US10550182B2 - T cell receptors and immune therapy using the same - Google Patents
T cell receptors and immune therapy using the same Download PDFInfo
- Publication number
- US10550182B2 US10550182B2 US15/677,651 US201715677651A US10550182B2 US 10550182 B2 US10550182 B2 US 10550182B2 US 201715677651 A US201715677651 A US 201715677651A US 10550182 B2 US10550182 B2 US 10550182B2
- Authority
- US
- United States
- Prior art keywords
- chain
- seq
- amino acid
- tcr
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
- 108091008874 T cell receptors Proteins 0.000 title abstract description 248
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 title abstract description 212
- 238000009169 immunotherapy Methods 0.000 title description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 126
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims 6
- 210000004027 cell Anatomy 0.000 abstract description 125
- 239000000427 antigen Substances 0.000 abstract description 110
- 108091007433 antigens Proteins 0.000 abstract description 109
- 102000036639 antigens Human genes 0.000 abstract description 109
- 206010028980 Neoplasm Diseases 0.000 abstract description 67
- 102100024338 Collagen alpha-3(VI) chain Human genes 0.000 abstract description 40
- 101000909506 Homo sapiens Collagen alpha-3(VI) chain Proteins 0.000 abstract description 40
- 150000007523 nucleic acids Chemical class 0.000 abstract description 39
- 102000039446 nucleic acids Human genes 0.000 abstract description 36
- 108020004707 nucleic acids Proteins 0.000 abstract description 36
- 239000012634 fragment Substances 0.000 abstract description 26
- 239000013598 vector Substances 0.000 abstract description 17
- 239000008194 pharmaceutical composition Substances 0.000 abstract description 14
- 238000011282 treatment Methods 0.000 abstract description 11
- 230000002265 prevention Effects 0.000 abstract description 10
- 150000001875 compounds Chemical class 0.000 abstract description 3
- 238000003745 diagnosis Methods 0.000 abstract description 3
- 201000010099 disease Diseases 0.000 abstract description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 95
- 102000004196 processed proteins & peptides Human genes 0.000 description 58
- 229920001184 polypeptide Polymers 0.000 description 52
- 210000001744 T-lymphocyte Anatomy 0.000 description 51
- 241000282414 Homo sapiens Species 0.000 description 50
- 201000011510 cancer Diseases 0.000 description 46
- 101100112922 Candida albicans CDR3 gene Proteins 0.000 description 44
- 108090000623 proteins and genes Proteins 0.000 description 40
- 235000018102 proteins Nutrition 0.000 description 39
- 102000004169 proteins and genes Human genes 0.000 description 39
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 38
- 108010075704 HLA-A Antigens Proteins 0.000 description 38
- 238000000034 method Methods 0.000 description 38
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 36
- 101000737793 Homo sapiens Cerebellar degeneration-related antigen 1 Proteins 0.000 description 36
- 230000009258 tissue cross reactivity Effects 0.000 description 36
- 102100035361 Cerebellar degeneration-related protein 2 Human genes 0.000 description 24
- 101000737796 Homo sapiens Cerebellar degeneration-related protein 2 Proteins 0.000 description 24
- 239000013604 expression vector Substances 0.000 description 19
- 230000014509 gene expression Effects 0.000 description 18
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 16
- 241000124008 Mammalia Species 0.000 description 15
- 238000003259 recombinant expression Methods 0.000 description 15
- 235000001014 amino acid Nutrition 0.000 description 14
- 239000000463 material Substances 0.000 description 14
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 150000001413 amino acids Chemical class 0.000 description 10
- 238000011534 incubation Methods 0.000 description 9
- 238000010186 staining Methods 0.000 description 8
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 7
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 125000000539 amino acid group Chemical group 0.000 description 7
- 239000003937 drug carrier Substances 0.000 description 7
- 102000018358 immunoglobulin Human genes 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 239000002773 nucleotide Substances 0.000 description 7
- 125000003729 nucleotide group Chemical group 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 7
- 108010035532 Collagen Proteins 0.000 description 6
- 102000008186 Collagen Human genes 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical group NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 239000004471 Glycine Chemical group 0.000 description 6
- 101000658376 Homo sapiens T cell receptor alpha variable 12-2 Proteins 0.000 description 6
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical group C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 102100034847 T cell receptor alpha variable 12-2 Human genes 0.000 description 6
- 235000004279 alanine Nutrition 0.000 description 6
- 229920001436 collagen Polymers 0.000 description 6
- 230000001419 dependent effect Effects 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 6
- 230000028993 immune response Effects 0.000 description 6
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 108010004729 Phycoerythrin Proteins 0.000 description 5
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 4
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 4
- 101000844040 Homo sapiens T cell receptor beta variable 9 Proteins 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- 108010050904 Interferons Proteins 0.000 description 4
- 102000014150 Interferons Human genes 0.000 description 4
- 208000008839 Kidney Neoplasms Diseases 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 206010038389 Renal cancer Diseases 0.000 description 4
- 208000005718 Stomach Neoplasms Diseases 0.000 description 4
- 102100032166 T cell receptor beta variable 9 Human genes 0.000 description 4
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 4
- 210000002255 anal canal Anatomy 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000001086 cytosolic effect Effects 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 206010017758 gastric cancer Diseases 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 229940079322 interferon Drugs 0.000 description 4
- 201000010982 kidney cancer Diseases 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 239000002245 particle Substances 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 201000011549 stomach cancer Diseases 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 3
- 208000026310 Breast neoplasm Diseases 0.000 description 3
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 101000840258 Homo sapiens Immunoglobulin J chain Proteins 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- 102100029571 Immunoglobulin J chain Human genes 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010002350 Interleukin-2 Proteins 0.000 description 3
- 108010002586 Interleukin-7 Proteins 0.000 description 3
- 102000000704 Interleukin-7 Human genes 0.000 description 3
- 102100026964 M1-specific T cell receptor beta chain Human genes 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 210000005260 human cell Anatomy 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical group N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 208000007860 Anus Neoplasms Diseases 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 206010005949 Bone cancer Diseases 0.000 description 2
- 208000018084 Bone neoplasm Diseases 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- 101150090583 COL6A3 gene Proteins 0.000 description 2
- 206010007279 Carcinoid tumour of the gastrointestinal tract Diseases 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 2
- 108091026890 Coding region Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 2
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 102000025850 HLA-A2 Antigen Human genes 0.000 description 2
- 108010074032 HLA-A2 Antigen Proteins 0.000 description 2
- 208000017604 Hodgkin disease Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 2
- 101000662909 Homo sapiens T cell receptor beta constant 1 Proteins 0.000 description 2
- 101000645339 Homo sapiens T cell receptor beta joining 1-2 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 206010023825 Laryngeal cancer Diseases 0.000 description 2
- 206010024291 Leukaemias acute myeloid Diseases 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 206010028729 Nasal cavity cancer Diseases 0.000 description 2
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 208000010505 Nose Neoplasms Diseases 0.000 description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 206010057444 Oropharyngeal neoplasm Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- 208000002471 Penile Neoplasms Diseases 0.000 description 2
- 208000009565 Pharyngeal Neoplasms Diseases 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 208000000453 Skin Neoplasms Diseases 0.000 description 2
- 208000032383 Soft tissue cancer Diseases 0.000 description 2
- 102100037272 T cell receptor beta constant 1 Human genes 0.000 description 2
- 102100026266 T cell receptor beta joining 1-2 Human genes 0.000 description 2
- 208000024313 Testicular Neoplasms Diseases 0.000 description 2
- 206010057644 Testis cancer Diseases 0.000 description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 description 2
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 2
- 206010046392 Ureteric cancer Diseases 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000002495 Uterine Neoplasms Diseases 0.000 description 2
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 108010004469 allophycocyanin Proteins 0.000 description 2
- 108010087408 alpha-beta T-Cell Antigen Receptors Proteins 0.000 description 2
- 206010065867 alveolar rhabdomyosarcoma Diseases 0.000 description 2
- 201000007696 anal canal cancer Diseases 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 210000000436 anus Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 201000010881 cervical cancer Diseases 0.000 description 2
- 230000001684 chronic effect Effects 0.000 description 2
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 2
- 238000003501 co-culture Methods 0.000 description 2
- 201000010989 colorectal carcinoma Diseases 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 210000000959 ear middle Anatomy 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 201000004101 esophageal cancer Diseases 0.000 description 2
- 208000024519 eye neoplasm Diseases 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 210000000232 gallbladder Anatomy 0.000 description 2
- 201000007487 gallbladder carcinoma Diseases 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 229910052737 gold Inorganic materials 0.000 description 2
- 208000014829 head and neck neoplasm Diseases 0.000 description 2
- 201000006866 hypopharynx cancer Diseases 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 210000003228 intrahepatic bile duct Anatomy 0.000 description 2
- 206010023841 laryngeal neoplasm Diseases 0.000 description 2
- 201000004962 larynx cancer Diseases 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 230000000527 lymphocytic effect Effects 0.000 description 2
- 208000006178 malignant mesothelioma Diseases 0.000 description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 2
- 208000025848 malignant tumor of nasopharynx Diseases 0.000 description 2
- 208000026037 malignant tumor of neck Diseases 0.000 description 2
- 210000003071 memory t lymphocyte Anatomy 0.000 description 2
- 210000000713 mesentery Anatomy 0.000 description 2
- 201000003956 middle ear cancer Diseases 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000010369 molecular cloning Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000000214 mouth Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000003928 nasal cavity Anatomy 0.000 description 2
- 201000007425 nasal cavity carcinoma Diseases 0.000 description 2
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 2
- 201000008106 ocular cancer Diseases 0.000 description 2
- 210000002747 omentum Anatomy 0.000 description 2
- 210000003300 oropharynx Anatomy 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 description 2
- 210000003899 penis Anatomy 0.000 description 2
- 210000005259 peripheral blood Anatomy 0.000 description 2
- 239000011886 peripheral blood Substances 0.000 description 2
- 210000004303 peritoneum Anatomy 0.000 description 2
- 201000008006 pharynx cancer Diseases 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 210000004224 pleura Anatomy 0.000 description 2
- 201000003437 pleural cancer Diseases 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 201000000849 skin cancer Diseases 0.000 description 2
- 201000002314 small intestine cancer Diseases 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 201000003120 testicular cancer Diseases 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- 201000002510 thyroid cancer Diseases 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 201000011294 ureter cancer Diseases 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 206010046766 uterine cancer Diseases 0.000 description 2
- 210000001215 vagina Anatomy 0.000 description 2
- 208000013139 vaginal neoplasm Diseases 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 210000003905 vulva Anatomy 0.000 description 2
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- NEWKHUASLBMWRE-UHFFFAOYSA-N 2-methyl-6-(phenylethynyl)pyridine Chemical compound CC1=CC=CC(C#CC=2C=CC=CC=2)=N1 NEWKHUASLBMWRE-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- 101000984722 Bos taurus Pancreatic trypsin inhibitor Proteins 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 210000003359 CD4-positive helper T lymphocyte Anatomy 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000011632 Caseins Human genes 0.000 description 1
- 108010076119 Caseins Proteins 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 108010043741 Collagen Type VI Proteins 0.000 description 1
- 102000002734 Collagen Type VI Human genes 0.000 description 1
- 102100031519 Collagen alpha-1(VI) chain Human genes 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101000941581 Homo sapiens Collagen alpha-1(VI) chain Proteins 0.000 description 1
- 101000941585 Homo sapiens Collagen alpha-2(VI) chain Proteins 0.000 description 1
- 101001095308 Homo sapiens Periostin Proteins 0.000 description 1
- 101000662902 Homo sapiens T cell receptor beta constant 2 Proteins 0.000 description 1
- 101000645350 Homo sapiens T cell receptor beta joining 2-1 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 101710199268 Periostin Proteins 0.000 description 1
- 102100037765 Periostin Human genes 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 239000008156 Ringer's lactate solution Substances 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100037298 T cell receptor beta constant 2 Human genes 0.000 description 1
- 102100026271 T cell receptor beta joining 2-1 Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 210000000173 T-lymphoid precursor cell Anatomy 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 241000703392 Tribec virus Species 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 239000000061 acid fraction Substances 0.000 description 1
- 230000001464 adherent effect Effects 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 230000000735 allogeneic effect Effects 0.000 description 1
- 102000006707 alpha-beta T-Cell Antigen Receptors Human genes 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- ZEWYCNBZMPELPF-UHFFFAOYSA-J calcium;potassium;sodium;2-hydroxypropanoic acid;sodium;tetrachloride Chemical compound [Na].[Na+].[Cl-].[Cl-].[Cl-].[Cl-].[K+].[Ca+2].CC(O)C(O)=O ZEWYCNBZMPELPF-UHFFFAOYSA-J 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 1
- 235000021240 caseins Nutrition 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 108091008034 costimulatory receptors Proteins 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 210000000172 cytosol Anatomy 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 230000009274 differential gene expression Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 239000008151 electrolyte solution Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 102000048431 human POSTN Human genes 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 230000008629 immune suppression Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 229940100994 interleukin-7 Drugs 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000000329 lymphopenic effect Effects 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- FVVLHONNBARESJ-NTOWJWGLSA-H magnesium;potassium;trisodium;(2r,3s,4r,5r)-2,3,4,5,6-pentahydroxyhexanoate;acetate;tetrachloride;nonahydrate Chemical compound O.O.O.O.O.O.O.O.O.[Na+].[Na+].[Na+].[Mg+2].[Cl-].[Cl-].[Cl-].[Cl-].[K+].CC([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O FVVLHONNBARESJ-NTOWJWGLSA-H 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 210000001724 microfibril Anatomy 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000004713 phosphodiesters Chemical class 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical compound NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 210000004986 primary T-cell Anatomy 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- -1 rituximab Chemical compound 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 239000003001 serine protease inhibitor Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 108010047303 von Willebrand Factor Proteins 0.000 description 1
- 102100036537 von Willebrand factor Human genes 0.000 description 1
- 229960001134 von willebrand factor Drugs 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000012130 whole-cell lysate Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4267—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K40/4269—NY-ESO
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- the present invention pertains to antigen recognizing constructs against COL6A3 antigens.
