KR20220142975A - 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 - Google Patents
조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 Download PDFInfo
- Publication number
- KR20220142975A KR20220142975A KR1020220127074A KR20220127074A KR20220142975A KR 20220142975 A KR20220142975 A KR 20220142975A KR 1020220127074 A KR1020220127074 A KR 1020220127074A KR 20220127074 A KR20220127074 A KR 20220127074A KR 20220142975 A KR20220142975 A KR 20220142975A
- Authority
- KR
- South Korea
- Prior art keywords
- cancer
- antibody
- amino acid
- epitope
- present
- Prior art date
Links
- 230000027455 binding Effects 0.000 title claims abstract description 59
- 210000003289 regulatory T cell Anatomy 0.000 title abstract description 53
- 101710160107 Outer membrane protein A Proteins 0.000 title 1
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 85
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 80
- 210000004027 cell Anatomy 0.000 claims abstract description 68
- 239000000427 antigen Substances 0.000 claims abstract description 53
- 108091007433 antigens Proteins 0.000 claims abstract description 49
- 102000036639 antigens Human genes 0.000 claims abstract description 49
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 41
- 239000012634 fragment Substances 0.000 claims abstract description 41
- 201000011510 cancer Diseases 0.000 claims abstract description 34
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 claims abstract description 13
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 claims abstract description 11
- 235000018102 proteins Nutrition 0.000 claims description 79
- 150000001413 amino acids Chemical group 0.000 claims description 32
- 235000001014 amino acid Nutrition 0.000 claims description 31
- 229940024606 amino acid Drugs 0.000 claims description 30
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 30
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 26
- 229920001184 polypeptide Polymers 0.000 claims description 21
- 239000000611 antibody drug conjugate Substances 0.000 claims description 20
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 20
- 239000008194 pharmaceutical composition Substances 0.000 claims description 19
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 claims description 17
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 claims description 17
- 235000009582 asparagine Nutrition 0.000 claims description 17
- 229960001230 asparagine Drugs 0.000 claims description 17
- 239000004475 Arginine Substances 0.000 claims description 16
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 16
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 claims description 15
- -1 aromatic amino acid Chemical class 0.000 claims description 15
- 229940079593 drug Drugs 0.000 claims description 14
- 239000003814 drug Substances 0.000 claims description 14
- 239000013604 expression vector Substances 0.000 claims description 13
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 claims description 12
- 238000000034 method Methods 0.000 claims description 12
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 claims description 12
- 239000004472 Lysine Substances 0.000 claims description 11
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 11
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 11
- 235000005772 leucine Nutrition 0.000 claims description 11
- 150000007523 nucleic acids Chemical class 0.000 claims description 11
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 10
- 108020004707 nucleic acids Proteins 0.000 claims description 10
- 102000039446 nucleic acids Human genes 0.000 claims description 10
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims description 10
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 claims description 9
- 235000003704 aspartic acid Nutrition 0.000 claims description 9
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 claims description 9
- 201000001441 melanoma Diseases 0.000 claims description 9
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 claims description 8
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 claims description 8
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 claims description 8
- 239000004473 Threonine Substances 0.000 claims description 8
- 210000004901 leucine-rich repeat Anatomy 0.000 claims description 8
- 239000004471 Glycine Substances 0.000 claims description 7
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 claims description 7
- 206010005003 Bladder cancer Diseases 0.000 claims description 6
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 6
- 206010009944 Colon cancer Diseases 0.000 claims description 6
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 claims description 6
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 claims description 6
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 6
- 206010033128 Ovarian cancer Diseases 0.000 claims description 6
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 6
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 6
- 206010060862 Prostate cancer Diseases 0.000 claims description 6
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 6
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 6
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 claims description 6
- 235000004279 alanine Nutrition 0.000 claims description 6
- 206010017758 gastric cancer Diseases 0.000 claims description 6
- 208000005017 glioblastoma Diseases 0.000 claims description 6
- 201000010536 head and neck cancer Diseases 0.000 claims description 6
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 6
- 201000007270 liver cancer Diseases 0.000 claims description 6
- 208000014018 liver neoplasm Diseases 0.000 claims description 6
- 201000005202 lung cancer Diseases 0.000 claims description 6
- 208000020816 lung neoplasm Diseases 0.000 claims description 6
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 6
- 208000037819 metastatic cancer Diseases 0.000 claims description 6
- 208000011575 metastatic malignant neoplasm Diseases 0.000 claims description 6
- 201000002528 pancreatic cancer Diseases 0.000 claims description 6
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 6
- 208000015347 renal cell adenocarcinoma Diseases 0.000 claims description 6
- 201000011549 stomach cancer Diseases 0.000 claims description 6
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 6
- 239000004474 valine Substances 0.000 claims description 6
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims description 5
- 235000013922 glutamic acid Nutrition 0.000 claims description 5
- 239000004220 glutamic acid Substances 0.000 claims description 5
- 230000002378 acidificating effect Effects 0.000 claims description 4
- 239000004480 active ingredient Substances 0.000 claims description 4
- 230000007935 neutral effect Effects 0.000 claims description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 3
- 239000007787 solid Substances 0.000 abstract description 15
- 230000000694 effects Effects 0.000 abstract description 9
- 108050006430 Immunoglobulin-like domains Proteins 0.000 abstract description 7
- 102000016844 Immunoglobulin-like domains Human genes 0.000 abstract description 7
- 210000003162 effector t lymphocyte Anatomy 0.000 abstract description 4
- 230000005907 cancer growth Effects 0.000 abstract 1
- 238000002360 preparation method Methods 0.000 description 24
- 230000014509 gene expression Effects 0.000 description 21
- 239000013598 vector Substances 0.000 description 20
- 125000003275 alpha amino acid group Chemical group 0.000 description 19
- 210000001744 T-lymphocyte Anatomy 0.000 description 16
- 241000699666 Mus <mouse, genus> Species 0.000 description 10
- 108020004999 messenger RNA Proteins 0.000 description 10
- 239000000872 buffer Substances 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 230000006870 function Effects 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- 201000010099 disease Diseases 0.000 description 8
- 238000002493 microarray Methods 0.000 description 8
- 210000000056 organ Anatomy 0.000 description 8
- 238000011282 treatment Methods 0.000 description 8
- 210000002602 induced regulatory T cell Anatomy 0.000 description 7
- 108020004414 DNA Proteins 0.000 description 6
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 6
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 6
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 6
- 241000699670 Mus sp. Species 0.000 description 6
- 230000000890 antigenic effect Effects 0.000 description 6
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 239000007924 injection Substances 0.000 description 6
- 238000002347 injection Methods 0.000 description 6
- 230000001105 regulatory effect Effects 0.000 description 6
- 241000282412 Homo Species 0.000 description 5
- 101000619640 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 1 Proteins 0.000 description 5
- 102100022170 Leucine-rich repeats and immunoglobulin-like domains protein 1 Human genes 0.000 description 5
- 241000700159 Rattus Species 0.000 description 5
- 239000002775 capsule Substances 0.000 description 5
- 230000010261 cell growth Effects 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 230000002159 abnormal effect Effects 0.000 description 4
- LEQAOMBKQFMDFZ-UHFFFAOYSA-N glyoxal Chemical compound O=CC=O LEQAOMBKQFMDFZ-UHFFFAOYSA-N 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- 241000196324 Embryophyta Species 0.000 description 3
- 108091092584 GDNA Proteins 0.000 description 3
- 241000124008 Mammalia Species 0.000 description 3
- 101150099493 STAT3 gene Proteins 0.000 description 3
- 238000003556 assay Methods 0.000 description 3
- 230000001580 bacterial effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 230000028993 immune response Effects 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 239000000314 lubricant Substances 0.000 description 3
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 108020003175 receptors Proteins 0.000 description 3
- 102000005962 receptors Human genes 0.000 description 3
- 230000006798 recombination Effects 0.000 description 3
- 238000005215 recombination Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 210000000952 spleen Anatomy 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 239000003826 tablet Substances 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 2
