulmonary delivery |
| WO2014071963A1 (en) | 2012-11-09 | 2014-05-15 | Biontech Ag | Method for cellular rna expression |
| US9200119B2 (en) | 2012-11-09 | 2015-12-01 | Momentive Performance Materials Inc. | Silicon-containing zwitterionic linear copolymer composition |
| WO2014074218A1 (en) | 2012-11-12 | 2014-05-15 | Redwood Bioscience, Inc. | Compounds and methods for producing a conjugate |
| US9833502B2 (en) | 2012-11-12 | 2017-12-05 | Genvec, Inc. | Malaria antigens and methods of use |
| GB201220354D0 (en) | 2012-11-12 | 2012-12-26 | Medpharm Ltd | Dermal compositions |
| US9943608B2 (en) | 2012-11-13 | 2018-04-17 | Baylor College Of Medicine | Multi-arm biodegradable polymers for nucleic acid delivery |
| WO2014078636A1 (en) | 2012-11-16 | 2014-05-22 | President And Fellows Of Harvard College | Nucleic acid hydrogel self-assembly |
| US9310374B2 (en) | 2012-11-16 | 2016-04-12 | Redwood Bioscience, Inc. | Hydrazinyl-indole compounds and methods for producing a conjugate |
| EP2919760A4 (en) | 2012-11-19 | 2016-08-03 | Technion Res & Dev Foundation | LIPOSOMES FOR DISTRIBUTION IN VIVO |
| EP2732825B1 (en) | 2012-11-19 | 2015-07-01 | Invivogen | Conjugates of a TLR7 and/or TLR8 agonist and a TLR2 agonist |
| WO2014081849A1 (en) | 2012-11-20 | 2014-05-30 | Phasebio Pharmaceuticals, Inc. | Formulations of active agents for sustained release |
| US20140141037A1 (en) | 2012-11-20 | 2014-05-22 | Novartis Ag | Rsv f prefusion trimers |
| WO2014081300A1 (en) | 2012-11-22 | 2014-05-30 | Tagworks Pharmaceuticals B.V. | Channel protein activatable liposomes |
| EP4245744A3 (en) | 2012-11-22 | 2024-05-01 | Tagworks Pharmaceuticals B.V. | Chemically cleavable group |
| WO2014081299A1 (en) | 2012-11-22 | 2014-05-30 | Tagworks Pharmaceuticals B.V. | Activatable liposomes |
| SMT202200337T1 (en) | 2012-11-26 | 2022-09-14 | Modernatx Inc | Terminally modified rna |
| EP2931914A4 (en) | 2012-12-13 | 2016-08-17 | Moderna Therapeutics Inc | MODIFIED POLYNUCLEOTIDES FOR MODIFYING CELL PHENOTYPE |
| RU2015132962A (en) | 2013-01-10 | 2017-02-14 | Новартис Аг | IMMUNOGENIC COMPOSITIONS BASED ON INFLUENZA VIRUS AND THEIR APPLICATION |
| CA2897941A1 (en) | 2013-01-17 | 2014-07-24 | Moderna Therapeutics, Inc. | Signal-sensor polynucleotides for the alteration of cellular phenotypes |
| HK1220122A1 (en) | 2013-03-09 | 2017-04-28 | Modernatx, Inc. | Heterologous untranslated regions for mrna |
| WO2014158795A1 (en) | 2013-03-12 | 2014-10-02 | Moderna Therapeutics, Inc. | Diagnosis and treatment of fibrosis |
| WO2014159813A1 (en) | 2013-03-13 | 2014-10-02 | Moderna Therapeutics, Inc. | Long-lived polynucleotide molecules |
| EP2971010B1 (en) | 2013-03-14 | 2020-06-10 | ModernaTX, Inc. | Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions |
| EP4279610A3 (en) | 2013-03-15 | 2024-01-03 | ModernaTX, Inc. | Ribonucleic acid purification |
| US20160032273A1 (en) | 2013-03-15 | 2016-02-04 | Moderna Therapeutics, Inc. | Characterization of mrna molecules |
| WO2014152027A1 (en) | 2013-03-15 | 2014-09-25 | Moderna Therapeutics, Inc. | Manufacturing methods for production of rna transcripts |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US10077439B2 (en) | 2013-03-15 | 2018-09-18 | Modernatx, Inc. | Removal of DNA fragments in mRNA production process |
| WO2014144767A1 (en) | 2013-03-15 | 2014-09-18 | Moderna Therapeutics, Inc. | Ion exchange purification of mrna |
| WO2014144711A1 (en) | 2013-03-15 | 2014-09-18 | Moderna Therapeutics, Inc. | Analysis of mrna heterogeneity and stability |
| PT3019619T (en) | 2013-07-11 | 2021-11-11 | Modernatx Inc | COMPOSITIONS COMPRISING SYNTHETIC POLYNUCLEOTIDES ENCODING SYNTHETIC CRISPR AND SGARN-RELATED PROTEINS AND METHODS OF USE |
| US20160194625A1 (en) | 2013-09-03 | 2016-07-07 | Moderna Therapeutics, Inc. | Chimeric polynucleotides |
| US20160194368A1 (en) | 2013-09-03 | 2016-07-07 | Moderna Therapeutics, Inc. | Circular polynucleotides |
| US9925277B2 (en) | 2013-09-13 | 2018-03-27 | Modernatx, Inc. | Polynucleotide compositions containing amino acids |
| EP3052106A4 (en) | 2013-09-30 | 2017-07-19 | ModernaTX, Inc. | Polynucleotides encoding immune modulating polypeptides |