- the invention in particular provides novel T cell receptor (TCR) based molecules which are selective and specific for the tumor expressed antigen COL6A3.
- TCR T cell receptor
- the TCR of the invention, and COL6A3 antigen binding fragments derived therefrom, are of use for the diagnosis, treatment and prevention of COL6A3 expressing cancerous diseases.
- the collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues.
- Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element.
- Collagen VI is a major structural component of microfibrils.
- the basic structural unit of collagen VI is a heterotrimer of the alpha 1(VI), alpha 2(VI), and alpha 3(VI) collagen chains.
- the alpha 1(VI) and alpha 2(VI) chains are encoded by the COL6A1 and COL6A2 genes, respectively.
- the protein encoded by the COL6A3 gene is the alpha 3 subunit of type VI collagen (alpha 3(VI) collagen chain) (Bertini et al., 2002 Eur. J. Paediatr.
- COL6A3′ s gene expression was previously shown to be associated with the progression of breast cancer and was elevated in colon cancer (Smith M J, et al. “Analysis of differential gene expression in colorectal cancer and stroma using fluorescence-activated cell sorting purification” British journal of cancer. 2009; 100:1452-1464; Tilman G et al “Human periostin gene expression in normal tissues, tumors and melanoma: evidences for periostin production by both stromal and melanoma cells” Mol Cancer. 2007; 6:80) and as a prognosis marker of colorectal carcinoma (Qiao J et al.
- COL6A3 is a potential prognosis marker of colorectal carcinoma revealed by quantitative proteomics” Oncotarget. 2015 Oct. 6; 6(30): 29929-29946).
- COL6A3 gene locates 2q37 in the human genome and contains 44 exons.
- the COL6A3 protein has 3177 amino acids and contains 12 Von Willebrand factor type A (vWA) domains, one fibronectin type 3 domain and one BPTI/Kunitz family of serine protease inhibitors (KU) domain.
- vWA Von Willebrand factor type A
- KU serine protease inhibitors
- T-cell based immunotherapy targets represent peptide epitopes derived from tumor-associated or tumor-specific proteins, which are presented by molecules of the major histocompatibility complex (MHC).
- MHC major histocompatibility complex
- TAAs tumor associated antigens
- TAAs can be peptides derived from all protein classes, such as enzymes, receptors, transcription factors, etc. which are expressed and, as compared to unaltered cells of the same origin, usually up-regulated in cells of the respective tumor.
- T-cells capable of specifically recognizing and destroying tumor cells.
- the isolation of T-cells from tumor-infiltrating cell populations or from peripheral blood suggests that such cells play an important role in natural immune defense against cancer.
- CD8-positive T-cells in particular, which recognize class I molecules of the major histocompatibility complex (MHC)-bearing peptides of usually 8 to 10 amino acid residues derived from proteins or defective ribosomal products (DRiPs) located in the cytosol, play an important role in this response.
- MHC-molecules of the human are also designated as human leukocyte-antigens (HLA).
- a TCR is a heterodimeric cell surface protein of the immunoglobulin super-family, which is associated with invariant proteins of the CD3 complex involved in mediating signal transduction.
- TCRs exist in ⁇ and ⁇ forms, which are structurally similar but have quite distinct anatomical locations and probably functions.
- the extracellular portion of native heterodimeric ⁇ TCR consists of two polypeptides, each of which has a membrane-proximal constant domain, and a membrane-distal variable domain. Each of the constant and variable domains includes an intra-chain disulfide bond.
- the variable domains contain the highly polymorphic loops analogous to the complementarity determining regions (CDRs) of antibodies.
- CDRs complementarity determining regions
- TCR will be transduced into central memory T cells or T cells with stem cell characteristics, which may ensure better persistence and function upon transfer.
- TCR-engineered T cells will be infused into cancer patients rendered lymphopenic by chemotherapy or irradiation, allowing efficient engraftment but inhibiting immune suppression.
- the object of the invention is solved in a first aspect by an antigen recognizing construct comprising at least one complementary determining region (CDR) 3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 3, 9, 15, 21, 27 and 33.
- CDR complementary determining region
- the antigen recognizing construct may further comprise a CDR1 and/or a CDR2 domain sequence.
- CDR1 and CDR2 are found in the variable (V) region of a polypeptide chain, and CDR3 includes some of V, all of diversity (D) and joining (J) regions.
- CDR3 is the most variable and is the main CDR responsible for specifically and selectively recognizing an antigen.
- CDR1 and CDR2 sequences may be selected from a CDR sequence of a human variable chain allele.
- Native alpha-beta heterodimeric TCRs have an alpha chain and a beta chain.
- Each chain comprises variable, joining and constant regions, and the beta chain also usually contains a short diversity region between the variable and joining regions, but this diversity region is often considered as part of the joining region.
- Each variable region comprises three CDRs (Complementarity Determining Regions) embedded in a framework sequence, one being the hypervariable region named CDR3.
- CDRs Complementarity Determining Regions
- the V ⁇ types are referred to in IMGT nomenclature by a unique TRAV number, V ⁇ types are referred to by a unique TRBV number.
- the antigen recognizing construct of the invention comprises CDR1, CDR2 and CDR3 sequences in a combination as provided in table 1 herein below, which display the respective variable chain allele together with the CDR3 sequence. Therefore, preferred are antigen recognizing constructs of the invention which comprise at least one, preferably, all three CDR sequences CDR1, CDR2 and CDR3.
- an antigen recognizing construct of the invention comprises the respective CDR1 to CDR3 of one individual herein disclosed TCR variable region of the invention.
- antigen recognizing construct can specifically bind to said antigen, preferably a COL6A3 antigen, more preferably with high avidity, when said antigen is by HLA, preferably HLA A2.
- a TCR as antigen recognizing construct, may be considered to have “antigenic specificity” for COL6A3 antigens, if T cells expressing the TCR and contacted with a COL6A3 presenting HLA secrete at least about 200 pg/ml or more (e.g., 250 pg/ml or more, 300 pg/ml or more, 400 pg/ml or more, 500 pg/ml or more, 600 pg/ml or more, 700 pg/ml or more, 1000 pg ml or more, 2,000 pg/ml or more, 2,500 pg/ml or more, 5,000 pg/ml or more) of interferon ⁇ (IFN- ⁇ ) upon co-culture with target cells pulsed with a low concentration of a COL6A3 antigen, such as the COL6A3 epitopes and antigens provided herein below (e.g., about 10-11 mol/1, 10-10),
- a TCR may be considered to have “antigenic specificity” for COL6A3, if T cells expressing the TCR secrete at least twice as much IFN- ⁇ as the untransduced background level of IFN- ⁇ upon co-culture with target cells pulsed with a low concentration of COL6A3 antigens.
- antigenic specificity for COL6A3
- Such a “specificity” as described above can—for example—be analyzed with an ELISA.
- the antigen recognizing construct selectively binds to a COL6A3 antigen; preferably wherein the COL6A3 antigen is a protein epitope or peptide having an amino acid sequence shown in SEQ ID NO: 58 to 67, most preferably SEQ ID NO: 58, or a variant thereof, wherein the variant is an amino acid deletion, addition, insertion or substitution of not more than three, preferably two and most preferably not more than one amino acid position.
- selectivity or “selective recognizing/binding” is understood to refer to the property of an antigen recognizing construct, such as a TCR or antibody, to selectively recognize or bind to preferably only one specific epitope and preferably shows no or substantially no cross-reactivity to another epitope.
- antigen recognizing construct e.g. a TCR
- the antigen recognizing construct according to the invention is preferably selected from an antibody, or derivative or fragment thereof, or a T cell receptor (TCR), or derivative or fragment thereof.
- a derivative or fragment of an antibody or TCR of the invention shall preferably retain the antigen binding/recognizing ability of the parent molecule, in particular its specificity and/or selectivity as explained above. Such binding functionality may be retained by the presence of a CDR3 region as defined herein.
- the inventive TCRs are able to recognize COL6A3 antigens in a major histocompatibility complex (MHC) class I-dependent manner.
- MHC class I-dependent manner means that the TCR elicits an immune response upon binding to COL6A3 antigens within the context of an MHC class I molecule.
- the MHC class I molecule can be any MHC class I molecule known in the art, e.g., HLA-A molecules.
- the MHC class I molecule is an HLA-A2 molecule.
- the invention provides both single chain antigen recognizing construct and double chain recognizing constructs.
- the invention in particular provides a TCR as antigen recognizing construct, or fragment or derivative thereof.
- the TCR preferably is of human, which is understood as being generated from a human TCR locus and therefore comprising human TCR sequences.
- the TCR of the invention may be characterized in that it is of human origin and specifically recognizes a COL6A3 antigen.
- Another embodiment of the invention additionally or alternatively provides the antigen recognizing construct described above, which induces an immune response, preferably wherein the immune response is characterized by an increase in interferon (IFN) ⁇ levels.
- IFN interferon
- TCRs of the invention may be provided as single chain ⁇ or ⁇ or ⁇ and ⁇ , molecules, or alternatively as double chain constructs composed of both the ⁇ and ⁇ chain, or ⁇ and ⁇ chain.
- the antigen recognizing construct of the invention may comprise a TCR ⁇ or ⁇ chain; and/or a TCR ⁇ or ⁇ chain; wherein the TCR ⁇ or ⁇ chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos.
- TCR ⁇ or ⁇ chain comprises a CDR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 9, 21, and 33.