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 210000000068 Th17 cell Anatomy 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 229960004117 capecitabine Drugs 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 239000003205 fragrance Substances 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 229960002584 gefitinib Drugs 0.000 description 2
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 2
- 229940015043 glyoxal Drugs 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 238000007913 intrathecal administration Methods 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 210000002501 natural regulatory T cell Anatomy 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 238000003753 real-time PCR Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 239000000829 suppository Substances 0.000 description 2
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000011534 wash buffer Substances 0.000 description 2
- GMVPRGQOIOIIMI-UHFFFAOYSA-N (8R,11R,12R,13E,15S)-11,15-Dihydroxy-9-oxo-13-prostenoic acid Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CCCCCCC(O)=O GMVPRGQOIOIIMI-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- JECYNCQXXKQDJN-UHFFFAOYSA-N 2-(2-methylhexan-2-yloxymethyl)oxirane Chemical compound CCCCC(C)(C)OCC1CO1 JECYNCQXXKQDJN-UHFFFAOYSA-N 0.000 description 1
- PVFFUHAAOKXVTK-UHFFFAOYSA-N 2-(methylamino)-4-oxopentanoic acid Chemical compound CNC(C(O)=O)CC(C)=O PVFFUHAAOKXVTK-UHFFFAOYSA-N 0.000 description 1
- XXJWYDDUDKYVKI-UHFFFAOYSA-N 4-[(4-fluoro-2-methyl-1H-indol-5-yl)oxy]-6-methoxy-7-[3-(1-pyrrolidinyl)propoxy]quinazoline Chemical compound COC1=CC2=C(OC=3C(=C4C=C(C)NC4=CC=3)F)N=CN=C2C=C1OCCCN1CCCC1 XXJWYDDUDKYVKI-UHFFFAOYSA-N 0.000 description 1
- XAUDJQYHKZQPEU-KVQBGUIXSA-N 5-aza-2'-deoxycytidine Chemical compound O=C1N=C(N)N=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XAUDJQYHKZQPEU-KVQBGUIXSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 102100030374 Actin, cytoplasmic 2 Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 101001073212 Arabidopsis thaliana Peroxidase 33 Proteins 0.000 description 1
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 1
- 102000015790 Asparaginase Human genes 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 101100098985 Caenorhabditis elegans cct-3 gene Proteins 0.000 description 1
- 101100275473 Caenorhabditis elegans ctc-3 gene Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- PTHCMJGKKRQCBF-UHFFFAOYSA-N Cellulose, microcrystalline Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC)C(CO)O1 PTHCMJGKKRQCBF-UHFFFAOYSA-N 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000773237 Homo sapiens Actin, cytoplasmic 2 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101100455496 Homo sapiens LRIG1 gene Proteins 0.000 description 1
- 101001038321 Homo sapiens Leucine-rich repeat protein 1 Proteins 0.000 description 1
- 101000619642 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 2 Proteins 0.000 description 1
- 101001017855 Homo sapiens Leucine-rich repeats and immunoglobulin-like domains protein 3 Proteins 0.000 description 1
- 101001123325 Homo sapiens Peroxisome proliferator-activated receptor gamma coactivator 1-beta Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 102000018251 Hypoxanthine Phosphoribosyltransferase Human genes 0.000 description 1
- 108010091358 Hypoxanthine Phosphoribosyltransferase Proteins 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100022341 Integrin alpha-E Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 241000235058 Komagataella pastoris Species 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- 239000002145 L01XE14 - Bosutinib Substances 0.000 description 1
- 101150032178 LRIG1 gene Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 102100040249 Leucine-rich repeat protein 1 Human genes 0.000 description 1
- 102100022173 Leucine-rich repeats and immunoglobulin-like domains protein 2 Human genes 0.000 description 1
- 102100033284 Leucine-rich repeats and immunoglobulin-like domains protein 3 Human genes 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 102100028961 Peroxisome proliferator-activated receptor gamma coactivator 1-beta Human genes 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 241000256248 Spodoptera Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- IVTVGDXNLFLDRM-HNNXBMFYSA-N Tomudex Chemical compound C=1C=C2NC(C)=NC(=O)C2=CC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)S1 IVTVGDXNLFLDRM-HNNXBMFYSA-N 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000221013 Viscum album Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 102000005421 acetyltransferase Human genes 0.000 description 1
- 108020002494 acetyltransferase Proteins 0.000 description 1
- USZYSDMBJDPRIF-SVEJIMAYSA-N aclacinomycin A Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1CCC(=O)[C@H](C)O1 USZYSDMBJDPRIF-SVEJIMAYSA-N 0.000 description 1
- 229960004176 aclarubicin Drugs 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 229960000711 alprostadil Drugs 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- 229960001694 anagrelide Drugs 0.000 description 1
- OTBXOEAOVRKTNQ-UHFFFAOYSA-N anagrelide Chemical compound N1=C2NC(=O)CN2CC2=C(Cl)C(Cl)=CC=C21 OTBXOEAOVRKTNQ-UHFFFAOYSA-N 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003006 anti-agglomeration agent Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 150000001502 aryl halides Chemical class 0.000 description 1
- 229960003272 asparaginase Drugs 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 1
- 229960003005 axitinib Drugs 0.000 description 1
- RITAVMQDGBJQJZ-FMIVXFBMSA-N axitinib Chemical compound CNC(=O)C1=CC=CC=C1SC1=CC=C(C(\C=C\C=2N=CC=CC=2)=NN2)C2=C1 RITAVMQDGBJQJZ-FMIVXFBMSA-N 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 210000000270 basal cell Anatomy 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- LNHWXBUNXOXMRL-VWLOTQADSA-N belotecan Chemical compound C1=CC=C2C(CCNC(C)C)=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 LNHWXBUNXOXMRL-VWLOTQADSA-N 0.000 description 1
- 229950011276 belotecan Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 235000013361 beverage Nutrition 0.000 description 1
- 230000001588 bifunctional effect Effects 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960003736 bosutinib Drugs 0.000 description 1
- UBPYILGKFZZVDX-UHFFFAOYSA-N bosutinib Chemical compound C1=C(Cl)C(OC)=CC(NC=2C3=CC(OC)=C(OCCCN4CCN(C)CC4)C=C3N=CC=2C#N)=C1Cl UBPYILGKFZZVDX-UHFFFAOYSA-N 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 229960002412 cediranib Drugs 0.000 description 1
- 238000002659 cell therapy Methods 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 208000037893 chronic inflammatory disorder Diseases 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960002448 dasatinib Drugs 0.000 description 1
- 229960003603 decitabine Drugs 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000008298 dragée Substances 0.000 description 1
- 239000013583 drug formulation Substances 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- INVTYAOGFAGBOE-UHFFFAOYSA-N entinostat Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC(=O)OCC1=CC=CN=C1 INVTYAOGFAGBOE-UHFFFAOYSA-N 0.000 description 1
- 229950005837 entinostat Drugs 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 150000002118 epoxides Chemical class 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 210000000442 hair follicle cell Anatomy 0.000 description 1
- WDVGLADRSBQDDY-UHFFFAOYSA-N holmium(3+);trinitrate Chemical compound [Ho+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O WDVGLADRSBQDDY-UHFFFAOYSA-N 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007919 intrasynovial administration Methods 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 1
- 150000002614 leucines Chemical class 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical class ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000003068 molecular probe Substances 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 229950008835 neratinib Drugs 0.000 description 1
- ZNHPZUKZSNBOSQ-BQYQJAHWSA-N neratinib Chemical compound C=12C=C(NC\C=C\CN(C)C)C(OCC)=CC2=NC=C(C#N)C=1NC(C=C1Cl)=CC=C1OCC1=CC=CC=N1 ZNHPZUKZSNBOSQ-BQYQJAHWSA-N 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 230000037311 normal skin Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 239000006186 oral dosage form Substances 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- DCWXELXMIBXGTH-UHFFFAOYSA-N phosphotyrosine Chemical compound OC(=O)C(N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-UHFFFAOYSA-N 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- GMVPRGQOIOIIMI-DWKJAMRDSA-N prostaglandin E1 Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1CCCCCCC(O)=O GMVPRGQOIOIIMI-DWKJAMRDSA-N 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 229960004432 raltitrexed Drugs 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000008844 regulatory mechanism Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- YBBRCQOCSYXUOC-UHFFFAOYSA-N sulfuryl dichloride Chemical compound ClS(Cl)(=O)=O YBBRCQOCSYXUOC-UHFFFAOYSA-N 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229960001674 tegafur Drugs 0.000 description 1
- WFWLQNSHRPWKFK-ZCFIWIBFSA-N tegafur Chemical compound O=C1NC(=O)C(F)=CN1[C@@H]1OCCC1 WFWLQNSHRPWKFK-ZCFIWIBFSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 239000003860 topical agent Substances 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960005026 toremifene Drugs 0.000 description 1
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- 230000023944 tyrosine phosphorylation of Stat3 protein Effects 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 229960000241 vandetanib Drugs 0.000 description 1
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- WAEXFXRVDQXREF-UHFFFAOYSA-N vorinostat Chemical compound ONC(=O)CCCCCCC(=O)NC1=CC=CC=C1 WAEXFXRVDQXREF-UHFFFAOYSA-N 0.000 description 1
- 229960000237 vorinostat Drugs 0.000 description 1
- XLMPPFTZALNBFS-INIZCTEOSA-N vorozole Chemical compound C1([C@@H](C2=CC=C3N=NN(C3=C2)C)N2N=CN=C2)=CC=C(Cl)C=C1 XLMPPFTZALNBFS-INIZCTEOSA-N 0.000 description 1
- 235000012431 wafers Nutrition 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
본 발명은 조절 T 세포의 표면에 존재하는 항원인 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질의 에피토프와 이에 특이적으로 결합하는 항체 또는 항원 결합 단편에 관한 것이다.