| BR112016007255A2 (en) | 2013-10-03 | 2017-09-12 | Moderna Therapeutics Inc | polynucleotides encoding low density lipoprotein receptor |
| EP3058082A4 (en) | 2013-10-18 | 2017-04-26 | ModernaTX, Inc. | Compositions and methods for tolerizing cellular systems |
| WO2015105926A1 (en) | 2014-01-08 | 2015-07-16 | Moderna Therapeutics, Inc. | Polynucleotides for the in vivo production of antibodies |
-
2011
- 2011-10-03 PL PL22173763.8T patent/PL4108671T3/en unknown
- 2011-10-03 PL PL19177059.3T patent/PL3590949T3/en unknown
- 2011-10-03 EP EP20140195388 patent/EP2857499A1/en not_active Withdrawn
- 2011-10-03 DE DE19177059.3T patent/DE19177059T1/en active Pending
- 2011-10-03 CN CN201410800005.2A patent/CN104531812A/en active Pending
- 2011-10-03 SM SM20240513T patent/SMT202400513T1/en unknown
- 2011-10-03 CN CN2011800575554A patent/CN103429606A/en active Pending
- 2011-10-03 SG SG10201508149TA patent/SG10201508149TA/en unknown
- 2011-10-03 EP EP18179157.5A patent/EP3431485B2/en active Active
- 2011-10-03 CA CA2821992A patent/CA2821992A1/en not_active Abandoned
- 2011-10-03 ES ES19177059T patent/ES2925251T3/en active Active
- 2011-10-03 EP EP11830067.2A patent/EP2625189B1/en active Active
- 2011-10-03 CA CA3162352A patent/CA3162352A1/en active Pending
- 2011-10-03 DK DK19177059.3T patent/DK3590949T3/en active
- 2011-10-03 EP EP24188375.0A patent/EP4435100A3/en active Pending
- 2011-10-03 SI SI201132122T patent/SI4108671T1/en unknown
- 2011-10-03 SM SM20220321T patent/SMT202200321T1/en unknown
- 2011-10-03 LT LTEP22173763.8T patent/LT4108671T/en unknown
- 2011-10-03 PT PT221737638T patent/PT4108671T/en unknown
- 2011-10-03 SI SI201132062T patent/SI3590949T1/en unknown
- 2011-10-03 NZ NZ608972A patent/NZ608972A/en not_active IP Right Cessation
- 2011-10-03 WO PCT/US2011/054636 patent/WO2012045082A2/en not_active Application Discontinuation
- 2011-10-03 RS RS20220707A patent/RS63430B1/en unknown
- 2011-10-03 EP EP11830061.5A patent/EP2622064B1/en active Active
- 2011-10-03 PT PT191770593T patent/PT3590949T/en unknown
- 2011-10-03 US US13/252,049 patent/US20120237975A1/en not_active Abandoned
- 2011-10-03 FI FIEP22173763.8T patent/FI4108671T3/en active
- 2011-10-03 HU HUE22173763A patent/HUE069586T2/en unknown
- 2011-10-03 BR BR112013007862A patent/BR112013007862A2/en not_active IP Right Cessation
- 2011-10-03 JP JP2013531955A patent/JP2013543381A/en active Pending
- 2011-10-03 WO PCT/US2011/054617 patent/WO2012045075A1/en active Application Filing
- 2011-10-03 RU RU2013120302/10A patent/RU2013120302A/en not_active Application Discontinuation
- 2011-10-03 MX MX2013003681A patent/MX2013003681A/en not_active Application Discontinuation
- 2011-10-03 RS RS20241417A patent/RS66304B1/en unknown
- 2011-10-03 ES ES18179157T patent/ES2862955T5/en active Active
- 2011-10-03 CA CA2813466A patent/CA2813466A1/en active Pending
- 2011-10-03 EP EP22173763.8A patent/EP4108671B1/en active Active
- 2011-10-03 HU HUE19177059A patent/HUE058896T2/en unknown
- 2011-10-03 HR HRP20220796TT patent/HRP20220796T1/en unknown
- 2011-10-03 DK DK22173763.8T patent/DK4108671T3/en active
- 2011-10-03 ES ES11830061T patent/ES2737960T3/en active Active
- 2011-10-03 CN CN201410798863.8A patent/CN104531671A/en active Pending
- 2011-10-03 HR HRP20241701TT patent/HRP20241701T1/en unknown
- 2011-10-03 EP EP20140195389 patent/EP2857413A1/en not_active Withdrawn
- 2011-10-03 EP EP19177059.3A patent/EP3590949B1/en active Active
- 2011-10-03 ES ES22173763T patent/ES3005233T3/en active Active
- 2011-10-03 AU AU2011308496A patent/AU2011308496A1/en not_active Abandoned
- 2011-10-03 LT LTEP19177059.3T patent/LT3590949T/en unknown
- 2011-10-03 SG SG2013023973A patent/SG190679A1/en unknown
-
2012
- 2012-05-25 US US13/481,127 patent/US20130102034A1/en not_active Abandoned
-
2013
- 2013-01-11 US US13/739,212 patent/US9334328B2/en active Active
- 2013-04-02 IL IL225493A patent/IL225493A0/en unknown
- 2013-04-30 ZA ZA2013/03161A patent/ZA201303161B/en unknown
- 2013-05-18 US US13/897,363 patent/US20130244282A1/en not_active Abandoned
-
2014
- 2014-05-20 ZA ZA2014/03666A patent/ZA201403666B/en unknown