- antigen recognizing constructs comprising any one, two or all of the CDR1 to CDR3 regions of the herein disclosed TCR chains (see table 1)
- such antigen recognizing constructs may be preferred, which comprise the respective CDR sequence having three, two, and preferably only one, modified amino acid residues.
- a modified amino acid residue may be selected from an amino acid insertion, deletion or substitution. Most preferred is that the three, two, preferably one modified amino acid residue is the first or last amino acid residue of the respective CDR sequence. If the modification is a substitution then it is preferable in some embodiments that the substitution is a conservative amino acid substitution.
- the antigen recognizing construct of the invention is composed of at least two amino acid chains, such as a double chain TCR, or antigen binding fragment thereof
- the antigen recognizing construct may comprises in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 3, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 9; or in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 15, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 21; or in a first polypeptide chain the amino acid sequence according to SEQ ID NO: 27, and in a second polypeptide chain the amino acid sequence according to SEQ ID NO: 33.
- the CDR3 of the double chain TCR of the invention may be mutated. Mutations of the CDR3 sequences of SEQ ID NOs: 9 to 28 as provided above preferably include a substitution, deletion, addition, or insertion of not more than three, preferably two, and most preferably not more than one amino acid residue.
- the first polypeptide chain may be a TCR ⁇ or ⁇ chain
- the second polypeptide chain may be a TCR ⁇ or ⁇ chain. Preferred is the combination of an ⁇ or ⁇ TCR.
- the TCR is in some embodiments composed of a TCR ⁇ and a TCR ⁇ chain, or ⁇ and ⁇ chain.
- a double chain TCR comprises within each chain variable regions, and the variable regions each comprise one CDR1, one CDR2 and one CDR3 sequence.
- the TCRs comprises the CDR1 to CDR3 sequences as comprised in the variable chain amino acid sequence of SEQ ID NO: 4 and SEQ ID NO: 10 (R4P1D10), or SEQ ID NO: 16 and SEQ ID NO: 22 (R4P3F9); or SEQ ID NO: 28 and SEQ ID NO: 34 (R4P3H3).
- Some embodiments of the invention pertain to a TCR, or a fragment thereof, composed of a TCR ⁇ and a TCR ⁇ chain, wherein said TCR comprises the variable region sequences having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to the amino acid sequence selected from the ⁇ and ⁇ chain according to SEQ ID NO: 4 and 10 respectively, or 16 and 22 respectively; or 28 and 34 respectively.
- the inventive TCRs may further comprise a constant region derived from any suitable species, such as any mammal, e.g., human, rat, monkey, rabbit, donkey, or mouse.
- the inventive TCRs further comprise a human constant region.
- the constant region of the TCR of the invention may be slightly modified, for example, by the introduction of heterologous sequences, preferably mouse sequences, which may increase TCR expression and stability.
- Some embodiments of the invention pertain to a TCR, or a fragment thereof, composed of a TCR ⁇ and a TCR ⁇ chain, wherein said TCR comprises the constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or preferably 100% sequence identity to an amino acid sequence selected from of the ⁇ and ⁇ chain according to SEQ ID NO: 5 and 11 respectively, or 17 and 23 respectively; or 29 and 35 respectively.
- the TCR ⁇ or ⁇ chain of the invention may further comprise a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 1, 13, and 25; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 2, 14, and 26.
- the TCR ⁇ or ⁇ chain may further comprise a CDR1 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 7, 19, and 31; and/or a CDR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 8, 20, and 32.
- the antigen recognizing construct may in a further embodiment comprise a binding fragment of a TCR, and wherein said binding fragment comprises CDR1 to CDR3, optionally selected from the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID Nos. 1, 2, 3, or 7, 8, 9 or 13, 14, 15, or 19, 20, 21, or 25, 26, 27 or 31, 32, 33.
- the antigen recognizing construct as described herein before is a TCR, or a fragment thereof, composed of at least one TCR ⁇ and one TCR ⁇ chain sequence, wherein said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 1 to 3, and said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 7 to 9; or wherein said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 13 to 15, and said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 19 to 21; or wherein said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO: 25 to 27, and said TCR ⁇ chain sequence comprises the CDR1 to CDR3 sequences having the amino acid sequences of SEQ ID NO:
- the antigen recognizing construct as described herein before is a TCR, or a fragment thereof, comprising at least one TCR ⁇ and one TCR ⁇ chain sequence, wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 4, and wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 10; or wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 16, and wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 22; or wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 28, and wherein said TCR ⁇ chain sequence comprises a variable region sequence having the amino acid sequence of SEQ ID No. 34.
- the antigen recognizing construct as described herein before is a TCR, or a fragment thereof, further comprising a TCR constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 11, 17, 23, 29 and 35, preferably wherein the TCR is composed of at least one TCR ⁇ and one TCR ⁇ chain sequence, wherein the TCR ⁇ chain sequence comprises a constant region having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID Nos. 5, 17, and 29.
- antigen recognizing constructs as described herein before comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 6, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 12.
- the invention also provides TCRs comprising a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No.
- the invention provides antigen recognizing constructs which are TCR and comprise a first TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 30, and a second TCR chain having at least 50%, 60%, 70%, 80%, 90%, 95%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID No. 36.
- the term “murine” or “human,” when referring to an antigen recognizing construct, or a TCR, or any component of a TCR described herein means a TCR (or component thereof), which is derived from a mouse or a human unrearranged TCR locus, respectively.
- chimeric TCR are provided, wherein the TCR chains comprise sequences from multiple species.
- a TCR of the invention may comprise an ⁇ chain comprising a human variable region of an ⁇ chain and, for example, a murine constant region of a murine TCR ⁇ chain.
- the TCR of the invention is a human TCR comprising human variable regions according to the above embodiments and human constant regions.
- the TCR of the invention may be provided as a single chain TCR (scTCR).
- a scTCR can comprise a polypeptide of a variable region of a first TCR chain (e.g., an alpha chain) and a polypeptide of an entire (full-length) second TCR chain (e.g., a beta chain), or vice versa.
- the scTCR can optionally comprise one or more linkers which join the two or more polypeptides together.
- the linker can be, for instance, a peptide, which joins together two single chains, as described herein.
- a scTCR of the invention which is fused to a human cytokine, such as IL-2, IL-7 or IL-15.
- the antigen recognizing construct according to the invention can also be provided in the form of a multimeric complex, comprising at least two scTCR molecules, wherein said scTCR molecules are each fused to at least one biotin moiety, and wherein said scTCRs are interconnected by biotin-streptavidin interaction to allow the formation of said multimeric complex.
- a multimeric complex comprising at least two scTCR molecules, wherein said scTCR molecules are each fused to at least one biotin moiety, and wherein said scTCRs are interconnected by biotin-streptavidin interaction to allow the formation of said multimeric complex.
- Similar approaches for the generation of multimeric TCR are also possible and included in this disclosure.
- multimeric complexes of a higher order comprising more than two scTCR of the invention.
- a TCR is a moiety having at least one TCR alpha or gamma and/or TCR beta or delta variable domain. Generally, they comprise both a TCR alpha variable domain and a TCR beta variable domain. They may be ⁇ heterodimers or may be in single chain format. For use in adoptive therapy, an ⁇ heterodimeric TCR may, for example, be transfected as full length chains having both cytoplasmic and transmembrane domains. If desired, an introduced disulfide bond between residues of the respective constant domains may be present.
- the antigen recognizing construct is a human TCR, or fragment or derivative thereof.
- a human TCR or fragment or derivative thereof is a TCR, which comprises over 50% of the corresponding human TCR sequence.
- Preferably, only a small part of the TCR sequence is of artificial origin or derived from other species.
- chimeric TCRs e.g. derived from human origin with murine sequences in the constant domains, are advantageous.
- Particularly preferred are, therefore, TCRs in accordance with the present invention, which contains murine sequences in the extracellular part of their constant domains.
- the inventive antigen recognizing construct is able to recognize its antigen in a human leucocyte antigen (HLA) dependent manner, preferably in a HLA-A02 dependent manner.
- HLA dependent manner in the context of the present invention means that the antigen recognizing construct binds to the antigen only in the event that the antigenic peptide is presented by said HLA.
- the antigen recognizing construct in accordance with the invention in one embodiment preferably induces an immune response, preferably wherein the immune response is characterized by the increase in interferon (IFN) ⁇ levels.
- IFN interferon
- polypeptide comprising a functional portion of any of the TCRs (or functional variants thereof) described herein, for examples, of any one of the TCRs selected from R4P1D10, R4P3F9, and R4P3H3, as provided in the example section and table 1.
- polypeptide as used herein includes oligopeptides and refers to a single chain of amino acids connected by one or more peptide bonds.
- the functional portion can be any portion comprising contiguous amino acids of the TCR (or functional variant thereof), of which it is a part, provided that the functional portion specifically binds to a COL6A3 antigen, preferably as disclosed herein in table 2, and peptides A1 to A9 (SEQ ID NOs: 59-67).
- the term “functional portion” when used in reference to a TCR (or functional variant thereof) refers to any part or fragment of the TCR (or functional variant thereof) of the invention, which part or fragment retains the biological activity of the TCR (or functional variant thereof), of which it is a part (the parent TCR or parent functional variant thereof).
- Functional portions encompass, for example, those parts of a TCR (or functional variant thereof) that retain the ability to specifically bind to a COL6A3 antigen (in an HLA-A2-dependent manner), or detect, treat, or prevent cancer, to a similar extent, the same extent, or to a higher extent, as the parent TCR (or functional variant thereof).
- the functional portion can comprise, for instance, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent TCR variable sequences (or functional variant thereof).
- the functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, in which additional amino acids are not found in the amino acid sequence of the parent TCR or functional variant thereof.
- the additional amino acids do not interfere with the biological function of the functional portion, e.g., specifically binding to COL6A3 antigens; and/or having the ability to detect cancer, treat or prevent cancer, etc. More desirably, the additional amino acids enhance the biological activity, as compared to the biological activity of the parent TCR or functional variant thereof.
- the polypeptide can comprise a functional portion of either or both of the ⁇ and ⁇ chains of the TCRs or functional variant thereof of the invention, such as a functional portion comprising one of more of CDR1, CDR2, and (preferably) CDR3 of the variable region(s) of the ⁇ chain and/or ⁇ chain of a TCR or functional variant thereof of the invention.
- the polypeptide can comprise a functional portion comprising the amino acid sequence of SEQ ID NO: 3, 9, 15, 21, 27, and 33 (CDR3 of the variable regions of the TCR of the invention), or a combination thereof.
- the inventive polypeptide can comprise, for instance, the variable region of the inventive TCR or functional variant thereof comprising a combination of the CDR regions set forth above.
- the polypeptide can comprise the amino acid sequence of any of SEQ ID NO: 4, 10, 16, 22, 28, and 34 (the variable regions of an ⁇ or ⁇ chain of the TCR of the invention).
- the construct of the invention may comprise one or two polypeptide chains comprising a sequences according to any of the SEQ ID NO: 1 to 36 (CDR sequences, constant and variable regions and full length sequences), or functional fragments thereof, and further comprise(s) other amino acid sequences, e.g., an amino acid sequence encoding an immunoglobulin or a portion thereof, then the inventive protein can be a fusion protein.
- the invention also provides a fusion protein comprising at least one of the inventive polypeptides described herein along with at least one other polypeptide.
- the other polypeptide can exist as a separate polypeptide of the fusion protein, or can exist as a polypeptide, which is expressed in frame (in tandem) with one of the inventive polypeptides described herein.
- the other polypeptide may include any peptidic or proteinaceous molecule, or a portion thereof, including, but not limited to an immunoglobulin, CD3, CD4, CD8, an MHC molecule, a CD1 molecule, e.g., CD1a, CD1b, CD1c, CD1d, etc.