Description
본 발명은 조절 T 세포의 표면에 존재하는 항원인 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질의 에피토프와 이에 특이적으로 결합하는 항체 또는 항원 결합 단편에 관한 것이다.
모든 정상 개체에 있어서 가장 중요한 특성 중 하나는, 자기(self)를 구성하고 있는 항원 물질에 대해서는 해롭게 반응하지 않는 반면, 비-자기(non-self) 항원에 대해서는 이를 인식하고 제거할 수 있는 능력을 갖는 것이다. 이처럼 자기 항원에 대한 생체의 무반응을 면역학적 무반응성(immunologic unresponsiveness) 또는 관용(tolerance)이라 한다. 자기 관용은 자기 항원의 특이적인 수용체를 가지고 있을지 모르는 림프구를 제거함으로써, 또는 자기 항원에 접한 후 스스로 반응하는 기능이 불활성화됨으로써 발생한다. 자기 관용을 유도하거나 계속 유지하는데 있어서 문제가 생기게 되면 자기 항원에 대하여 면역반응이 일어나게 되고, 이로 인하여 초래되는 질환을 자가면역질환(autoimmune disease)이라 한다.
상기 자가면역질환의 치료를 위하여, 1970년 대 초 Gershon에 의해 고식적 T 세포(conventional T cells)의 효과 기능(effector function)을 제어 및 억제할 수 있는 T 세포의 존재 가능성이 있는 억제 T 세포라는 개념을 도입하여, 처음으로 제시된 이래(R. K. Gershon and K. Kondo, Immunology, 1970, 18: 723-37), 면역학의 많은 분야에서 조절 T 세포의 생물학적 특성 및 기능을 규명하기 위한 연구가 이루어져 왔다.
이에, 상기 조절 T 세포(Treg)는 과다한 염증과 면역반응의 발생을 자연적으로 방지하는 중요한 역할을 하지만, 자가면역질환과 만성염증질환이 발생하는 경우 조절 T 세포의 기능과 숫자가 현저하게 줄어드는 것이 보고되었다. 따라서, 면역 질환과 염증 질환이 있는 환자의 경우, 조절 T 세포가 정상적인 수준으로 생성되는 것이 중요하며, 이는 상기 질환의 치료법 중 하나가 될 수 있다.
현재까지 조절 T 세포에 특이적으로 존재하는 유전자 및 단백질에 대한 연구가 진행되어, CD25, CTLA4, CD62L, CD38, CD103, GITR 및 CD45RB 등의 물질이 표지 물질에 해당할 수 있음이 제시되어 왔지만, 아직 조절 T 세포만을 단독으로 표적화 할 수 있는 유전자 및 단백질은 존재하지 않는다.
한편, 상보성 결정 영역(complementarity determining region, 이하 "CDR"이라 함)이라 불리우는 3개의 다변 가능한 영역 및 4개의 구조 영역(framework region)을 포함한다. 상기 CDR은 주로 항원의 항원 결정기(epitope)에 결합하는 역할을 한다. 각각의 사슬의 CDR은 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2 및 CDR3로 지칭하고, 또한 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다.
본 발명의 일 목적은 조절 T 세포(regulatory T cell, Treg cell)의 표면에 존재하는 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질의 에피토프를 제공하는 것이다.
본 발명의 다른 목적은 상기 에피토프에 특이적으로 결합할 수 있는 항체 또는 항원 결합 단편을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 에피토프에 특이적으로 결합할 수 있는 항체 또는 항원 결합 단편을 포함하는 암의 예방 또는 치료용 약학 조성물을 제공하는 것이다.
본 발명의 다른 목적은 상기 에피토프에 특이적으로 결합할 수 있는 항체 또는 항원 결합 단편을 이용하여 암을 예방 또는 치료하는 방법을 제공하는 것이다.
그러나 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 당 업계에서 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다.
본 발명은 Lrig-1(leucine-rich and immunoglobulin-like domains 1) 단백질의 에피토프 또는 상기 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편에 관한 것이다.
본 발명에서, 상기 "Lrig-1 단백질"은 조절 T 세포의 표면에 존재하는 막관통 단백질로서, 세포 외 혹은 루멘 쪽의 루신 반복 서열(leucine-rich repeat(LRR))과 세개의 면역 체 유사 도메인(immunoglobulin-like domains), 세포막 관통 서열 및 세포질 꼬리부분으로 구성되어 있다. LRIG 유전자 패밀리는 LRIG1, LRIG2와 LRIG3이 존재하며, 이들간의 아미노산들은 매우 보전적으로 구성되어 있다. 상기 LRIG1 유전자는 정상 피부에서 높게 발현하고 있으며, 기저와 모낭 세포에 발현하여 상피 줄기세포의 증식을 조절할 수 있다. 따라서, 표피의 항상성 유지에 중요한 역할을 하며, 부존재 시 건선이나 피부암으로 발전할 수 있다. LRIG1이 위치한 염색체 3p14.3 부분이 잘리는 경우에는 암세포로 발전할 가능성이 있는 것으로 보고된 바 있으며, 실제로 신장암(renal cell carcinoma)과 편평상피암(cutaneous squamous cell carcinoma)에서는 LRIG1의 발현이 매우 감소되어 있는 것으로 확인되었다. 그런데 최근에는 상기 Lrig-1을 발현하는 암은 20~30% 정도에 불과하다고 밝혀지기도 하였다. 한편, 본 발명의 목적상 상기 Lrig-1 단백질은 인간 또는 마우스에 존재하는 단백질일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 일 예시에서 상기 Lrig-1 단백질은 인간, 원숭이 등의 영장류, 마우스, 래트 등의 설치류, 등을 포함하는 포유류로부터 유래된 Lrig-1 단백질일 수 있다.