- 2014-11-07 US US14/535,484 patent/US9701965B2/en active Active
-
2016
- 2016-04-29 US US15/143,364 patent/US9657295B2/en active Active
-
2017
- 2017-04-21 US US15/493,829 patent/US10064959B2/en active Active
- 2017-05-03 AU AU2017202958A patent/AU2017202958A1/en not_active Abandoned
- 2017-06-01 US US15/611,490 patent/US20180112221A1/en not_active Abandoned
-
2018
- 2018-07-27 US US16/047,574 patent/US20190160185A1/en not_active Abandoned
-
2020
- 2020-07-16 US US16/930,720 patent/US20210236655A1/en not_active Abandoned
-
2022
- 2022-07-29 CY CY20221100520T patent/CY1125421T1/en unknown
- 2022-10-11 US US18/045,805 patent/US20240033379A1/en active Pending
-
2024
- 2024-08-30 US US18/820,804 patent/US12357708B2/en active Active
Cited By (205)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8822663B2 (en) | 2010-08-06 | 2014-09-02 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9447164B2 (en) | 2010-08-06 | 2016-09-20 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9181319B2 (en) | 2010-08-06 | 2015-11-10 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9937233B2 (en) | 2010-08-06 | 2018-04-10 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9657295B2 (en) | 2010-10-01 | 2017-05-23 | Modernatx, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9701965B2 (en) | 2010-10-01 | 2017-07-11 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US10064959B2 (en) | 2010-10-01 | 2018-09-04 | Modernatx, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9334328B2 (en) | 2010-10-01 | 2016-05-10 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9950068B2 (en) | 2011-03-31 | 2018-04-24 | Modernatx, Inc. | Delivery and formulation of engineered nucleic acids |
| US8710200B2 (en) | 2011-03-31 | 2014-04-29 | Moderna Therapeutics, Inc. | Engineered nucleic acids encoding a modified erythropoietin and their expression |
| US9533047B2 (en) | 2011-03-31 | 2017-01-03 | Modernatx, Inc. | Delivery and formulation of engineered nucleic acids |
| US10022425B2 (en) | 2011-09-12 | 2018-07-17 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US10751386B2 (en) | 2011-09-12 | 2020-08-25 | Modernatx, Inc. | Engineered nucleic acids and methods of use thereof |
| US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
| US9428535B2 (en) | 2011-10-03 | 2016-08-30 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
| US9605278B2 (en) | 2011-12-05 | 2017-03-28 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US12227757B2 (en) | 2011-12-05 | 2025-02-18 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US12391961B2 (en) | 2011-12-05 | 2025-08-19 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US10662410B1 (en) | 2011-12-05 | 2020-05-26 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US10829738B2 (en) | 2011-12-05 | 2020-11-10 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US12227768B2 (en) | 2011-12-05 | 2025-02-18 | Factor Bioscience Inc. | Methods and products for transfection |
| US9605277B2 (en) | 2011-12-05 | 2017-03-28 | Factor Bioscience, Inc. | Methods and products for transfecting cells |
| US10472611B2 (en) | 2011-12-05 | 2019-11-12 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US10982229B2 (en) | 2011-12-05 | 2021-04-20 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US11466293B2 (en) | 2011-12-05 | 2022-10-11 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US11692203B2 (en) | 2011-12-05 | 2023-07-04 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US11708586B2 (en) | 2011-12-05 | 2023-07-25 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US9422577B2 (en) | 2011-12-05 | 2016-08-23 | Factor Bioscience Inc. | Methods and products for transfecting cells |
| US9295689B2 (en) | 2011-12-16 | 2016-03-29 | Moderna Therapeutics, Inc. | Formulation and delivery of PLGA microspheres |
| US9271996B2 (en) | 2011-12-16 | 2016-03-01 | Moderna Therapeutics, Inc. | Formulation and delivery of PLGA microspheres |
| US8680069B2 (en) | 2011-12-16 | 2014-03-25 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of G-CSF |
| US8754062B2 (en) | 2011-12-16 | 2014-06-17 | Moderna Therapeutics, Inc. | DLIN-KC2-DMA lipid nanoparticle delivery of modified polynucleotides |