- the fusion protein can comprise one or more copies of the inventive polypeptide and/or one or more copies of the other polypeptide.
- the fusion protein can comprise 1, 2, 3, 4, 5, or more, copies of the inventive polypeptide and/or of the other polypeptide.
- Suitable methods of making fusion proteins are known in the art, and include, for example, recombinant methods.
- the TCRs (and functional portions and functional variants thereof), polypeptides, and proteins of the invention may be expressed as a single protein comprising a linker peptide linking the ⁇ chain and the ⁇ chain, and linking the ⁇ chain and the ⁇ chain.
- the TCRs (and functional variants and functional portions thereof), polypeptides, and proteins of the invention comprising the amino acid sequences of the variable regions of the TCR of the invention and may further comprise a linker peptide.
- the linker peptide may advantageously facilitate the expression of a recombinant TCR (including functional portions and functional variants thereof), polypeptide, and/or protein in a host cell.
- the linker peptide may comprise any suitable amino acid sequence.
- Linker sequences for single chain TCR constructs are well known in the art. Such a single chain construct may further comprise one, or two, constant domain sequences. Upon expression of the construct including the linker peptide by a host cell, the linker peptide may also be cleaved, resulting in separated ⁇ and ⁇ chains, and separated ⁇ and ⁇ chain.
- the binding functionality of the TCR of the invention may be provided in the framework of an antibody.
- antibody in its various grammatical forms is used herein to refer to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen-binding site or a paratope. Such molecules are also referred to as “antigen binding fragments” of immunoglobulin molecules.
- the invention further provides an antibody, or antigen binding portion thereof, which specifically binds to the antigens described herein.
- the antibody can be any type of immunoglobulin that is known in the art.
- the antibody can be of any isotype, e.g., IgA, IgD, IgE, IgG, IgM, etc.
- the antibody can be monoclonal or polyclonal.
- the antibody can be a naturally-occurring antibody, e.g., an antibody isolated and/or purified from a mammal, e.g., mouse, rabbit, goat, horse, chicken, hamster, human, etc.
- the antibody can be a genetically-engineered antibody, e.g., a humanized antibody or a chimeric antibody.
- the antibody can be in monomeric or polymeric form.
- the invention also provides antigen binding portions of any of the antibodies described herein.
- the antigen binding portion can be any portion that has at least one antigen binding site, such as Fab, F(ab′)2, dsFv, sFv, diabodies, and triabodies.
- a single-chain variable region fragment (sFv) antibody fragment which consists of a truncated Fab fragment comprising the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide, can be generated using routine recombinant DNA technology techniques.
- disulfide-stabilized variable region fragments can be prepared by recombinant DNA technology
- antibody fragments of the invention are not limited to these exemplary types of antibody fragments.
- the antibody, or antigen binding portion thereof can be modified to comprise a detectable label, such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)
- FITC fluorescein isothiocyanate
- PE phycoerythrin
- an enzyme e.g., alkaline phosphata
- the TCR CDR3 sequence may be slightly modified, but preferably by not more than 3 amino acid residues, preferably only two and most preferably only one amino acid position, as compared to the CDR3 sequences provided in SEQ ID Nos: 3, 9, 15, 21, 27, and 33.
- the antibodies comprise the CDR3, preferably all of CDR1 to CDR3 regions in the combination, as indicated for the TCR of the invention in table 1.
- Suitable methods of making antibodies are known in the art. For instance, standard hybridoma methods are described in, e.g., Kohler and Milstein, Eur. J. Immunol, 5, 51 1-519 (1976), Harlow and Lane (eds.), Antibodies: A Laboratory Manual, CSH Press (1988), and C. A. Janeway et al. (eds.), Immunobiology, 8 Ed., Garland Publishing, New York, N.Y. (2011)). Alternatively, other methods, such as EBV-hybridoma methods (Haskard and Archer, J. Immunol.
- TCRs or functional fragments and polypeptides thereof, which are soluble TCRs.
- soluble T-cell receptor refers to heterodimeric truncated variants of native TCRs, which comprise extracellular portions of the TCR ⁇ -chain and ⁇ -chain linked by a disulfide bond, but which lack the transmembrane and cytosolic domains of the native protein.
- soluble T-cell receptor ⁇ -chain sequence and soluble T-cell receptor ⁇ -chain sequence refer to TCR ⁇ -chain and ⁇ -chain sequences that lack the transmembrane and cytosolic domains.
- the sequence (amino acid or nucleic acid) of the soluble TCR ⁇ -chain and ⁇ -chains may be identical to the corresponding sequences in a native TCR or may comprise variant soluble TCR ⁇ -chain and ⁇ -chain sequences, as compared to the corresponding native TCR sequences.
- the term “soluble T-cell receptor” as used herein encompasses soluble TCRs with variant or non-variant soluble TCR ⁇ -chain and ⁇ -chain sequences.
- the variations may be in the variable or constant regions of the soluble TCR ⁇ -chain and ⁇ -chain sequences and can include, but are not limited to, amino acid deletion, insertion, substitution mutations as well as changes to the nucleic acid sequence, which do not alter the amino acid sequence. Soluble TCR of the invention in any case retain the binding functionality of their parent molecules.
- nucleic acid encoding for an antigen recognizing construct of the invention, or any of the aforementioned protein or polypeptide constructs.
- the nucleic acid preferably (a) has a strand encoding for an antigen recognizing construct according to the invention; (b) has a strand complementary to the strand in (a); or (c) has a strand that hybridizes under stringent conditions with a molecule as described in (a) or (b). Stringent conditions are known to the person of skill in the art, specifically from Sambrook et al, “Molecular Cloning”.
- the nucleic acid optionally has further sequences, which are necessary for expressing the nucleic acid sequence corresponding to the protein, specifically for expression in a mammalian/human cell.
- the nucleic acid used can be contained in a vector suitable for allowing expression of the nucleic acid sequence corresponding to the peptide in a cell.
- the nucleic acids can also be used to transform an antigen-presenting cell, which may not be restricted to classical antigen-presenting cells, such as dendritic cells, in such a way that they themselves produce the corresponding proteins on their cellular surface.
- nucleic acid includes “polynucleotide,” “oligonucleotide,” and “nucleic acid molecule,” and generally means a polymer of DNA or RNA, which can be single-stranded or double-stranded, synthesized or obtained (e.g., isolated and/or purified) from natural sources, which can contain natural, non-natural or altered nucleotides, and can contain a natural, non-natural or altered internucleotide linkage, such as a phosphoroamidate linkage or a phosphorothioate linkage, instead of the phosphodiester found between the nucleotides of an unmodified oligonucleotide.
- the nucleic acids of the invention are recombinant.
- the term “recombinant” refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above.
- the replication can be in vitro replication or in vivo replication.
- the nucleic acid can comprise any nucleotide sequence, which encodes any of the TCRs, polypeptides, or proteins, or functional portions or functional variants thereof described herein.
- the invention provides a vector comprising a nucleic acid in accordance to the invention as described above.
- the vector is an expression vector or a recombinant expression vector.
- the term “recombinant expression vector” refers in context of the present invention to a nucleic acid construct that allows for the expression of an mRNA, protein or polypeptide in a suitable host cell.
- the recombinant expression vector of the invention can be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses. Examples of animal expression vectors include pEUK-Cl, pMAM, and pMAMneo.
- the recombinant expression vector is a viral vector, e.g., a retroviral vector.
- the recombinant expression vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterium, fungus, plant, or animal), into which the vector is to be introduced and in which the expression of the nucleic acid of the invention may be performed.
- the vector of the invention may include one or more marker genes, which allow for selection of transformed or transfected hosts.
- the recombinant expression vector can comprise a native or normative promoter operably linked to the nucleotide sequence encoding the constructs of the invention, or to the nucleotide sequence, which is complementary to or which hybridizes to the nucleotide sequence encoding the constructs of the invention.
- the selections of promoters include, e.g., strong, weak, inducible, tissue-specific and developmental-specific promoters.
- the promoter can be a non-viral promoter or a viral promoter.
- the inventive recombinant expression vectors can be designed for either transient expression, for stable expression, or for both. Also, the recombinant expression vectors can be made for constitutive expression or for inducible expression.
- the invention also pertains to a host cell comprising an antigen recognizing construct in accordance with the invention.
- the host cell of the invention comprises a nucleic acid, or a vector as described herein above.
- the host cell can be a eukaryotic cell, e.g., plant, animal, fungi, or algae, or can be a prokaryotic cell, e.g., bacteria or protozoa.
- the host cell can be a cultured cell or a primary cell, i.e., isolated directly from an organism, e.g., a human.
- the host cell can be an adherent cell or a suspended cell, i.e., a cell that grows in suspension.
- the host cell is preferably a mammalian cell. Most preferably, the host cell is a human cell. While the host cell can be of any cell type, can originate from any type of tissue, and can be of any developmental stage, the host cell preferably is a peripheral blood leukocyte (PBL) or a peripheral blood mononuclear cell (PBMC). More preferably, the host cell is a T cell.
- PBL peripheral blood leukocyte
- PBMC peripheral blood mononuclear cell
- the T cell can be any T cell, such as a cultured T cell, e.g., a primary T cell, or a T cell from a cultured T cell line, e.g., Jurkat, SupT1, etc., or a T cell obtained from a mammal, preferably a T cell or T cell precursor from a human patient. If obtained from a mammal, the T cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. T cells can also be enriched for or purified.
- the T cell is a human T cell. More preferably, the T cell is a T cell isolated from a human.
- the T cell can be any type of T cell and can be of any developmental stage, including but not limited to, CD4-positive and/or CD8-positive, CD4-positive helper T cells, e.g., Th1 and Th2 cells, CD8-positive T cells (e.g., cytotoxic T cells), tumor infiltrating cells (TILs), memory T cells, naive T cells, and the like.
- CD4-positive and/or CD8-positive CD4-positive helper T cells
- CD8-positive T cells e.g., cytotoxic T cells
- TILs tumor infiltrating cells
- memory T cells e.g., naive T cells, and the like.
- the T cell is a CD8-positive T cell or a CD4-positive T cell.
- the host cell of the invention is a lymphocyte, preferably, a T lymphocyte, such as a CD4-positive or CD8-positive T-cell.
- the host cell furthermore preferably is a tumor reactive T cell specific for COL6A3 expressing tumor cells.
- One further aspect of the present invention relates to the herein disclosed antigen recognizing constructs, nucleic acids, vectors, pharmaceutical compositions and/or host cell for use in medicine.
- the use in medicine in one preferred embodiment includes the use in the diagnosis, prevention and/or treatment of a tumor disease, such as a malignant or benign tumor disease.
- the tumor disease is, for example, a tumor disease characterized by the expression of COL6A3, in a cancer or tumor cell of said tumor disease.
- the to be treated and/or diagnosed cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vagina, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, gastrointestinal carcinoid tumor, glioma, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer, malignant mesothelioma, mela
- a preferred cancer is cancer is cancer of the uterine cervix, oropharynx, anus, anal canal, anorectum, vagina, vulva, or penis.
- a particularly preferred cancer is a COL6A3 positive cancer, including gastrointestinal and gastric cancer.
- the constructs, proteins, TCRs antibodies, polypeptides and nucleic acids of the invention are in particular for use in immune therapy, preferably, in adoptive T cell therapy.
- the administration of the compounds of the invention can, for example, involve the infusion of T cells of the invention into said patient.
- T cells are autologous T cells of the patient and in vitro transduced with a nucleic acid or antigen recognizing construct of the present invention.
- WO 2016/011210 discloses engineered cells for adoptive therapy, including NK cells and T cells, and compositions containing the cells, and methods for their administration to subjects.