본 발명의 일 예시에서 상기 Lrig-1 단백질은 서열번호 1로 표시되는 인간 유래 Lrig-1 단백질일 수 있고, 이는 서열번호 2로 표시되는 핵산 서열에 의해 코딩될 수 있으나, 이에 제한되는 것은 아니다(표 1 참조).
본 발명의 다른 예시에서 상기 Lrig-1 단백질은 서열번호 3으로 표시되는 마우스 유래 Lrig-1 단백질일 수 있으나, 이에 제한되는 것은 아니다(표 2 참조).
| 서열목록 | 서열정보 |
| 서열번호 3 | MARPGPGVLG APRLAPRLLL WLLLLLLQWP ESAGAQAGPR APCAAACTCA GDSLDCSGRG 60 LATLPRDLPS WTRSLNLSYN RLSEIDSAAF EDLTNLQEVY LNSNELTAIP SLGTASIGVV 120 SLFLQHNKIL SVDGSQLKSY LSLEVLDLSS NNITEIRSSC FPNGLRIREL NLASNRISIL 180 ESGAFDGLSR SLLTLRLSKN RITQLPVKAF KLPRLTQLDL NRNRIRLIEG LTFQGLDSLE 240 VLRLQRNNIS RLTDGAFWGL SKMHVLHLEY NSLVEVNSGS LYGLTALHQL HLSNNSISRI 300 QRDGWSFCQK LHELILSFNN LTRLDEESLA ELSSLSILRL SHNAISHIAE GAFKGLKSLR 360 VLDLDHNEIS GTIEDTSGAF TGLDNLSKLT LFGNKIKSVA KRAFSGLESL EHLNLGENAI 420 RSVQFDAFAK MKNLKELYIS SESFLCDCQL KWLPPWLMGR MLQAFVTATC AHPESLKGQS 480 IFSVLPDSFV CDDFPKPQII TQPETTMAVV GKDIRFTCSA ASSSSSPMTF AWKKDNEVLA 540 NADMENFAHV RAQDGEVMEY TTILHLRHVT FGHEGRYQCI ITNHFGSTYS HKARLTVNVL 600 PSFTKIPHDI AIRTGTTARL ECAATGHPNP QIAWQKDGGT DFPAARERRM HVMPDDDVFF 660 ITDVKIDDMG VYSCTAQNSA GSVSANATLT VLETPSLAVP LEDRVVTVGE TVAFQCKATG 720 SPTPRITWLK GGRPLSLTER HHFTPGNQLL VVQNVMIDDA GRYTCEMSNP LGTERAHSQL 780 SILPTPGCRK DGTTVGIFTI AVVCSIVLTS LVWVCIIYQT RKKSEEYSVT NTDETIVPPD 840 VPSYLSSQGT LSDRQETVVR TEGGHQANGH IESNGVCLRD PSLFPEVDIH STTCRQPKLC 900 VGYTREPWKV TEKADRTAAP HTTAHSGSAV CSDCSTDTAY HPQPVPRDSG QPGTASSQEL 960 RQHDREYSPH HPYSGTADGS HTLSGGSLYP SNHDRILPSL KNKAASADGN GDSSWTLAKL 1020 HEADCIDLKP SPTLASGSPE LMEDAISTEA QHLLVSNGHL PKACDSSPES VPLKGQITGK 1080 RRGPLLLAPR S |
본 발명의 일 구현 예에 따르면, 상기 Lrig-1 단백질의 에피토프로서, 하기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프를 제공한다:
[식 1]
Lx1Lx2x3N
상기 식 1에서,
x1 내지 x3는 각각 독립적으로 중성 아미노산, 산성 아미노산, 염기성 아미노산 또는 방향족 아미노산일 수 있다. 여기서 상기 중성 아미노산은, 글리신(glycine; G), 알라닌(alanine; A), 발린(valine, V), 류신(leucine, L), 아이소류신(isoleucine, I), 세린(serine, S) 또는 트레오닌(threonine, T)일 수 있고, 상기 산성 아미노산은 아스파트산(aspartic acid; D), 글루탐산(glutamic acid; E), 아스파라긴(asparagine; N) 또는 글루타민(glutamine; Q)일 수 있으며, 상기 염기성 아미노산은 라이신(lysine, K), 아르기닌(arginine; R) 또는 히스티딘(histidine; H)일 수 있고, 상기 방향족 아미노산은 페닐알라닌(phenylalanine; F) 또는 티로신(tyrosine; Y)일 수 있다.
본 발명의 일 예시로, 상기 x1 내지 x3는 각각 독립적으로 아스파라긴(asparagine; N), 아스파트산(aspartic acid; D), 세린(serine; S), 티로신(tyrosine; Y), 아르기닌(arginine; R), 페닐알라닌(phenylalanine; F), 라이신(lysine, K), 히스티딘(histidine; H), 류신(leucine, L), 발린(valine, V), 트레오닌(threonine, T), 알라닌(alanine; A), 글루타민(glutamine; Q), 글루탐산(glutamic acid; E) 및 글리신(glycine; G)으로 이루어진 군에서 선택되는 아미노산일 수 있다.
본 발명의 다른 예시로, 상기 x1은 아스파라긴(asparagine; N), 페닐알라닌(phenylalanine; F), 아스파트산(aspartic acid; D), 라이신(lysine, K), 히스티딘(histidine; H), 발린(valine, V), 아르기닌(arginine; R) 및 트레오닌(threonine, T)으로 이루어진 군에서 선택되는 아미노산이고, 상기 x2는 세린(serine; S), 글루타민(glutamine; Q), 알라닌(alanine; A), 아스파라긴(asparagine; N), 글루탐산(glutamic acid; E), 아스파트산(aspartic acid; D), 페닐알라닌(phenylalanine; F) 및 글리신(glycine; G)으로 이루어진 군에서 선택되는 아미노산이며, 상기 x3는 티로신(tyrosine; Y), 히스티딘(histidine; H), 글리신(glycine; G), 아르기닌(arginine; R), 아스파라긴(asparagine; N), 류신(leucine, L), 라이신(lysine, K) 및 페닐알라닌(phenylalanine; F)으로 이루어진 군에서 선택되는 아미노산일 수 있다.
본 발명의 또 다른 예시로, 상기 x1 내지 x3는 각각 독립적으로 각각 독립적으로 아스파라긴(asparagine; N), 아스파트산(aspartic acid; D), 세린(serine; S), 티로신(tyrosine; Y) 및 아르기닌(arginine; R)으로 이루어진 군에서 선택되는 아미노산일 수 있다.
본 발명의 또 다른 예시로, 상기 x1은 아스파라긴(asparagine; N) 또는 아스파트산(aspartic acid; D)이고, 상기 x2는 세린(serine; S) 또는 아스파라긴(asparagine; N)이며, 상기 x3는 티로신(tyrosine; Y) 또는 아르기닌(arginine; R)이다.
본 발명에서 상기 에피토프는 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 것으로, 10 내지 20 mer, 바람직하게는 10 내지 15 mer, 보다 바람직하게는 11 내지 14 mer로 이루어질 수 있다.
또한, 본 발명에서 상기 에피토프에서 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드는, 상기 에피토프의 N-터미널로부터 3 내지 6 번째, 바람직하게는 4 내지 6 번째, 보다 바람직하게는 5 번째에 위치할 수 있다.