| US9186372B2 (en) | 2011-12-16 | 2015-11-17 | Moderna Therapeutics, Inc. | Split dose administration |
| US8664194B2 (en) | 2011-12-16 | 2014-03-04 | Moderna Therapeutics, Inc. | Method for producing a protein of interest in a primate |
| US9221891B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | In vivo production of proteins |
| US9061059B2 (en) | 2012-04-02 | 2015-06-23 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating protein deficiency |
| US9107886B2 (en) | 2012-04-02 | 2015-08-18 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding basic helix-loop-helix family member E41 |
| US9095552B2 (en) | 2012-04-02 | 2015-08-04 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding copper metabolism (MURR1) domain containing 1 |
| US9255129B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding SIAH E3 ubiquitin protein ligase 1 |
| US9149506B2 (en) | 2012-04-02 | 2015-10-06 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding septin-4 |
| US9089604B2 (en) | 2012-04-02 | 2015-07-28 | Moderna Therapeutics, Inc. | Modified polynucleotides for treating galactosylceramidase protein deficiency |
| US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9587003B2 (en) | 2012-04-02 | 2017-03-07 | Modernatx, Inc. | Modified polynucleotides for the production of oncology-related proteins and peptides |
| US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
| US9233141B2 (en) | 2012-04-02 | 2016-01-12 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders |
| US9303079B2 (en) | 2012-04-02 | 2016-04-05 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
| US9220755B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins associated with blood and lymphatic disorders |
| US9220792B2 (en) | 2012-04-02 | 2015-12-29 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding aquaporin-5 |
| US9675668B2 (en) | 2012-04-02 | 2017-06-13 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding hepatitis A virus cellular receptor 2 |
| US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
| US9050297B2 (en) | 2012-04-02 | 2015-06-09 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding aryl hydrocarbon receptor nuclear translocator |
| US9216205B2 (en) | 2012-04-02 | 2015-12-22 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding granulysin |
| US9114113B2 (en) | 2012-04-02 | 2015-08-25 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding citeD4 |
| US10501512B2 (en) | 2012-04-02 | 2019-12-10 | Modernatx, Inc. | Modified polynucleotides |
| US9782462B2 (en) | 2012-04-02 | 2017-10-10 | Modernatx, Inc. | Modified polynucleotides for the production of proteins associated with human disease |
| US9814760B2 (en) | 2012-04-02 | 2017-11-14 | Modernatx, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9827332B2 (en) | 2012-04-02 | 2017-11-28 | Modernatx, Inc. | Modified polynucleotides for the production of proteins |
| US9828416B2 (en) | 2012-04-02 | 2017-11-28 | Modernatx, Inc. | Modified polynucleotides for the production of secreted proteins |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| US8999380B2 (en) | 2012-04-02 | 2015-04-07 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of biologics and proteins associated with human disease |
| US9192651B2 (en) | 2012-04-02 | 2015-11-24 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of secreted proteins |
| US9301993B2 (en) | 2012-04-02 | 2016-04-05 | Moderna Therapeutics, Inc. | Modified polynucleotides encoding apoptosis inducing factor 1 |
| US9512456B2 (en) | 2012-08-14 | 2016-12-06 | Modernatx, Inc. | Enzymes and polymerases for the synthesis of RNA |
| US9758797B2 (en) | 2012-11-01 | 2017-09-12 | Factor Bioscience, Inc. | Methods and products for expressing proteins in cells |
| US10724053B2 (en) | 2012-11-01 | 2020-07-28 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US11339409B2 (en) | 2012-11-01 | 2022-05-24 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US10752919B2 (en) | 2012-11-01 | 2020-08-25 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US10767195B2 (en) | 2012-11-01 | 2020-09-08 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9657282B2 (en) | 2012-11-01 | 2017-05-23 | Factor Bioscience, Inc. | Methods and products for expressing proteins in cells |