- the cells can contain genetically engineered antigen receptors that specifically bind to antigens, such as chimeric antigen receptors (CARs) and costimulatory receptors.
- CARs chimeric antigen receptors
- the objective of the invention is also solved by a method of manufacturing a COL6A3 specific antigen recognizing construct expressing cell line, comprising
- the method may further comprise a step of cell surface presentation of said antigen recognizing construct on said suitable host cell.
- the genetic construct is an expression construct comprising a promoter sequence operably linked to said coding sequence.
- said antigen recognizing construct is of mammalian origin, preferably of human origin.
- the preferred suitable host cell for use in the method of the invention is a mammalian cell, such as a human cell, in particular a human T lymphocyte. T cells for use in the invention are described in detail herein above.
- said antigen recognizing construct is a modified TCR, wherein said modification is the addition of functional domains, such as a label or a therapeutically active substance.
- TCR having alternative domains, such as an alternative membrane anchor domain instead of the endogenous transmembrane region.
- the transfection system for introducing the genetic construct into said suitable host cell is a retroviral vector system.
- retroviral vector system Such systems are well known to the skilled artisan.
- Also comprised by the present invention is in one embodiment the additional method step of isolation and purification of the antigen recognizing construct from the cell and, optionally, the reconstitution of the translated antigen recognizing construct-fragments in a T-cell.
- a T-cell obtained or obtainable by a method for the production of a T cell receptor (TCR), which is specific for tumorous cells and has high avidity as described herein above.
- TCR T cell receptor
- Such a T cell is depending on the host cell used in the method of the invention, for example, a human or non-human T-cell, preferably a human TCR.
- inventive TCRs, polypeptides, proteins, (including functional variants thereof), nucleic acids, recombinant expression vectors, host cells (including populations thereof), and antibodies (including antigen binding portions thereof), can be isolated and/or purified.
- isolated means having been removed from its natural environment.
- purified means having been increased in purity, wherein “purity” is a relative term, and not to be necessarily construed as absolute purity. For example, the purity can be at least about 50%, can be greater than 60%, 70%, 80%, 90%, 95%, or can be 100%.
- inventive antigen recognizing constructs, TCRs, polypeptides, proteins (including functional variants thereof), nucleic acids, recombinant expression vectors, host cells (including populations thereof), and antibodies (including antigen binding portions thereof), all of which are collectively referred to as “inventive TCR materials” hereinafter, can be formulated into a composition, such as a pharmaceutical composition.
- the invention provides a pharmaceutical composition comprising any of the antigen recognizing constructs, TCRs, polypeptides, proteins, functional portions, functional variants, nucleic acids, expression vectors, host cells (including populations thereof), and antibodies (including antigen binding portions thereof) described herein, and a pharmaceutically acceptable carrier, excipient and/or stabilizer.
- inventive pharmaceutical compositions containing any of the inventive TCR materials can comprise more than one inventive TCR material, e.g., a polypeptide and a nucleic acid, or two or more different TCRs (including functional portions and functional variants thereof).
- the pharmaceutical composition can comprise an inventive TCR material in combination with another pharmaceutically active agent(s) or drug(s), such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
- chemotherapeutic agents e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate,
- the carrier is a pharmaceutically acceptable carrier.
- the carrier can be any of those conventionally used for the particular inventive TCR material under consideration.
- Such pharmaceutically acceptable carriers are well-known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one, which has no detrimental side effects or toxicity under the conditions of use.
- compositions comprising any of the herein described products of the invention and TCR materials of the invention, specifically any proteins, nucleic acids or host cells.
- pharmaceutical composition is for immune therapy, preferably adoptive cell therapy.
- the inventive TCR material is administered by injection, e.g., intravenously.
- the pharmaceutically acceptable carrier for the cells for injection may include any isotonic carrier such as, for example, normal saline (about 0.90% w/v of NaCl in water, about 300 mOsm/L NaCl in water, or about 9.0 g NaCl per liter of water), NORMOSOL R electrolyte solution (Abbott, Chicago, Ill.), PLASMA-LYTE A (Baxter, Deerfield, Ill.), about 5% dextrose in water, or Ringer's lactate.
- the pharmaceutically acceptable carrier is supplemented with human serum albumen.
- the amount or dose (e.g., numbers of cells when the inventive TCR material is one or more cells) of the inventive TCR material administered may be sufficient to affect, e.g., a therapeutic or prophylactic response, in the subject or animal over a reasonable time frame.
- the dose of the inventive TCR material should be sufficient to bind to a cancer antigen, or detect, treat or prevent cancer in a period of from about 2 hours or longer, e.g., 12 to 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer.
- the dose will be determined by the efficacy of the particular inventive TCR material and the condition of the animal (e.g., human), as well as the body weight of the animal (e.g., human) to be treated.
- inventive pharmaceutical compositions TCRs (including functional variants thereof), polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, or populations of cells can be used in methods of treating or preventing cancer, or COL6A3-positive premalignancy.
- inventive TCRs and functional variants thereof are believed to bind specifically to COL6A3 antigen, such that the TCR (or related inventive polypeptide or protein and functional variants thereof), when expressed by a cell, is able to mediate an immune response against a target cell expressing the COL6A3 antigens of the invention.
- the invention provides a method of treating or preventing a condition, in particular cancer, in a mammal, comprising administering to the mammal any of the pharmaceutical compositions, antigen recognizing constructs, in particular TCRs (and functional variants thereof), polypeptides, or proteins described herein, any nucleic acid or recombinant expression vector comprising a nucleotide sequence encoding any of the TCRs (and functional variants thereof), polypeptides, proteins described herein, or any host cell or population of cells comprising a recombinant vector, which encodes any of the constructs of the invention (and functional variants thereof), polypeptides, or proteins described herein, in an amount effective to treat or prevent the condition in the mammal, wherein the condition is cancer, preferably COL6A3 positive cancer.
- Examples of pharmaceutically acceptable carriers or diluents useful in the present invention include stabilizers such as SPGA, carbohydrates (e.g. sorbitol, mannitol, starch, sucrose, glucose, dextran), proteins such as albumin or casein, protein containing agents such as bovine serum or skimmed milk and buffers (e.g. phosphate buffer).
- stabilizers such as SPGA
- carbohydrates e.g. sorbitol, mannitol, starch, sucrose, glucose, dextran
- proteins such as albumin or casein
- protein containing agents such as bovine serum or skimmed milk
- buffers e.g. phosphate buffer
- inventive methods can provide any amount of any level of treatment or prevention of a condition in a mammal.
- the treatment or prevention provided by the inventive method can include treatment or prevention of one or more conditions or symptoms of the condition, e.g., cancer, being treated or prevented.
- treatment or prevention can include promoting the regression of a tumor.
- prevention can encompass delaying the onset of the condition, or a symptom or condition thereof.
- the present invention also relates to a method of treating cancer comprising administering a TCR, a nucleic acid, or a host cell of the present description in combination with at least one chemotherapeutic agent and/or radiation therapy.
- Also provided is a method of detecting cancer in a biological sample comprising:
- the method of detecting cancer is carried out in vitro, in vivo or in situ.
- the method comprises (i) contacting a sample comprising one or more cells from the mammal with any of the inventive TCRs (and functional variants thereof), polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, populations of cells, antibodies, or antigen binding portions thereof, or pharmaceutical compositions described herein, thereby forming a complex, and detecting the complex, wherein detection of the complex is indicative of the presence of the condition in the mammal, wherein the condition is cancer, such as a COL6A3-positive malignancy.
- the sample of cells can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction.
- the contacting can take place in vitro or in vivo with respect to the mammal.
- the contacting is in vitro.
- the inventive antigen recognizing constructs and functional variants thereof, polypeptides, proteins, nucleic acids, recombinant expression vectors, host cells, populations of cells, or antibodies or TCRs, or antigen binding portions thereof, described herein, can be labeled with a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g.
- the cells can be cells that are allogeneic or autologous to the mammal.
- the cells are autologous to the mammal.
- the to be treated and/or diagnosed cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia, alveolar rhabdomyosarcoma, bone cancer, brain cancer, breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vagina, cancer of the vulva, chronic lymphocytic leukemia, chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, gastrointestinal carcinoid tumor, glioma, Hodgkin lymphoma, hypopharynx cancer, kidney cancer, larynx cancer, liver cancer, lung cancer, malignant mesothelioma, melanoma, multiple myel
- a preferred cancer is cancer is cancer of the uterine cervix, oropharynx, anus, anal canal, anorectum, vagina, vulva, or penis.
- a particularly preferred cancer is a COL6A3 positive cancer, such as gastrointestinal or gastric cancer.
- the invention provides a method for treating a subject suffering from a tumor or tumor disease comprising the administration of the antigen recognizing constructs, nucleic acids, vectors, pharmaceutical compositions and/or host cell as disclosed by the present invention.
- the subject is a subject in need of such a treatment.
- the subject in preferred embodiments is a mammalian subject, preferably a human patient, suffering from a tumor or tumor disease, which is COL6A3-positive.
- FIG. 1 IFN ⁇ release (left axis) and HLA-A*02/COL6A3-002 tetramer staining (right axis) of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P1D10 (Table 1), respectively, after co-incubation with K562-A2 target cells (see Hirano N. et al; Blood. 2006 Feb.
- FIG. 2 IFN ⁇ release (left axis) and HLA-A*02/COL6A3-002 tetramer staining (right axis) of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P1D10 (Table 1), respectively, after co-incubation with K562-A2 target cells loaded with COL6A3-002 peptide (SEQ ID NO:58), homologous but unrelated peptide AGRN-001, CLASP-001, COL6A1-001, COL6A2-001, COL6A3-006, COL6A3-008, COL6A3-014, VWA2-001, VWF-001 (SEQ ID NO:49-57) or NYESO1-001 control peptide (SEQ ID NO:68). Electroporated CD8+ T-cells only (E only) serve as control.
- FIG. 3 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of J.RT3-T3.5 cells electroporated with alpha and beta chain RNA of TCR R4P1D10 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated J.RT3-T3.5 cells serve as control.
- FIG. 4 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of SUP-T1 cells electroporated with alpha and beta chain RNA of TCR R4P1D10 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated SUP-T1 cells serve as control.
- FIG. 5 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P1D10 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated CD8+ T-cells serve as control.
- FIG. 6 IFN ⁇ release of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P3F9 (Table 1), respectively, after co-incubation with K562-A2 target cells loaded with COL6A3-002 peptide (SEQ ID NO:58), various COL6A3-002 alanine or glycine substitution variants at positions 1-9 of (SEQ ID NO:59-67), or NYESO1-001 control peptide (SEQ ID NO:68).
- FIG. 7 IFN ⁇ release of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P3F9 (Table 1), respectively, after co-incubation with K562-A2 target cells loaded with COL6A3-002 peptide (SEQ ID NO:58), homologous but unrelated peptide AGRN-001, CLASP-001, COL6A1-001, COL6A2-001, COL6A3-006, COL6A3-008, COL6A3-014, VWA2-001, VWF-001 (SEQ ID NO:49-57) or NYESO1-001 control peptide (SEQ ID NO:68). Mock electroporated CD8+ T-cells (E only) serve as control.
- FIG. 8 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of J.RT3-T3.5 cells electroporated with alpha and beta chain RNA of TCR R4P3F9 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated J.RT3-T3.5 cells serve as control.
- FIG. 9 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of SUP-T1 cells electroporated with alpha and beta chain RNA of TCR R4P3F9 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated SUP-T1 cells serve as control.
- FIG. 10 IFN ⁇ release of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P3H3 (Table 1), respectively, after co-incubation with K562-A2 target cells loaded with COL6A3-002 peptide (SEQ ID NO:58), various COL6A3-002 alanine or glycine substitution variants at positions 1-9 of (SEQ ID NO:59-67) or NYESO1-001 control peptide (SEQ ID NO:68).