본 발명의 일 예시로서, 상기 식 1로 표시되는 아미노산 서열로 이루어진 폴리펩티드는 하기 표 3의 서열번호 4 내지 17 중 어느 하나의 아미노산 서열로 표시될 수 있으나, 이에 제한되는 것은 아니다:
| 서열목록 | 서열정보 |
| 서열번호 4 | LNLSYN |
| 서열번호 5 | LDLNRN |
| 서열번호 6 | LFLQHN |
| 서열번호 7 | LNLAGN |
| 서열번호 8 | LDLSLN |
| 서열번호 9 | LRLSKN |
| 서열번호 10 | LKLQRN |
| 서열번호 11 | LHLEYN |
| 서열번호 12 | LHLSNN |
| 서열번호 13 | LVLSFN |
| 서열번호 14 | LRLSHN |
| 서열번호 15 | LDLDHN |
| 서열번호 16 | LTLFGN |
| 서열번호 17 | LNLGGN |
본 발명의 다른 일 예시로서, 상기 에피토프는 서열번호 18 또는 20의 아미노산 서열로 표시될 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 다른 구현 예에 따르면, 상기 Lrig-1 단백질의 에피토프로서, 하기 표 4의 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 폴리펩티드를 포함하는 에피토프를 제공한다:
| 서열목록 | 서열정보 |
| 서열번호 18 | WTRSLNLSYNKL |
| 서열번호 19 | TEVRNTCFPHGPPI |
| 서열번호 20 | RLTQLDLNRNRIR |
| 서열번호 21 | DLNRNRIRLIEGLTF |
| 서열번호 22 | NSIARIHRKGW |
| 서열번호 23 | WLPPWLIGRMLQAF |
| 서열번호 24 | RQVTFGHEGRY |
| 서열번호 25 | FGHEGRYQCVITNHF |
| 서열번호 26 | RLTVNVLPSFTKTPH |
| 서열번호 27 | RRMHVMPDDDVFF |
| 서열번호 28 | FFITDVKIDDAGVYS |
| 서열번호 29 | KGDRPLSLTERHH |
본 발명의 다른 구현 예에 따르면, 본 발명에서 제공하는 상기 에피토프를 코딩하는 핵산 분자를 제공한다.
본 발명의 핵산 분자는 본 발명에서 제공하는 폴리펩티드의 아미노산 서열을 당업자에게 알려진 바와 같이 폴리뉴클레오티드 서열로 번역된 핵산 분자 모두를 포함한다. 그러므로 ORF(open reading frame)에 의한 다양한 폴리뉴클레오티드 서열이 제조될 수 있으며 이 또한 모두 본 발명의 핵산 분자에 포함된다.
본 발명의 또 다른 구현 예에 따르면, 본 발명에서 제공하는 상기 단리된 핵산 분자가 삽입된 발현 벡터를 제공한다.
본 발명에서 상기 "벡터"는 어떤 핵산 분자가 연결된 또 다른 핵산을 수송할 수 있는 상기 핵산 분자이다. 벡터의 한 가지 유형은, 추가적인 DNA 세그멘트가 결찰될 수 있는 원형 이중가닥 DNA를 가리키는 "플라스미드"이다. 또 다른 유형의 벡터는 파지 벡터이다. 또 다른 유형의 벡터는 바이러스성 벡터로, 추가적인 DNA 세그멘트가 바이러스 게놈에 결찰될 수 있다. 어떤 벡터들은 그들이 유입된 숙주세포에서 자율적인 복제를 할 수 있다(예컨대, 박테리아성 벡터는 박테리아성 복제 기원을 갖는 에피솜 포유류 벡터). 기타 벡터(예컨대, 비-에피솜 포유류 벡터)는 숙주세포에 유입되면서 숙주세포의 게놈에 통합될 수 있고, 그럼으로써, 숙주 게놈과 함께 복제된다. 뿐만 아니라, 어떤 벡터는 이들이 작동차원에서 연결된 유전자의 발현을 지시할 수 있다. 이와 같은 벡터는 본원에서 "재조합 발현 벡터" 또는 단순히 "발현 벡터"라 명명된다. 일반적으로 재조합 DNA 기법에서 유용한 발현 벡터는 종종 플라스미드의 형태로 존재한다. 본 명세서에서, "플라스미드"와 "벡터"는, 플라스미드가 벡터 중 가장 통상적으로 사용되는 형태이기 때문에, 상호 교환하여 사용될 수 있다.
본 발명에서 상기 발현 벡터의 구체적인 예시로는 상업적으로 널리 사용되는 pCDNA 벡터, F, R1, RP1, Col, pBR322, ToL, Ti 벡터; 코스미드; 람다, 람도이드(lambdoid), M13, Mu, p1 P22, Qμμ, T-even, T2, T3, T7 등의 파아지; 식물 바이러스로 이루어진 군으로부터 선택될 수 있으나, 이에 제한되는 것은 아니며, 당업자에게 발현 벡터로 알려진 모든 발현 벡터는 본 발명에 사용 가능하고, 발현 벡터를 선택할 때에는 목적으로 하는 숙주 세포의 성질에 따른다. 숙주세포로의 벡터 도입 시 인산칼슘 트랜스펙션, 바이러스 감염, DEAE-덱스트란 조절 트랜스펙션, 리포펙타민 트랜스펙션 또는 전기천공법에 의해 수행될 수 있으나 이에 한정되는 것은 아니며 당업자는 사용하는 발현 벡터 및 숙주 세포에 알맞은 도입 방법을 선택하여 이용할 수 있다. 바람직하게 벡터는 하나 이상의 선별 마커를 함유하나 이에 한정되지 않으며, 선별 마커를 포함하지 않은 벡터를 이용하여 생산물 생산 여부에 따라 선별이 가능하다. 선별 마커의 선택은 목적하는 숙주 세포에 의해 선별되며, 이는 이미 당업자에게 알려진 방법을 이용하므로 본 발명은 이에 제한을 두지 않는다.
본 발명의 핵산 분자를 정제를 용이하게 하기 위하여 태그 서열을 발현 벡터 상에 삽입하여 융합시킬 수 있다. 상기 태그로는 헥사-히스티딘 태그, 헤마글루티닌 태그, myc 태그 또는 flag 태그를 포함하나 이에 한정되는 것은 아니며 당업자에게 알려진 정제를 용이하게 하는 태그는 모두 본 발명에서 이용 가능하다.
본 발명의 또 다른 구현 예에 다르면, 본 발명에서 제공하는 상기 발현 벡터가 형질 감염된 숙주 세포주를 제공한다.
본 발명에서 상기 "숙주 세포"에는 폴리펩티드 삽입물의 편입을 위한 벡터(들)의 수령자(recipient)일 수 있거나 또는 수령자였던 개별적인 세포 또는 세포배양물이 포함된다. 숙주 세포에는 단일 숙주 세포의 자손이 포함되고, 상기 자손은 자연적인, 우발적인 또는 고의의 돌연변이 때문에 반드시 원래 모세포와 완전히 동일(형태학상 또는 게놈 DNA 보완체에서)하지 않을 수 있다. 숙주 세포에는 본원의 폴리펩티드(들)로 체내에서 형질주입된 세포가 포함된다.
본 발명에 있어서, 상기 숙주 세포로는 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있고, 예를 들면 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포, 피치아 파스 토리스 등의 균류세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO(중국 햄스터 난소 세포, Chinese hamster ovary cells), SP2/0(생쥐 골수종), 인간 림프아구(Human lymphoblastoid), COS, NSO(생쥐 골 수종), 293T, 보우 멜라노마 세포, HT-1080, BHK(베이비 햄스터 신장세포, Baby Hamster Kidney cells), HEK(인간 배아신장 세포, Human Embryonic Kidney cells) 또는 PERC.6(인간 망막 세포)의 동물 세포; 또는 식물 세포일 수 있으나, 이에 제한되는 것은 아니며, 당업자에게 알려진 숙주 세포주로 사용 가능한 세포는 모두 이용 가능하다.
본 발명의 또 다른 구현 예에 따르면, 본 발명의 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편을 제공한다.