| US10752918B2 (en) | 2012-11-01 | 2020-08-25 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US10590437B2 (en) | 2012-11-01 | 2020-03-17 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US11332758B2 (en) | 2012-11-01 | 2022-05-17 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9376669B2 (en) | 2012-11-01 | 2016-06-28 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US11332759B2 (en) | 2012-11-01 | 2022-05-17 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9487768B2 (en) | 2012-11-01 | 2016-11-08 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US12006508B2 (en) | 2012-11-01 | 2024-06-11 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US10415060B2 (en) | 2012-11-01 | 2019-09-17 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US10752917B2 (en) | 2012-11-01 | 2020-08-25 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9447395B2 (en) | 2012-11-01 | 2016-09-20 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US11339410B2 (en) | 2012-11-01 | 2022-05-24 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9464285B2 (en) | 2012-11-01 | 2016-10-11 | Factor Bioscience Inc. | Methods and products for expressing proteins in cells |
| US9597380B2 (en) | 2012-11-26 | 2017-03-21 | Modernatx, Inc. | Terminally modified RNA |
| US10258698B2 (en) | 2013-03-14 | 2019-04-16 | Modernatx, Inc. | Formulation and delivery of modified nucleoside, nucleotide, and nucleic acid compositions |
| US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
| US10815291B2 (en) | 2013-09-30 | 2020-10-27 | Modernatx, Inc. | Polynucleotides encoding immune modulating polypeptides |
| US10323076B2 (en) | 2013-10-03 | 2019-06-18 | Modernatx, Inc. | Polynucleotides encoding low density lipoprotein receptor |
| WO2015095351A1 (en) | 2013-12-19 | 2015-06-25 | Novartis Ag | LEPTIN mRNA COMPOSITIONS AND FORMULATIONS |
| US10124042B2 (en) | 2014-01-31 | 2018-11-13 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| US9770489B2 (en) | 2014-01-31 | 2017-09-26 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| US12201675B2 (en) | 2014-01-31 | 2025-01-21 | Factor Bioscience Inc. | Methods and products for nucleic acid production and delivery |
| US10709779B2 (en) | 2014-04-23 | 2020-07-14 | Modernatx, Inc. | Nucleic acid vaccines |
| US12274743B2 (en) | 2014-04-23 | 2025-04-15 | Modernatx, Inc. | Nucleic acid vaccines |
| US12329812B2 (en) | 2014-04-23 | 2025-06-17 | Modernatx, Inc. | Nucleic acid vaccines |
| US9751925B2 (en) | 2014-11-10 | 2017-09-05 | Modernatx, Inc. | Alternative nucleic acid molecules containing reduced uracil content and uses thereof |
| US10072057B2 (en) | 2014-11-10 | 2018-09-11 | Modernatx, Inc. | Alternative nucleic acid molecules containing reduced uracil content and uses thereof |
| US11241505B2 (en) | 2015-02-13 | 2022-02-08 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US11007260B2 (en) | 2015-07-21 | 2021-05-18 | Modernatx, Inc. | Infectious disease vaccines |
| US11364292B2 (en) | 2015-07-21 | 2022-06-21 | Modernatx, Inc. | CHIKV RNA vaccines |
| US10702597B2 (en) | 2015-07-21 | 2020-07-07 | Modernatx, Inc. | CHIKV RNA vaccines |
| US10449244B2 (en) | 2015-07-21 | 2019-10-22 | Modernatx, Inc. | Zika RNA vaccines |
| US12150980B2 (en) | 2015-07-30 | 2024-11-26 | Modernatx, Inc. | Concatemeric peptide epitope RNAs |
| US11564893B2 (en) | 2015-08-17 | 2023-01-31 | Modernatx, Inc. | Methods for preparing particles and related compositions |
| US10849920B2 (en) | 2015-10-05 | 2020-12-01 | Modernatx, Inc. | Methods for therapeutic administration of messenger ribonucleic acid drugs |
| US11590157B2 (en) | 2015-10-05 | 2023-02-28 | Modernatx, Inc. | Methods for therapeutic administration of messenger ribonucleic acid drugs |
| US12246030B2 (en) | 2015-10-05 | 2025-03-11 | Modernatx, Inc. | Methods for therapeutic administration of messenger ribonucleic acid drugs |
| US10702599B2 (en) | 2015-10-22 | 2020-07-07 | Modernatx, Inc. | HPIV3 RNA vaccines |
| US11235052B2 (en) | 2015-10-22 | 2022-02-01 | Modernatx, Inc. | Chikungunya virus RNA vaccines |