- FIG. 11 IFN ⁇ release of human primary CD8+ T-cells of one donor electroporated with alpha and beta chain RNA of TCR R4P3H3 (Table 1), respectively, after co-incubation with K562-A2 target cells loaded with COL6A3-002 peptide (SEQ ID NO:58), homologous but unrelated peptide AGRN-001, CLASP-001, COL6A1-001, COL6A2-001, COL6A3-006, COL6A3-008, COL6A3-014, VWA2-001, VWF-001 (SEQ ID NO:49-57) or NYESO1-001 control peptide (SEQ ID NO:68). Mock electroporated CD8+ T-cells (E only) serve as control.
- FIG. 12 HLA-A*02/COL6A3-002 tetramer and HLA-A*02/NYESO1-001 tetramer staining, respectively, of SUP-T1 cells electroporated with alpha and beta chain RNA of TCR R4P3H3 or NYESO1-001-specific control TCR 1G4 (Table 1). Mock electroporated SUP-T1 cells serve as control.
- TCR sequences of the invention SEQ ID NO: TCR Chain Region Sequence 1 R4P1D10 alpha CDR1 DRGSQS 2 R4P1D10 alpha CDR2 IY 3 R4P1D10 alpha CDR3 CAVNFHDKIIF 4 R4P1D10 alpha variable domain MKSLRVLLVILWLQLSWVWSQQKE VEQNSGPLSVPEGAIASLNCTYSDRG SQSFFWYRQYSGKSPELIMFIYSNGD KEDGRFTAQLNKASQYVSLLIRDSQ PSDSATYLCAVN 5 R4P1D10 alpha constant domain NIQNPDPAVYQLRDSKSSDKSVCLFT DFDSQTNVSQSKDSDVYITDKTVLD MRSMDFKSNSAVAWSNKSDFACAN AFNNSIIPEDTFFPSPESSCDVKLVEK SFETDTNLNFQNLSVIGFRILLLKVA GFNLLMTLRLWSS 6 R4P1D10 alpha full-length MKS
- Peptide Code Sequence SEQ ID NO: AGRN-001 ALLDGRVQL 49 CLASP1-001 RLLDGAFKL 50 COL6A1-001 ILLDGSASV 51 COL6A2-001 FLLDGSERL 52 COL6A3-006 FLFDGSANLV 53 COL6A3-008 FLFDGSANL 54 COL6A3-014 FLLDGSEGV 55 VWA2-001 FLLDGSNSV 56 VWF-001 FLLDGSSRL 57 COL6A3-002 FLLDGSANV 58 A1 ALLDGSANV 59 A2 FALDGSANV 60 A3 FLADGSANV 61 A4 FLLAGSANV 62 AS FLLDASANV 63 A6 FLLDGAANV 64 A7 FLLDGSGNV 65 A8 FLLDGSAAV 66 A9 FLLDGSANA 67 NYESO1-001 SLLMWITQV 68
- allo-reactive settings are used to circumvent self-tolerance and yield T-cells with a higher avidity when compared to T-cells derived from autologous settings, i.e., patients.
- autologous settings i.e., patients.
- examples of such settings include in vitro generation of allo-HLA reactive, peptide-specific T-cells (Sadovnikova et al. 1998; Savage et al. 2004; Wilde et al. 2012), and immunization of mice transgenic for human-MHC or human TCR (Stanislawski et al. 2001; Li et al. 2010), each of which are incorporated by reference in their entireties.
- PBMCs from HLA-A*02-negative healthy donors are used after obtaining informed consent.
- Recombinant biotinylated HLA-A*02 class I monomers and A2 fluorescent tetramers containing COL6A3-002 are obtained from MBLI (Woburn, Mass.).
- PBMCs are incubated with anti-CD20SA diluted in phosphate buffered saline (PBS) for 1 hour at room temperature, washed, and incubated with the biotinylated HLA-A*02/COL6A3-002 monomers for 30 minutes at room temperature, washed, and plated at 3 ⁇ 10 6 cells/well in 24-well plates in RPMI with 10% human AB serum.
- Interleukin 7 IL-7; R&D Systems, Minneapolis, Minn.
- IL-2 Choiron, Harefield, United Kingdom
- PBMCs with HLA-A*02/COL6A3-002 tetramer-phycoerythrin (PE) obtained from MBLI
- PE tetramer-phycoerythrin
- FITC anti-CD8-fluorescein isothiocyanate
- API allophycocyanin
- Sorted tetramer-positive cells were expanded in 24-well plates using, per well, 2 ⁇ 10 5 sorted cells, 2 ⁇ 10 6 irradiated A2-negative PBMCs as feeders, 2 ⁇ 10 4 CD3/CD28 beads/mL (Dynal, Oslo Norway), and IL-2 (1000 U/mL).
- the high avidity T-cells, thus obtained, were then used to identify and isolate TCRs using techniques known in the art, such as single cell 5′ RACE (Rapid Amplification of cDNA Ends).
- Non-redundant TCR DNAs were then analyzed for amino acid/DNA sequences determination and cloning into expression vectors.
- COL6A3-002-specific TCRs (R4P1D10, R4P3F9 and R4P3H3, see Table 2), each encoding tumor specific TCR-alpha and TCR-beta chains, were isolated and amplified from T-cells of healthy donors.
- Cells from healthy donors were in vitro stimulated according to a method previously described (Walter et al., 2003 J Immunol., November 15; 171(10):4974-8).
- COL6A3 peptide presentation was performed as described previously (Hirano N. et al; Blood. 2006 Feb. 15; 107(4):1528-36).
- Target-specific cells were single-cell sorted using HLA-A*02 multimers and then used for subsequent TCR isolation.
- TCR sequences were isolated via 5′ RACE by standard methods as described by e.g. Molecular Cloning a laboratory manual fourth edition by Green and Sambrook.
- the alpha and beta variable regions of TCRs R4P1D10, R4P3F9 and R4P3H3 were sequenced and cloned for further functional characterization.
- R4P1D10 and R4P3H3 are derived from HLA-A*02 positive donors and R4P3F9 is derived from a HLA-A*02 negative donor (allo-reactive setting).
- TCR R4P1D10 alpha and beta chains were cloned as described previously, for example, as described in U.S. Pat. No. 8,519,100, the content of which is hereby incorporated by reference in its entirety for said methods.
- TCR R4P1D10 is restricted towards HLA-A2-presented COL6A3-002 (see table 3 above).
- R4P1D10 alpha chain Start Stop Description Sequence 1 21 L segment MKSLRVLLVILWLQLSWVWSQ (SEQ ID NO: 69) (TRAV12-2) 1 113 V chain MKSLRVLLVILWLQLSWVWSQQKEVEQNSGPL (TRAV12-2) SVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSP ELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIR DSQPSDSATYLCAVN 48 53 CDR1 DRGSQS 71 72 CDR2 IY 110 120 CDR3 CAVNFHDKIIF 116 130 J segment DKIIFGKGTRLHILP (TRAJ30) 131 272 Constant NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTN region VSQSKDSDVYITDKTVLDMRSMDFKSNSAVAW (TRAC) SNKSDFACANAFNNSIIPEDTFFPSPESSCDVKL VEKS
- R4P1D10 beta chain Start Stop Description Sequence 1 19 L segment MGFRLLCCVAFCLLGAGPV (SEQ ID NO: 70) (TRBV9) 1 114 V chain MGFRLLCCVAFCLLGAGPVDSGVTQTPKHLIT (TRBV9) ATGQRVTLRCSPRSGDLSVYWYQQSLDQGLQ FLIHYYNGEERAKGNILERFSAQQFPDLHSEL NLSSLELGDSALYFCASSV 46 50 CDR1 SGDLS 68 73 CDR2 YYNGEE 110 122 CDR3 CASSVASAYGYTF 118 131 J chain YGYTFGSGTRLTVV (TRBJ1-2) 132 308 constant EDLNKVFPPEVAVFEPSEAEISHTQKATLVCL region ATGFFPDHVELSWWVNGKEVHSGVSTDPQPL (TRBC1) KEQPALNDSRYCLSSRLRVSATFWQNPRNHF RCQVQFYGLSENDEWTQDRAK
- R4P1D10 specifically recognizes COL6A3-002 as human primary CD8+ T-cells re-expressing this TCR release IFN ⁇ upon co-incubation with HLA-A*02+ target cells and bind HLA-A*02 tetramers, respectively, loaded either with COL6A3-002 peptide or alanine and glycine substitution variants of COL6A3-002 ( FIG. 1 ) or different peptides showing high degree of sequence similarity to COL6A3-002 ( FIG. 2 ). NYESO1-001 peptide is used as negative control.
- Re-expression of R4P1D10 leads to selective binding of HLA-A*02/COL6A3-002 tetramers but not HLA-A*02/NYESO1-001 tetramers in J.RT3-T3.5 Jurkat cells ( FIG. 3 ), SUP-T1 cells ( FIG. 4 ) and human primary CD8+ T-cells ( FIG. 5 ). For each cell type, re-expression of the NYESO1-001-specific TCR 1G4 and mock expression are used as control.
- TCR R4P3F9 alpha and beta chains were cloned as described before, for example, as described in U.S. Pat. No. 8,519,100, which is hereby incorporated by reference in its entirety for said methods.
- TCR R4P3F9 is restricted towards HLA-A2-presented COL6A3-002 (see table 3 above).
- Re-expression of R4P3F9 leads to selective binding of HLA-A*02/COL6A3-002 tetramers but not HLA-A*02/NYESO1-001 tetramers in J.RT3-T3.5 Jurkat cells ( FIG. 8 ) and SUP-T1 cells ( FIG. 9 ). For each cell type, re-expression of the NYESO1-001-specific TCR 1G4 and mock expression are used as control.
- TCR R4P3H3 alpha and beta chains were cloned as described before, for example, as described in U.S. Pat. No. 8,519,100, which is hereby incorporated by reference in its entirety.
- TCR R4P3H3 is restricted towards HLA-A2-presented COL6A3-002 (see table 3 above).
- R4P3H3 specifically recognizes COL6A3-002 as human primary CD8+ T-cells re-expressing this TCR release IFN ⁇ upon co-incubation with HLA-A*02+ target cells, respectively, loaded either with COL6A3-002 peptide or alanine and glycine substitution variants of COL6A3-002 ( FIG. 10 ) or different peptides showing high degree of sequence similarity to COL6A3-002 ( FIG. 11 ). NYESO1-001 peptide is used as negative control.