또한, 본 발명에 따른 항체는 조절 T 세포 상에 존재하는 Lrig-1 단백질 중 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프; 또는 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 폴리펩테드를 포함하는 에피토프에 특이적으로 결합하여 상기 조절 T 세포의 기능을 억제하고, 이펙터 T 세포의 활성은 유지 혹은 상승시켜 암 세포 중에서도 특히 고형암 세포의 성장을 효과적으로 억제할 수 있다.
본 발명에서 상기 "암"은 포유류에서 전형적으로 조절되지 않는 세포 성장으로 특징 지어진 생리적 상태를 나타내거나 가리킨다. 본 발명에서 예방, 개선 또는 치료의 대상이 되는 암은 고형 장기(solid organ)에서 비정상적으로 세포가 성장하여 발생한 덩어리로 이루어진 고형암(solid tumor)일 수 있고, 고형 장기의 부위에 따라 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암 등일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 상기 항체는 전장 항체 (full-length antibody) 또는 항체의 일부분으로써 Lrig-1 단백질에 결합할 능력을 가지며 본 발명의 결합 분자와 경쟁적으로 Lrig-1 항원 결정 부위에 결합하는 항체 단편 모두를 포함한다.
본 발명에 있어서, 상기 "항체"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로블린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미한다. 본 발명의 목적상 상기 항원은 조절 T 세포(regulatory T cell)의 표면에 존재하는 Lrig-1 단백질일 수 있다. 바람직하게는 상기 Lrig-1 단백질의 류신 리치 구역(Leucine Rich Region) 또는 면역글로블린 유사 도메인을 특이적으로 인식하는 것일 수 있으나, 이에 제한되지 아니한다.
본 발명에서 상기 "면역글로불린"은 중쇄 및 경쇄를 가지며 각각의 중쇄 및 경쇄는 불변 영역 및 가변 영역을 포함한다. 경쇄 및 중쇄의 가변 영역은, 상보성 결정 영역(complementarity determining region, 이하 "CDR"이라 함)이라 불리우는 3개의 다변 가능한 영역 및 4개의 구조 영역(Framework region)을 포함한다. 상기 CDR은 주로 항원의 항원 결정기(Epitope)에 결합하는 역할을 한다. 각각의 사슬의 CDR은 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2 및 CDR3로 지칭하고, 또한 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다.
본 발명에서 상기 "전장 항체"는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드(Disulfide) 결합으로 연결되어 있으며, IgA, IgD, IgE, IgM, 및 IgG를 포함한다. 상기 IgG는 그 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다.
또한, 본 발명에서 상기 "항원 결합 단편"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, 항원 결합 단편의 예는 (i) 경쇄의 가변역역(VL) 및 중쇄의 가변영역(VH)과 경쇄의 불변역역(CL) 및 중쇄의 첫번째 불변 영역 (CH1)으로 이루어진 Fab 단편; (ii) VH 및 CH1 도메인으로 이루어진 Fd 단편; (iii) 단일 항체의 VL 및 VH 도메인으로 이루어진 Fv 단편; (iv) VH 도메인으로 이루어진 dAb 단편(Ward, E. S. et al., Nature 341: 544-546(1989)]; (v) 분리된 CDR 영역; (vi) 2개의 연결된 Fab 단편을 포함하는 2가 단편인 F(ab')2 단편; (vii) VH 도메인 및 VL 도메인이 항원 결합 부위를 형성하도록 결합시키는 펩타이드 링커에 의해 결합된 단일쇄 Fv 분자(scFv); (viii) 이특이적인 단일쇄 Fv 이량체 및 (ix) 유전자 융합에 의해 제작된 다가 또는 다특이적인 단편인 디아바디(diabody) 등을 포함한다. 상기 항원 결합 단편은 단백질 가수분해 효소, 예를 들면 파파인 또는 펩신을 이용하는 경우 Fab 또는 F(ab')2의 단편을 얻을 수 있으며, 유전자 재조합 기술을 통하여 제작할 수 있다.
또한, 본 발명에서 상기 항체는 단일클론항체(monoclonal antibody), 다클론항체(polyclonal antibody), 키메라 항체(chimeric antibody), 인간화 항체(humanized antibody), 이가(bivalent), 양특이성 분자, 미니바디(minibody), 도메인 항체, 이중특이적 항체(bispecific antibody), 항체 모방체, 디아바디(diabody), 트리아바디(triabody), 테트라바디(tetrabody) 또는 이의 단편일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명에서 상기 "단일클론항체"는, 실질적으로 동일한 항체 집단에서 수득한 단일 분자 조성의 항체 분자를 일컫는 말로, 특정 항원 결정기(Epitope)에 대해 단일 결합 특이성 및 친화도를 나타낸다.
본 발명에서 상기 "키메라 항체"는, 생쥐 항체의 가변 영역 및 인간 항체의 불변 영역을 재조합 시킨 항체로서, 생쥐 항체에 비하여 면역 반응이 크게 개선된 항체이다.
또한, 본 발명에서 상기 "인간화 항체"는 인간이 아닌 종에서 유래한 항체의 단백질 서열을 인간에서 자연적으로 생산된 항체 변이체와 유사하도록 변형시킨 항체를 의미한다. 그 예로 상기 인간화 항체는 생쥐 유래의 CDR을 인간 항체 유래의 FR과 재조합시켜 인간화 가변 영역을 제조하고, 이를 바람직한 인간 항체의 불변 영역과 재조합시켜 인간화 항체를 제조할 수 있다.
본 발명에서 상기 "결합" 또는 "특이적 결합"은 본원 항체 또는 항체 조성물의 항원에 대한 친화도를 나타내는 것이다. 항원 항체 결합에서 "특이적 결합"은 전형적으로 해리상수(dissociation constant, Kd)가 1x10-5M 미만 또는 1x10-6M 미만 또는 1x10-7M 미만인 경우 비특이적인 배경 결합과 구분될 수 있다. 특이적 결합은 당업계의 공지된 방법, 예를 들면 ELISA, SPR(Surface plasmon resonance), 면역침전(immunoprecipitation), 공침전(coprecipitation) 등의 방법으로 검출될 수 있으며, 비특이적 결합과 특이적 결합을 구분할 수 있는 적절한 대조군을 포함한다.
본 발명의 항체 또는 항원 결합 단편은 단량체의 항원 결합능의 적어도 일부를 포함하는 이량체, 삼량체, 사량체, 오량체 등의 다량체로 존재할 수 있다. 이러한 다량체는 또한 동종다량체, 또는 이종다량체를 포함하는 것이다. 항체 다량체는 다수의 항원 결합 부위를 포함하기 때문에 단량체와 비교하여 항원에 대한 결합능이 우수하다. 항체의 다량체는 또한 다기능성(bifunctional, trifunctional, tetrafunctional) 항체 제작에도 용이하다.
본 발명에서 상기 "다기능성"이란, 두 가지 이상의 활성 또는 기능 (예를 들면 항원결합능, 효소 활성, 리간드 또는 수용체 결합능)을 갖는 항체 또는 항원 결합 단편을 일컫는 것으로, 예를 들면 본 발명의 항체는 효소 활성을 갖는 폴리펩타이드 예를 들면 루시퍼라제, 아세틸트랜스퍼라제, 갈락토시다제 등과 결합될 수 있다. 다기능성 항체는 또한 다가성(multivalent) 또는 다특이성(bispecific, trispecific, 등) 형태의 항체를 포함한다.
본 발명의 또 다른 구현 예에 따르면, 본 발명에서 제공하는 항체 또는 항원 결합 단편; 및 약물을 포함하는 항체-약물 결합체(Antibody-Drug Conjugate, ADC)를 제공한다.
본 발명에서 상기 "항체-약물 결합체(Antibody-Drug Conjugate, ADC)"란, 항체와 약물의 생물학적 활성을 저하시키지 않으면서 약물과 항체를 화학적으로 연결한 형태를 지칭한다. 본 발명에서 상기 항체-약물 결합체는 항체의 중쇄 및/또는 경쇄의 N-말단의 아미노산 잔기에 약물이 결합된 형태, 구체적으로는 항체의 중쇄 및/또는 경쇄의 N-말단, α-아민기에 약물이 결합된 형태를 말한다.