| US11643441B1 (en) | 2015-10-22 | 2023-05-09 | Modernatx, Inc. | Nucleic acid vaccines for varicella zoster virus (VZV) |
| US11872278B2 (en) | 2015-10-22 | 2024-01-16 | Modernatx, Inc. | Combination HMPV/RSV RNA vaccines |
| US10716846B2 (en) | 2015-10-22 | 2020-07-21 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US10702600B1 (en) | 2015-10-22 | 2020-07-07 | Modernatx, Inc. | Betacoronavirus mRNA vaccine |
| US10383937B2 (en) | 2015-10-22 | 2019-08-20 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US10675342B2 (en) | 2015-10-22 | 2020-06-09 | Modernatx, Inc. | Chikungunya virus RNA vaccines |
| US11484590B2 (en) | 2015-10-22 | 2022-11-01 | Modernatx, Inc. | Human cytomegalovirus RNA vaccines |
| US10517940B2 (en) | 2015-10-22 | 2019-12-31 | Modernatx, Inc. | Zika virus RNA vaccines |
| US12208288B2 (en) | 2015-10-22 | 2025-01-28 | Modernatx, Inc. | Betacoronavirus RNA vaccines |
| US12409347B2 (en) | 2015-10-22 | 2025-09-09 | Modernatx, Inc. | Betacoronavirus mRNA vaccines |
| US10933127B2 (en) | 2015-10-22 | 2021-03-02 | Modernatx, Inc. | Betacoronavirus mRNA vaccine |
| US10543269B2 (en) | 2015-10-22 | 2020-01-28 | Modernatx, Inc. | hMPV RNA vaccines |
| US12403336B2 (en) | 2015-10-22 | 2025-09-02 | Modernatx, Inc. | Betacorona virus mRNA vaccines |
| US12403335B2 (en) | 2015-10-22 | 2025-09-02 | Modernatx, Inc. | Betacoronavirus MRNA vaccines |
| US11278611B2 (en) | 2015-10-22 | 2022-03-22 | Modernatx, Inc. | Zika virus RNA vaccines |
| US10493143B2 (en) | 2015-10-22 | 2019-12-03 | Modernatx, Inc. | Sexually transmitted disease vaccines |
| US10272150B2 (en) | 2015-10-22 | 2019-04-30 | Modernatx, Inc. | Combination PIV3/hMPV RNA vaccines |
| WO2017098468A1 (en) | 2015-12-09 | 2017-06-15 | Novartis Ag | Label-free analysis of rna capping efficiency using rnase h, probes and liquid chromatography/mass spectrometry |
| EP3656872A1 (en) | 2015-12-09 | 2020-05-27 | Novartis AG | Label-free analysis of rna capping efficiency using rnase h, probes and liquid chromatography/mass spectrometry |
| US10207010B2 (en) | 2015-12-10 | 2019-02-19 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US10485885B2 (en) | 2015-12-10 | 2019-11-26 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US11285222B2 (en) | 2015-12-10 | 2022-03-29 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US10556018B2 (en) | 2015-12-10 | 2020-02-11 | Modernatx, Inc. | Compositions and methods for delivery of agents |
| US10465190B1 (en) | 2015-12-23 | 2019-11-05 | Modernatx, Inc. | In vitro transcription methods and constructs |
| US12128113B2 (en) | 2016-05-18 | 2024-10-29 | Modernatx, Inc. | Polynucleotides encoding JAGGED1 for the treatment of Alagille syndrome |
| US10730924B2 (en) | 2016-05-18 | 2020-08-04 | Modernatx, Inc. | Polynucleotides encoding relaxin |
| US12103955B2 (en) | 2016-05-18 | 2024-10-01 | Modernatx, Inc. | Polynucleotides encoding relaxin |
| US10363321B2 (en) | 2016-08-17 | 2019-07-30 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10137206B2 (en) | 2016-08-17 | 2018-11-27 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10894092B2 (en) | 2016-08-17 | 2021-01-19 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10369233B2 (en) | 2016-08-17 | 2019-08-06 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US11904023B2 (en) | 2016-08-17 | 2024-02-20 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10888627B2 (en) | 2016-08-17 | 2021-01-12 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10350304B2 (en) | 2016-08-17 | 2019-07-16 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10576167B2 (en) | 2016-08-17 | 2020-03-03 | Factor Bioscience Inc. | Nucleic acid products and methods of administration thereof |
| US10653712B2 (en) | 2016-09-14 | 2020-05-19 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US11202793B2 (en) | 2016-09-14 | 2021-12-21 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US12233084B2 (en) | 2016-09-14 | 2025-02-25 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US12246029B2 (en) | 2016-09-14 | 2025-03-11 | Modernatx, Inc. | High purity RNA compositions and methods for preparation thereof |