- Re-expression of R4P3H3 leads to selective binding of HLA-A*02/COL6A3-002 tetramers but not HLA-A*02/NYESO1-001 tetramers in SUP-T1 cells ( FIG. 12 ). Re-expression of the NYESO1-001-specific TCR 1G4 and mock expression are used as control.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Epidemiology (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Steroid Compounds (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/677,651 US10550182B2 (en) | 2016-08-17 | 2017-08-15 | T cell receptors and immune therapy using the same |
| US16/035,300 US10526407B2 (en) | 2016-08-17 | 2018-07-13 | T cell receptors and immune therapy using the same |
| US16/402,829 US10800845B2 (en) | 2016-08-17 | 2019-05-03 | T cell receptors and immune therapy using the same |
| US17/000,143 US11939376B2 (en) | 2016-08-17 | 2020-08-21 | T cell receptors and immune therapy using the same |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662376059P | 2016-08-17 | 2016-08-17 | |
| DE102016115246.3A DE102016115246C5 (de) | 2016-08-17 | 2016-08-17 | Neue t-zellrezeptoren und deren verwendung in immuntherapie |
| DE102016115246.3 | 2016-08-17 | ||
| DE102016115246 | 2016-08-17 | ||
| US201662376632P | 2016-08-18 | 2016-08-18 | |
| US15/677,651 US10550182B2 (en) | 2016-08-17 | 2017-08-15 | T cell receptors and immune therapy using the same |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/035,300 Continuation US10526407B2 (en) | 2016-08-17 | 2018-07-13 | T cell receptors and immune therapy using the same |
| US16/402,829 Continuation US10800845B2 (en) | 2016-08-17 | 2019-05-03 | T cell receptors and immune therapy using the same |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| US20180051080A1 US20180051080A1 (en) | 2018-02-22 |
| US10550182B2 true US10550182B2 (en) | 2020-02-04 |
Family
ID=60419980
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/677,651 Expired - Fee Related US10550182B2 (en) | 2016-08-17 | 2017-08-15 | T cell receptors and immune therapy using the same |
| US16/035,300 Active US10526407B2 (en) | 2016-08-17 | 2018-07-13 | T cell receptors and immune therapy using the same |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/035,300 Active US10526407B2 (en) | 2016-08-17 | 2018-07-13 | T cell receptors and immune therapy using the same |
Country Status (18)
| Country | Link |
|---|---|
| US (2) | US10550182B2 (OSRAM) |
| EP (1) | EP3500593B1 (OSRAM) |
| JP (2) | JP6964351B2 (OSRAM) |
| CN (1) | CN109563149A (OSRAM) |
| AU (2) | AU2017312361B2 (OSRAM) |
| BR (1) | BR112019001922A2 (OSRAM) |
| CA (1) | CA3031995A1 (OSRAM) |
| CR (1) | CR20190095A (OSRAM) |
| DE (1) | DE102016115246C5 (OSRAM) |
| DK (1) | DK3500593T3 (OSRAM) |
| LT (1) | LT3500593T (OSRAM) |
| MA (1) | MA45976B1 (OSRAM) |
| MX (1) | MX395287B (OSRAM) |
| PE (1) | PE20190477A1 (OSRAM) |
| RS (1) | RS62498B1 (OSRAM) |
| SG (1) | SG11201900955VA (OSRAM) |
| TW (1) | TWI775768B (OSRAM) |
| WO (1) | WO2018033291A1 (OSRAM) |
Cited By (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020243134A1 (en) | 2019-05-27 | 2020-12-03 | Immatics US, Inc. | Viral vectors and their use in adoptive cellular therapy |
| US20200385468A1 (en) * | 2016-08-17 | 2020-12-10 | Immatic Biotechnologies GmbH | Novel t cell receptors and immune therapy using the same |
| US11034748B2 (en) * | 2017-03-15 | 2021-06-15 | Fred Hutchinson Cancer Research Center | High affinity MAGE-A1-specific TCRs and uses thereof |
| WO2021173560A1 (en) | 2020-02-24 | 2021-09-02 | Immatics US, Inc. | Methods for expanding t cells for the treatment of cancer and related malignancies |
| WO2022040631A1 (en) | 2020-08-21 | 2022-02-24 | Immatics US, Inc. | Methods for isolating cd8+ selected t cells |
| DE102021100038A1 (de) | 2020-12-31 | 2022-06-30 | Immatics US, Inc. | Modifizierte cd8-polypeptide, zusammensetzungen und verfahren zu deren verwendung |
| WO2022147029A2 (en) | 2020-12-31 | 2022-07-07 | Immatics US, Inc. | Cd8 polypeptides, compositions, and methods of using thereof |
| WO2023044488A1 (en) | 2021-09-20 | 2023-03-23 | Immatics US, Inc. | Monocyte depletion of t cells populations for t-cell therapy |
| WO2023081461A1 (en) | 2021-11-08 | 2023-05-11 | Immatics US, Inc. | Methods for generating cell spheroids |
| WO2023212691A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | DOMINANT NEGATIVE TGFβ RECEPTOR POLYPEPTIDES, CD8 POLYPEPTIDES, CELLS, COMPOSITIONS, AND METHODS OF USING THEREOF |
| WO2023212655A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | Il-12 polypeptides, il-15 polypeptides, il-18 polypeptides, cd8 polypeptides, compositions, and methods of using thereof |
| WO2023212697A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | Membrane-bound il-15, cd8 polypeptides, cells, compositions, and methods of using thereof |
| WO2023215825A1 (en) | 2022-05-05 | 2023-11-09 | Immatics US, Inc. | Methods for improving t cell efficacy |
| WO2025096649A1 (en) | 2023-11-01 | 2025-05-08 | Immatics US, Inc. | Membrane-bound il-15, cd8 polypeptides, cells, compositions, and methods of using thereof |
Families Citing this family (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB201423361D0 (en) * | 2014-12-30 | 2015-02-11 | Immatics Biotechnologies Gmbh | Method for the absolute Quantification of naturally processed HLA-Restricted cancer peptides |
| CA3070468A1 (en) | 2017-09-01 | 2019-03-07 | Dana-Farber Cancer Institute, Inc. | Immunogenic peptides specific to bcma and taci antigens for treatment of cancer |
| MX2020004741A (es) | 2017-11-06 | 2020-09-18 | Immatics Biotechnologies Gmbh | Nuevos receptores de las celulas t modificados geneticamente y terapias immunologicas que emplean los mismos. |
| DE102017125888A1 (de) | 2017-11-06 | 2019-05-23 | Immatics Biotechnologies Gmbh | Neue konstruierte T-Zell-Rezeptoren und deren Verwendung in Immuntherapie |
| MX2020008327A (es) | 2018-02-09 | 2020-10-28 | Immatics Us Inc | Metodos para preparar celulas t. |
| DE102018108612A1 (de) | 2018-03-21 | 2019-09-26 | Immatics US, Inc. | Verfahren zur erhöhung der persistenz von adoptiv infundierten t-zellen |
| BR112020025589A2 (pt) | 2018-06-19 | 2021-03-23 | Dsm Ip Assets B.V. | variantes de enzima lipolítica |
| CN113412277B (zh) * | 2019-01-22 | 2025-07-18 | 美国卫生和人力服务部 | 针对含有g12r突变的ras的hla第ii类限制性t细胞受体 |
| AU2020231218B2 (en) | 2019-03-06 | 2025-09-11 | Dana-Farber Cancer Institute, Inc. | T cell receptors specific to B-cell maturation antigen for treatment of cancer |
| DE102019108125B4 (de) | 2019-03-28 | 2022-02-03 | Immatics US, Inc. | Cd28 t-zellkulturen, zusammensetzungen und verfahren zu deren verwendung |
| WO2020191172A1 (en) | 2019-03-19 | 2020-09-24 | Immatics US, Inc. | Cd28 t cell cultures, compositions, and methods of using thereof |
| AU2020286756A1 (en) | 2019-06-06 | 2022-01-27 | Immatics Biotechnologies Gmbh | Sorting with counter selection using sequence similar peptides |
| US20210032370A1 (en) | 2019-08-02 | 2021-02-04 | Immatics Biotechnologies Gmbh | Recruiting agent further binding an mhc molecule |
| DE102020106710A1 (de) | 2020-03-11 | 2021-09-16 | Immatics US, Inc. | Wpre-mutantenkonstrukte, zusammensetzungen und zugehörige verfahren |
| DE102020111571A1 (de) | 2020-03-11 | 2021-09-16 | Immatics US, Inc. | Wpre-mutantenkonstrukte, zusammensetzungen und zugehörige verfahren |
| WO2021252517A1 (en) * | 2020-06-09 | 2021-12-16 | Board Of Regents, The University Of Texas System | Engineered t cell receptors and methods of use |
| JP2024516699A (ja) | 2021-05-05 | 2024-04-16 | イマティクス バイオテクノロジーズ ゲーエムベーハー | Bma031抗原結合ポリペプチド |
| US20240358831A1 (en) | 2021-08-24 | 2024-10-31 | Immatics US, Inc. | Selection of immune cells using peptide mhc complexes generated by conditional ligand exchange |
| US20230192886A1 (en) | 2021-11-08 | 2023-06-22 | Immatics Biotechnologies Gmbh | Adoptive cell therapy combination treatment and compositions thereof |
| CN117946245B (zh) * | 2023-02-23 | 2024-08-02 | 暨南大学 | 一种识别mage-a3抗原短肽的t细胞受体及其应用 |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080219956A1 (en) * | 2007-03-09 | 2008-09-11 | University Of Washington | Hla homozygous cells and methods of use thereof |
| WO2011113819A2 (en) | 2010-03-19 | 2011-09-22 | Immatics Biotechnologies Gmbh | Novel immunotherapy against several tumors including gastrointestinal and gastric cancer |
| US9228007B1 (en) | 2010-03-11 | 2016-01-05 | The Regents Of The University Of California | Recombinant human progenitor cells, engineered human thymocytes, and engineered human T cells |
| WO2016011210A2 (en) | 2014-07-15 | 2016-01-21 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
| US20160152681A1 (en) * | 2013-07-15 | 2016-06-02 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv | Anti-human papillomavirus 16 e6 t cell receptors |
| US20160159880A1 (en) * | 2014-11-05 | 2016-06-09 | Genentech, Inc. | Methods of producing two chain proteins in bacteria |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2089661C (en) | 1990-08-29 | 2007-04-03 | Nils Lonberg | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US20020197266A1 (en) | 2000-02-08 | 2002-12-26 | Waldemar Debinski | Immunotherapy using interleukin 13 receptor subunit alpha 2 |
| WO2006023382A2 (en) * | 2004-08-23 | 2006-03-02 | Albert Einstein College Of Medicine Of Yeshiva University | Collagen vi and cancer |
| EP1762575A1 (en) * | 2005-09-12 | 2007-03-14 | Ganymed Pharmaceuticals AG | Identification of tumor-associated antigens for diagnosis and therapy |
| GB0911566D0 (en) | 2009-07-03 | 2009-08-12 | Immunocore Ltd | T cell receptors |
-
2016
- 2016-08-17 DE DE102016115246.3A patent/DE102016115246C5/de not_active Expired - Fee Related
-
2017
- 2017-07-04 WO PCT/EP2017/066630 patent/WO2018033291A1/en not_active Ceased
- 2017-07-04 RS RS20211327A patent/RS62498B1/sr unknown
- 2017-07-04 BR BR112019001922A patent/BR112019001922A2/pt not_active IP Right Cessation
- 2017-07-04 SG SG11201900955VA patent/SG11201900955VA/en unknown
- 2017-07-04 CN CN201780049787.2A patent/CN109563149A/zh active Pending
- 2017-07-04 CR CR20190095A patent/CR20190095A/es unknown
- 2017-07-04 MX MX2019001769A patent/MX395287B/es unknown
- 2017-07-04 CA CA3031995A patent/CA3031995A1/en active Pending
- 2017-07-04 PE PE2019000285A patent/PE20190477A1/es unknown
- 2017-07-04 JP JP2019508259A patent/JP6964351B2/ja active Active
- 2017-07-04 DK DK17739220.6T patent/DK3500593T3/da active
- 2017-07-04 AU AU2017312361A patent/AU2017312361B2/en not_active Ceased
- 2017-07-04 EP EP17739220.6A patent/EP3500593B1/en active Active