본 발명에서 상기 "약물"은 세포에 특정 생물학적 활성을 가지는 임의의 물질을 의미할 수 있으며, 이는 DNA, RNA 또는 펩타이드(Peptide)를 포함하는 개념이다. 상기 약물은 α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 형태일 수 있으며, α-아민기와 반응하여 가교할 수 있는 반응기를 포함하는 링커가 연결되어 있는 형태 역시 포함한다.
본 발명에서 상기 α-아민기와 반응하여 가교할 수 있는 반응기의 예로는, 항체의 중쇄 또는 경쇄의 N-말단의 α-아민기와 반응하여 가교할 수 있다면 그 종류는 특별히 제한되지 않으며, 당업계에 공지된 아민기와 반응하는 종류를 모두 포함한다. 그 예로 아이소티오시아네이트(Isothiocyanate), 아이소시아네이트(Isocyanates), 아실 아자이드(Acyl azide), NHS 에스터(NHS ester), 설포닐 클로라이드(Sulfonyl chloride), 알데하이드(Aldehyde), 글리옥살(Glyoxal), 에폭사이드(Epoxide), 옥시레인(Oxirane), 칼보네이트(Carbonate), 아릴 할라이드(Aryl halide), 이미도에스터(Imidoester), 카보이미드(Carbodiimide), 안하이드라이드(Anhydride) 및 플루오로페닐 에스터(Fluorophenyl ester) 중 어느 하나 일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서, 항체-약물 결합체는 상기 항체 또는 항원 결합 단편으로 본 발명의 에피토프, 즉 Lrig-1 단백질 중 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프; 또는 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편을 포함하고, 이때 상기 약물은 Lrig-1 항체가 표적으로 하는 질환인, 암을 치료할 수 있는 약물로 항암제일 수 있다.
본 발명에서 상기 항암제는 암의 예방, 개선 또는 치료를 위해 사용되는 약물이라면 제한없이 포함될 수 있으나, 예를 들면, 나이트로젠 머스타드, 이마티닙, 옥살리플라틴, 리툭시맙, 엘로티닙, 네라티닙, 라파티닙, 제피티닙, 반데타닙, 니로티닙, 세마사닙, 보수티닙, 악시티닙, 세디라닙, 레스타우르티닙, 트라스투주맙, 게피티니브, 보르테조밉, 수니티닙, 카보플라틴, 소라페닙, 베바시주맙, 시스플라틴, 세툭시맙, 비스쿰알붐, 아스파라기나제, 트레티노인, 하이드록시카바마이드, 다사티닙, 에스트라머스틴, 겜투주맵오조가마이신, 이브리투모맙튜세탄, 헵타플라틴, 메칠아미노레불린산, 암사크린, 알렘투주맙, 프로카르바진, 알프로스타딜, 질산홀뮴 키토산, 젬시타빈, 독시플루리딘, 페메트렉세드, 테가푸르, 카페시타빈, 기메라신, 오테라실, 아자시티딘, 메토트렉세이트, 우라실, 시타라빈, 플루오로우라실, 플루다가빈, 에노시타빈, 플루타미드, 카페시타빈, 데시타빈, 머캅토푸린, 티오구아닌, 클라드리빈, 카르모퍼, 랄티트렉세드, 도세탁셀, 파클리탁셀, 이리노테칸, 벨로테칸, 토포테칸, 비노렐빈, 에토포시드, 빈블라스틴, 이다루비신, 미토마이신, 블레로마이신, 닥티노마이신, 피라루비신, 아클라루비신, 페프로마이신, 템시롤리무스, 테모졸로마이드, 부설판, 이포스파미드, 사이클로포스파미드, 멜파란, 알트레트민, 다카바진, 치오테파, 니무스틴, 클로람부실, 미토락톨, 레우코보린, 트레토닌, 엑스메스탄, 아미노글루테시미드, 아나그렐리드, 올라파립, 나벨빈, 파드라졸, 타목시펜, 토레미펜, 테스토락톤, 아나스트로졸, 레트로졸, 보로졸, 비칼루타미드, 로무스틴, 5FU, 보리노스텟, 엔티노스텟 및 카르무스틴으로 이루어진 군에서 선택될 수 있고, 이에 제한되는 것은 아니다.
본 발명에서 상기 암은 고형 장기(solid organ)에서 비정상적으로 세포가 성장하여 발생한 덩어리로 이루어진 고형암(solid tumor)일 수 있고, 구체적인 예시로 고형 장기의 부위에 따라 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암 등일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 구현 예에 따르면, 본 발명에서 제공하는 항체 또는 항원 결합 단편; 또는 항체-약물 결합체(Antibody-Drug Conjugate, ADC)를 유효 성분으로 포함하는 암의 예방 또는 치료용 약학 조성물을 제공한다.
본 발명에서 상기 약학 조성물에서 유효 성분으로 포함하는 항체 또는 항원 결합 단편; 또는 이에 약물이 결합된 항체-약물 결합체는, 조절 T 세포 상에 존재하는 Lrig-1 단백질 중 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프; 또는 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 폴리펩티드를 포함하는 에피토프에 특이적으로 결합하여 상기 조절 T 세포의 기능을 억제하고, 이펙터 T 세포의 활성은 유지 혹은 상승시켜 암 세포 중에서도 특히 고형암 세포의 성장을 효과적으로 억제할 수 있다.
본 발명에서 상기 암은 고형 장기(solid organ)에서 비정상적으로 세포가 성장하여 발생한 덩어리로 이루어진 고형암(solid tumor)일 수 있고, 구체적인 예시로 고형 장기의 부위에 따라 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암 등일 수 있으나, 이에 제한되는 것은 아니다.
한편, 본 발명에서, "예방"은 본 발명의 약학 조성물을 이용하여 질환의 증상을 차단하거나, 그 증상을 억제 또는 지연시키는 모든 행위라면 제한없이 포함할 수 있다.
또한, 본 발명에서, "치료"는 본 발명의 약학 조성물을 이용하여 질환의 증상이 호전되거나 이롭게 되는 모든 행위라면 제한없이 포함할 수 있다.
본 발명에서 상기 약학 조성물은 캡슐, 정제, 과립, 주사제, 연고제, 분말 또는 음료 형태임을 특징으로 할 수 있으며, 상기 약학 조성물은 인간을 대상으로 하는 것을 특징으로 할 수 있다.
본 발명에서 상기 약학 조성물은 이들로 한정되는 것은 아니지만, 각각 통상의 방법에 따라 산제, 과립제, 캡슐, 정제, 수성 현탁액 등의 경구형 제형, 외용제, 좌제 및 멸균 주사 용액의 형태로 제형화하여 사용될 수 있다. 본 발명의 약학 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다. 약학적으로 허용되는 담체는 경구 투여 시에는 결합제, 활탁제, 붕해제, 부형제, 가용화제, 분산제, 안정화제, 현탁화제, 색소, 향료 등을 사용할 수 있으며, 주사제의 경우에는 완충제, 보존제, 무통화제, 가용화제, 등장제, 안정화제 등을 혼합하여 사용할 수 있으며, 국소투여용의 경우에는 기제, 부형제, 윤활제, 보존제 등을 사용할 수 있다. 본 발명의 약학 조성물의 제형은 상술한 바와 같은 약제학적으로 허용되는 담체와 혼합하여 다양하게 제조될 수 있다. 예를 들어, 경구 투여시에는 정제, 트로키, 캡슐, 엘릭서(elixir), 서스펜션, 시럽, 웨이퍼 등의 형태로 제조할 수 있으며, 주사제의 경우에는 단위 투약 앰플 또는 다수회 투약 형태로 제조할 수 있다. 기타, 용액, 현탁액, 정제, 캡슐, 서방형 제제 등으로 제형화할 수 있다.