| US10695419B2 (en) | 2016-10-21 | 2020-06-30 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11541113B2 (en) | 2016-10-21 | 2023-01-03 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11197927B2 (en) | 2016-10-21 | 2021-12-14 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US11696946B2 (en) | 2016-11-11 | 2023-07-11 | Modernatx, Inc. | Influenza vaccine |
| US12318443B2 (en) | 2016-11-11 | 2025-06-03 | Modernatx, Inc. | Influenza vaccine |
| US12409218B2 (en) | 2016-11-11 | 2025-09-09 | Modernatx, Inc. | Influenza vaccine |
| US10925958B2 (en) | 2016-11-11 | 2021-02-23 | Modernatx, Inc. | Influenza vaccine |
| US11103578B2 (en) | 2016-12-08 | 2021-08-31 | Modernatx, Inc. | Respiratory virus nucleic acid vaccines |
| US11384352B2 (en) | 2016-12-13 | 2022-07-12 | Modernatx, Inc. | RNA affinity purification |
| US10273269B2 (en) | 2017-02-16 | 2019-04-30 | Modernatx, Inc. | High potency immunogenic zika virus compositions |
| US11752206B2 (en) | 2017-03-15 | 2023-09-12 | Modernatx, Inc. | Herpes simplex virus vaccine |
| US11045540B2 (en) | 2017-03-15 | 2021-06-29 | Modernatx, Inc. | Varicella zoster virus (VZV) vaccine |
| US11464848B2 (en) | 2017-03-15 | 2022-10-11 | Modernatx, Inc. | Respiratory syncytial virus vaccine |
| US11576961B2 (en) | 2017-03-15 | 2023-02-14 | Modernatx, Inc. | Broad spectrum influenza virus vaccine |
| US11918644B2 (en) | 2017-03-15 | 2024-03-05 | Modernatx, Inc. | Varicella zoster virus (VZV) vaccine |
| US11497807B2 (en) | 2017-03-17 | 2022-11-15 | Modernatx, Inc. | Zoonotic disease RNA vaccines |
| US11905525B2 (en) | 2017-04-05 | 2024-02-20 | Modernatx, Inc. | Reduction of elimination of immune responses to non-intravenous, e.g., subcutaneously administered therapeutic proteins |
| US11786607B2 (en) | 2017-06-15 | 2023-10-17 | Modernatx, Inc. | RNA formulations |
| US11767548B2 (en) | 2017-08-18 | 2023-09-26 | Modernatx, Inc. | RNA polymerase variants |
| US12195778B2 (en) | 2017-08-18 | 2025-01-14 | Modernatx, Inc. | RNA polymerase variants |
| US11866696B2 (en) | 2017-08-18 | 2024-01-09 | Modernatx, Inc. | Analytical HPLC methods |
| US11912982B2 (en) | 2017-08-18 | 2024-02-27 | Modernatx, Inc. | Methods for HPLC analysis |
| US11066686B2 (en) | 2017-08-18 | 2021-07-20 | Modernatx, Inc. | RNA polymerase variants |
| US10526629B2 (en) | 2017-08-18 | 2020-01-07 | Modernatx, Inc. | RNA polymerase variants |
| US12357575B2 (en) | 2017-08-31 | 2025-07-15 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US11744801B2 (en) | 2017-08-31 | 2023-09-05 | Modernatx, Inc. | Methods of making lipid nanoparticles |
| US11207398B2 (en) | 2017-09-14 | 2021-12-28 | Modernatx, Inc. | Zika virus mRNA vaccines |
| US10653767B2 (en) | 2017-09-14 | 2020-05-19 | Modernatx, Inc. | Zika virus MRNA vaccines |
| WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
| US11911453B2 (en) | 2018-01-29 | 2024-02-27 | Modernatx, Inc. | RSV RNA vaccines |
| US12383508B2 (en) | 2018-09-19 | 2025-08-12 | Modernatx, Inc. | High-purity peg lipids and uses thereof |
| US12151029B2 (en) | 2018-09-19 | 2024-11-26 | Modernatx, Inc. | PEG lipids and uses thereof |
| US12090235B2 (en) | 2018-09-20 | 2024-09-17 | Modernatx, Inc. | Preparation of lipid nanoparticles and methods of administration thereof |
| US11351242B1 (en) | 2019-02-12 | 2022-06-07 | Modernatx, Inc. | HMPV/hPIV3 mRNA vaccine composition |
| US12180518B2 (en) | 2019-02-20 | 2024-12-31 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US11485960B2 (en) | 2019-02-20 | 2022-11-01 | Modernatx, Inc. | RNA polymerase variants for co-transcriptional capping |
| US11851694B1 (en) | 2019-02-20 | 2023-12-26 | Modernatx, Inc. | High fidelity in vitro transcription |
| US12070495B2 (en) | 2019-03-15 | 2024-08-27 | Modernatx, Inc. | HIV RNA vaccines |
| US12344572B2 (en) | 2019-07-03 | 2025-07-01 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US12384740B2 (en) | 2019-07-30 | 2025-08-12 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US10556855B1 (en) | 2019-07-30 | 2020-02-11 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US11814333B2 (en) | 2019-07-30 | 2023-11-14 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US10611722B1 (en) | 2019-07-30 | 2020-04-07 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US10752576B1 (en) | 2019-07-30 | 2020-08-25 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US11242311B2 (en) | 2019-07-30 | 2022-02-08 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US10501404B1 (en) | 2019-07-30 | 2019-12-10 | Factor Bioscience Inc. | Cationic lipids and transfection methods |