- 2017-07-04 LT LTEPPCT/EP2017/066630T patent/LT3500593T/lt unknown
- 2017-07-04 MA MA45976A patent/MA45976B1/fr unknown
- 2017-08-11 TW TW106127257A patent/TWI775768B/zh not_active IP Right Cessation
- 2017-08-15 US US15/677,651 patent/US10550182B2/en not_active Expired - Fee Related
-
2018
- 2018-07-13 US US16/035,300 patent/US10526407B2/en active Active
-
2021
- 2021-03-10 AU AU2021201518A patent/AU2021201518A1/en not_active Abandoned
- 2021-08-04 JP JP2021128303A patent/JP2021184729A/ja active Pending
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20080219956A1 (en) * | 2007-03-09 | 2008-09-11 | University Of Washington | Hla homozygous cells and methods of use thereof |
| US9228007B1 (en) | 2010-03-11 | 2016-01-05 | The Regents Of The University Of California | Recombinant human progenitor cells, engineered human thymocytes, and engineered human T cells |
| WO2011113819A2 (en) | 2010-03-19 | 2011-09-22 | Immatics Biotechnologies Gmbh | Novel immunotherapy against several tumors including gastrointestinal and gastric cancer |
| US20160152681A1 (en) * | 2013-07-15 | 2016-06-02 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Serv | Anti-human papillomavirus 16 e6 t cell receptors |
| WO2016011210A2 (en) | 2014-07-15 | 2016-01-21 | Juno Therapeutics, Inc. | Engineered cells for adoptive cell therapy |
| US20160159880A1 (en) * | 2014-11-05 | 2016-06-09 | Genentech, Inc. | Methods of producing two chain proteins in bacteria |
Non-Patent Citations (25)
| Title |
|---|
| Brodnicki et al., Molecular Immunology, vol. 33, No. 3, pp. 253-263, 1996 (Year: 1996). * |
| Communication issued pursuant to Rules 161(1) and 162 EPC in related European Patent Application No. 17739220.6. dated Mar. 26, 2019. |
| DATABASE EMBL [online] "Homo sapiens (human) partial T cell receptor alpha chain V-J-region", XP002774327, retrieved from EBI |
| DATABASE EMBL [online] "Homo sapiens (human) partial T cell receptor alpha chain V-J-region", XP002774329, retrieved from EBI |
| DATABASE EMBL [online] "Homo sapiens (human) partial T cell receptor beta chain V-D-J-region", XP002774328, retrieved from EBI |
| DATABASE EMBL [online] "Homo sapiens (human) partial T cell receptor beta chain V-D-J-region", XP002774330, retrieved from EBI |
| DATABASE EMBL [online] "Homo sapiens (human) partial T-cell receptor beta", XP002774332, retrieved from EBI |
| DATABASE EMBL [online] 20 September 2002 (2002-09-20), "Homo sapiens clone SCO1 T-cell receptor alpha mRNA, partial cds.", XP002774331, retrieved from EBI |
| Database EMBL [Online]. Jul. 30, 2015 (Jul. 30, 2015) "Homo sapiens (human) partial T cell receptor alpha chain V-J-region", XP002774327, retrieved from EBI accession No. EMBL:BAS03272 Database accession No. BAS03272. |
| Database EMBL [Online]. Jul. 30, 2015 (Jul. 30, 2015) "Homo sapiens (human) partial T cell receptor alpha chain V-J-region", XP002774329, retrieved from EBI accession No. EMBL:BAS03375 Database accession No. BAS03375. |
| Database EMBL [Online]. Jul. 30, 2015 (Jul. 30, 2015) "Homo sapiens (human) partial T cell receptor beta chain V-D-J-region", XP002774328, retrieved from EBI accession No. EMBL:BAS04242 Database accession No. BAS04242. |
| Database EMBL [Online]. Jul. 30, 2015 (Jul. 30, 2015) "Homo sapiens (human) partial T cell receptor beta chain V-D-J-region", XP002774330, retrieved from EBI accession No. EMBL:BAS04067 Database accession No. BAS04067. |
| Database EMBL [Online]. Mar. 4, 2000 (Mar. 4, 2000) "Homo sapiens (human) partial T cell receptor beta", XP002774332, retrieved from EBI accession No. EMBL:AAD15181 Database accession No. AAD15181. |
| Database EMBL [Online]. Sep. 20, 2002 (Sep. 20, 2002) "Homo sapiens clone SC01 T cell receptor alpha mRNA partial cds", XP002774331, retrieved from EBI accession No. EMBL:AF532840 Database accession No. AF532840. |
| Faden et al., Hastings Cent Rep. Nov.-Dec. 2003;33(6):13-27 (Year: 2003). * |
| Garcia et al., Cell, vol. 122, 333-336, Aug. 12, 2005. (Year: 2005). * |
| Goyarts et al. (Mol Immunol. Jul. 1998;35(10):593-607). (Year: 1998). * |
| International Search Report for PCT/EP2017/066630, dated Oct. 20, 2017. |
| Janeway et al., Immunobiology, 5th Ed., Garland Science, pp. 106-108 and 260-263, (2001). (Year: 2001). * |
| Piepenbrink, Kurt H. et al. (2013). "The basis for limited specificity and MHC restriction in a T cell receptor interface." Nature. 2013; 4:1948. doi:10.1038/ncomms2948. |
| Portolano et al., J Immunol. Feb. 1, 1993;150(3):880-7. (Year: 1993). * |
| Qiao, J. "Stroma derived COL6A3 is a potential prognosis marker of colorectal carcinoma revealed by quantitative proteomics", Oncotarget (2015) 6 (30) 29929-46. |
| Robert W. Bahr, Deputy Commissioner for Patent Examination Policy Memorandum of Feb. 22, 2018, 2 pages. (Year: 2018). * |
| Robins et al., Blood. 2009;114:4099-4107 (Year: 2009). * |
| Woodsworth et al., Genome Medicine 2013, 5:98 (Year: 2013). * |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200385468A1 (en) * | 2016-08-17 | 2020-12-10 | Immatic Biotechnologies GmbH | Novel t cell receptors and immune therapy using the same |
| US11939376B2 (en) * | 2016-08-17 | 2024-03-26 | immatics biotechnology GmbH | T cell receptors and immune therapy using the same |
| US11034748B2 (en) * | 2017-03-15 | 2021-06-15 | Fred Hutchinson Cancer Research Center | High affinity MAGE-A1-specific TCRs and uses thereof |
| WO2020243134A1 (en) | 2019-05-27 | 2020-12-03 | Immatics US, Inc. | Viral vectors and their use in adoptive cellular therapy |
| WO2021173560A1 (en) | 2020-02-24 | 2021-09-02 | Immatics US, Inc. | Methods for expanding t cells for the treatment of cancer and related malignancies |
| WO2022040631A1 (en) | 2020-08-21 | 2022-02-24 | Immatics US, Inc. | Methods for isolating cd8+ selected t cells |
| WO2022147029A2 (en) | 2020-12-31 | 2022-07-07 | Immatics US, Inc. | Cd8 polypeptides, compositions, and methods of using thereof |
| DE102021100038A1 (de) | 2020-12-31 | 2022-06-30 | Immatics US, Inc. | Modifizierte cd8-polypeptide, zusammensetzungen und verfahren zu deren verwendung |
| WO2023044488A1 (en) | 2021-09-20 | 2023-03-23 | Immatics US, Inc. | Monocyte depletion of t cells populations for t-cell therapy |
| WO2023081461A1 (en) | 2021-11-08 | 2023-05-11 | Immatics US, Inc. | Methods for generating cell spheroids |
| WO2023212691A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | DOMINANT NEGATIVE TGFβ RECEPTOR POLYPEPTIDES, CD8 POLYPEPTIDES, CELLS, COMPOSITIONS, AND METHODS OF USING THEREOF |
| WO2023212655A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | Il-12 polypeptides, il-15 polypeptides, il-18 polypeptides, cd8 polypeptides, compositions, and methods of using thereof |
| WO2023212697A1 (en) | 2022-04-28 | 2023-11-02 | Immatics US, Inc. | Membrane-bound il-15, cd8 polypeptides, cells, compositions, and methods of using thereof |
| WO2023215825A1 (en) | 2022-05-05 | 2023-11-09 | Immatics US, Inc. | Methods for improving t cell efficacy |
| WO2025096649A1 (en) | 2023-11-01 | 2025-05-08 | Immatics US, Inc. | Membrane-bound il-15, cd8 polypeptides, cells, compositions, and methods of using thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| JP6964351B2 (ja) | 2021-11-10 |
| TW201806973A (zh) | 2018-03-01 |
| AU2017312361A1 (en) | 2019-02-28 |
| MA45976B1 (fr) | 2021-09-30 |
| SG11201900955VA (en) | 2019-03-28 |
| CN109563149A (zh) | 2019-04-02 |
| JP2021184729A (ja) | 2021-12-09 |
| US20180051080A1 (en) | 2018-02-22 |
| US20180319884A1 (en) | 2018-11-08 |
| TWI775768B (zh) | 2022-09-01 |
| EP3500593A1 (en) | 2019-06-26 |
| AU2017312361B2 (en) | 2020-12-10 |
| MX2019001769A (es) | 2019-07-08 |
| DE102016115246C5 (de) | 2018-12-20 |
| PE20190477A1 (es) | 2019-04-04 |
| US10526407B2 (en) | 2020-01-07 |
| RS62498B1 (sr) | 2021-11-30 |
| LT3500593T (lt) | 2021-11-25 |
| CA3031995A1 (en) | 2018-02-22 |
| MA45976A (fr) | 2021-05-19 |
| CR20190095A (es) | 2019-06-13 |
| MX395287B (es) | 2025-03-25 |
| JP2019528061A (ja) | 2019-10-10 |
| EP3500593B1 (en) | 2021-08-25 |
| BR112019001922A2 (pt) | 2019-07-09 |
| WO2018033291A1 (en) | 2018-02-22 |
| DK3500593T3 (da) | 2021-11-01 |
| AU2021201518A1 (en) | 2021-04-01 |
| DE102016115246B3 (de) | 2017-12-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10526407B2 (en) | T cell receptors and immune therapy using the same | |
| US11939376B2 (en) | T cell receptors and immune therapy using the same | |
| US20250154246A1 (en) | Novel t cell receptors and immune therapy using the same | |
| US20240228611A1 (en) | Novel engineered t cell receptors and immune therapy using the same | |
| US10725044B2 (en) | T cell receptors and immune therapy using the same | |
| US20190256572A1 (en) | T cell receptors and immune therapy using the same against prame positive cancers | |
| HK40071461A (en) | T cell receptors and immune therapy using the same | |
| TWI790162B (zh) | 新穎t細胞受器及使用其之免疫治療 | |
| HK40010473B (en) | T cell receptors and immune therapy using the same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: IMMATICS BIOTECHNOLOGIES GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ALTEN, LEONIE;MAURER, DOMINIK;WALTER, STEFFEN;AND OTHERS;SIGNING DATES FROM 20160830 TO 20160920;REEL/FRAME:043572/0045 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: FINAL REJECTION MAILED |
|
| AS | Assignment |
Owner name: IMMATICS BIOTECHNOLOGIES GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:ALTEN, LEONIE;MAURER, DOMINIK;WALTER, STEFFEN;AND OTHERS;SIGNING DATES FROM 20180716 TO 20180727;REEL/FRAME:047924/0244 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NOTICE OF ALLOWANCE MAILED -- APPLICATION RECEIVED IN OFFICE OF PUBLICATIONS |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT RECEIVED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: PUBLICATIONS -- ISSUE FEE PAYMENT VERIFIED |
|
| STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
| FEPP | Fee payment procedure |
Free format text: MAINTENANCE FEE REMINDER MAILED (ORIGINAL EVENT CODE: REM.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| LAPS | Lapse for failure to pay maintenance fees |
Free format text: PATENT EXPIRED FOR FAILURE TO PAY MAINTENANCE FEES (ORIGINAL EVENT CODE: EXP.); ENTITY STATUS OF PATENT OWNER: SMALL ENTITY |
|
| STCH | Information on status: patent discontinuation |
Free format text: PATENT EXPIRED DUE TO NONPAYMENT OF MAINTENANCE FEES UNDER 37 CFR 1.362 |
|
| FP | Lapsed due to failure to pay maintenance fee |
Effective date: 20240204 |