| US12133899B2 (en) | 2020-04-22 | 2024-11-05 | BioNTech SE | Coronavirus vaccine |
| US11951185B2 (en) | 2020-04-22 | 2024-04-09 | BioNTech SE | RNA constructs and uses thereof |
| US11925694B2 (en) | 2020-04-22 | 2024-03-12 | BioNTech SE | Coronavirus vaccine |
| US11779659B2 (en) | 2020-04-22 | 2023-10-10 | BioNTech SE | RNA constructs and uses thereof |
| US11547673B1 (en) | 2020-04-22 | 2023-01-10 | BioNTech SE | Coronavirus vaccine |
| US11406703B2 (en) | 2020-08-25 | 2022-08-09 | Modernatx, Inc. | Human cytomegalovirus vaccine |
| US12329811B2 (en) | 2021-01-11 | 2025-06-17 | Modernatx, Inc. | Seasonal RNA influenza virus vaccines |
| US11622972B2 (en) | 2021-02-19 | 2023-04-11 | Modernatx, Inc. | Lipid nanoparticle compositions and methods of formulating the same |
| US11524023B2 (en) | 2021-02-19 | 2022-12-13 | Modernatx, Inc. | Lipid nanoparticle compositions and methods of formulating the same |
| US12428577B2 (en) | 2021-05-14 | 2025-09-30 | Modernatx, Inc. | Methods of monitoring in vitro transcription of mRNA and/or post-in vitro transcription processes |
| US12208136B2 (en) | 2021-11-29 | 2025-01-28 | BioNTech SE | Coronavirus vaccine |
| US12186387B2 (en) | 2021-11-29 | 2025-01-07 | BioNTech SE | Coronavirus vaccine |
| US11878055B1 (en) | 2022-06-26 | 2024-01-23 | BioNTech SE | Coronavirus vaccine |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12357708B2 (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof | |
| US20230416324A1 (en) | Alternative nucleic acid molecules containing reduced uracil content and uses thereof | |
| AU2017213503B2 (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof | |
| US20140371302A1 (en) | Modified mrnas encoding cell-penetrating polypeptides | |
| US20160022774A1 (en) | Diagnosis and treatment of fibrosis | |
| HK40086418A (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof | |
| HK40086418B (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof | |
| HK40032374B (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof | |
| HK40032374A (en) | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: MODERNA THERAPEUTICS, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SCHRUM, JASON P.;REEL/FRAME:029398/0184 Effective date: 20101123 |
|
| AS | Assignment |
Owner name: MODERNA THERAPEUTICS, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:SIDDIQI, SUHAIB;REEL/FRAME:029678/0524 Effective date: 20130110 |
|
| STCB | Information on status: application discontinuation |
Free format text: EXPRESSLY ABANDONED -- DURING EXAMINATION |
|
| AS | Assignment |
Owner name: MODERNA THERAPEUTICS, INC., MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:FLAGSHIP VENTURES;REEL/FRAME:033245/0001 Effective date: 20140624 |
|
| AS | Assignment |
Owner name: MODERNA THERAPEUTICS, INC., MASSACHUSETTS Free format text: CORRECTIVE ASSIGNMENT TO CORRECT THE RECEIVING PARTY NAME PREVIOUSLY RECORDED AT REEL: 029678 FRAME: 0524. ASSIGNOR(S) HEREBY CONFIRMS THE ASSIGNMENT;ASSIGNOR:SIDDIQI, SUHAIB;REEL/FRAME:034660/0944 Effective date: 20130110 |
|
| AS | Assignment |
Owner name: MODERNA THERAPEUTICS, INC., MASSACHUSETTS Free format text: CORRECTIVE ASSIGNMENT TO CORRECT THE RECEIVING PARTY'S NAME PREVIOUSLY RECORDED AT REEL: 029398 FRAME: 0184. ASSIGNOR(S) HEREBY CONFIRMS THE ASSIGNMENT;ASSIGNOR:SCHRUM, JASON P.;REEL/FRAME:034679/0001 Effective date: 20101123 |
|
| AS | Assignment |
Owner name: MODERNATX, INC., MASSACHUSETTS Free format text: CHANGE OF NAME;ASSIGNOR:MODERNA THERAPEUTICS;REEL/FRAME:040233/0082 Effective date: 20160808 |
|
| AS | Assignment |
Owner name: MODERNATX, INC., MASSACHUSETTS Free format text: CHANGE OF NAME;ASSIGNOR:MODERNA THERAPEUTICS, INC.;REEL/FRAME:042457/0482 Effective date: 20160808 |

























