한편, 제제화에 적합한 담체, 부형제 및 희석제의 예로는, 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말디톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로즈, 미정질 셀룰로즈, 폴리비닐피롤리돈, 물, 메틸하이드록시벤조에이트, 프로필하이드록시벤조에이트, 탈크, 마그네슘 스테아레이트 또는 광물유 등이 사용될 수 있다. 또한, 충진제, 항 응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.
본 발명에 상기 약학 조성물의 투여 경로는 이들로 한정되는 것은 아니지만 구강, 정맥내, 근육내, 동맥내, 골수내, 경막내, 심장내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하 또는 직장이 포함된다. 경구 또는 비경구 투하가 바람직하다.
본 발명에서 상기 "비경구"란, 피하, 피내, 정맥내, 근육내, 관절내, 활액낭내, 흉골내, 경막내, 병소내 및 두개골내 주사 또는 주입기술을 포함한다. 본 발명의 약학 조성물은 또한 직장 투여를 위한 좌제의 형태로 투여될 수 있다.
본 발명의 상기 약학 조성물은 사용된 특정 화합물의 활성, 연령, 체중, 일반적인 건강, 성별, 정식, 투여 시간, 투여 경로, 배출율, 약물 배합 및 예방 또는 치료될 특정 질환의 중증을 포함한 여러 요인에 따라 다양하게 변할 수 있고, 상기 약학 조성물의 투여량은 환자의 상태, 체중, 질병의 정도, 약무 형태, 투여 경로 및 기간에 따라 다르지만 당업자에 의해 적절하게 선택될 수 있고, 1일 0.0001 내지 50mg/kg 또는 0.001 내지 50mg/kg으로 투여할 수 있다. 투여는 하루에 한번 투여할 수도 있고, 수회 나누어 투여할 수도 있다. 상기 투여량은 어떠한 면으로든 본 발명의 범위를 한정하는 것은 아니다. 본 발명에 따른 의약 조성물은 환제, 당의정, 캡슐, 액제, 겔, 시럽, 슬러리, 현탁제로 제형화될 수 있다.
본 발명의 또 다른 구현 예에 따르면, 본 발명에 따른 항체 또는 항원 결합 단편; 또는 항체-약물 결합체(Antibody-Drug Conjugate, ADC)를 개체에 투여하는 단계를 포함하는 암의 예방 또는 치료 방법에 관한 것이다.
본 발명의 항체 또는 항원 결합 단편; 및 항체-약물 결합체는 조절 T 세포 상에 존재하는 Lrig-1 단백질 중 상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프; 또는 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 폴리펩티드를 포함하는 에피토프에 특이적으로 결합하여 상기 조절 T 세포의 기능을 억제하고, 이펙터 T 세포의 활성은 유지 혹은 상승시켜 암 세포 중에서도 특히 고형암 세포의 성장을 효과적으로 억제할 수 있다.
본 발명에서 상기 "개체"는 암의 발병이 의심되는 개체로서, 상기 암 발병의 의심 개체는 해당 질환이 발병하였거나 발병할 수 있는 인간을 포함한 쥐, 가축 등을 포함하는 포유동물을 의미하나, 본 발명의 항체 또는 항체-약물 결합체로 치료 가능한 개체는 제한 없이 포함된다.
본 발명의 방법은 항체 또는 항체-약물 결합체를 약학적 유효량으로 투여하는 것을 포함할 수 있다. 적합한 총 1일 사용량은 올바른 의학적 판단범위 내에서 처치의에 의해 결정될 수 있으며, 1회 또는 수회로 나누어 투여할 수 있다. 그러나 본 발명의 목적상, 특정 환자에 대한 구체적인 치료적 유효량은 달성하고자 하는 반응의 종류와 정도, 경우에 따라 다른 제제가 사용되는지의 여부를 비롯한 구체적 조성물, 환자의 연령, 체중, 일반 건강 상태, 성별 및 식이, 투여 시간, 투여 경로 및 조성물의 분비율, 치료기간, 구체적 조성물과 함께 사용되거나 동시 사용되는 약물을 비롯한 다양한 인자와 의약 분야에 잘 알려진 유사 인자에 따라 다르게 적용하는 것이 바람직하다.
한편, 이에 제한되지 않으나, 상기 암의 예방 또는 치료 방법은 하나 이상의 암 질환에 대한 치료적 활성을 가지는 화합물 또는 물질을 투여하는 것을 더 포함하는 병용 요법일 수 있다.
본 발명에서 상기 "병용"은 동시, 개별 또는 순차 투여를 나타내는 것으로 이해되어야 한다. 상기 투여가 순차 또는 개별적인 경우, 2차 성분 투여의 간격은 상기 병용의 이로운 효과를 잃지 않도록 하는 것이어야 한다.
본 발명에서 상기 항체 또는 항체-약물 결합체의 투여 용량은 환자 체중 1 kg당 약 0.0001 μg 내지 500 mg일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 상기 암은 고형 장기(solid organ)에서 비정상적으로 세포가 성장하여 발생한 덩어리로 이루어진 고형암(solid tumor)일 수 있고, 구체적인 예시로 고형 장기의 부위에 따라 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암 등일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 따른 Lrig-1 단백질의 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편은 조절 T 세포 상에 존재하는 본 발명의 에피토프에 특이적으로 결합하여 상기 조절 T 세포의 기능을 억제하고, 이펙터 T 세포의 활성은 유지 혹은 상승시켜 암 세포 중에서도 특히 고형암 세포의 성장을 효과적으로 억제할 수 있다.
도 1은 본 발명의 일 실시예에 따른 Lrig-1 단백질의 구조를 나타낸 것이다.
도 2는 본 발명의 일 실시예에 따른 Lrig-1 단백질의 구조를 나타낸 것이다.
도 3은 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 4는 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 5는 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 6은 본 발명의 일 실시예에 따른 Lrig-1, Lrig-2 및 Lrig-3 mRNA의 발현 정도를 나타낸 것이다.
도 7은 본 발명의 일 실시예에 따른 조절 T 세포와 비 조절 T 세포 내 Lrig-1 단백질의 발현량 비교 결과를 나타낸 것이다.
도 8은 본 발명의 일 실시예에 따른 조절 T 세포의 표면에 Lrig-1 단백질의 발현을 나타낸 것이다.
도 9는 본 발명의 일 실시예에서 항체(A7, C8, E7, G3, A8, B8, D9 및 H6)와 Lrig-1 단백질에 대한 결합력을 분석한 결과를 나타낸 것이다.
도 10은 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A7, C8, E7, G3, A8, B8, D9 및 H6)와 조절 T 세포 내에서 Lrig-1 단백질 유도 Stat3 인산화 조절 기작을 분석한 결과를 나타낸 것이다.
도 11은 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A8, B8, D9 및 H6)를 이용한 암 치료 실험 설계도를 나타낸 것이다.
도 12는 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A8, B8, D9 및 H6)를 이용한 암 치료 효과를 나타낸 것이다.
도 13은 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6) 10 μg/ml의 에피토프 맵핑 결과를 나타낸 것이다.
도 14는 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6) 100 μg/ml의 에피토프 맵핑 결과를 나타낸 것이다.
도 15는 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6)의 에피토프 맵핑 결과를 나타낸 것이다.
도 2는 본 발명의 일 실시예에 따른 Lrig-1 단백질의 구조를 나타낸 것이다.
도 3은 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 4는 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 5는 본 발명의 일 실시예에 따른 Lrig-1 mRNA의 발현 정도를 나타낸 것이다.
도 6은 본 발명의 일 실시예에 따른 Lrig-1, Lrig-2 및 Lrig-3 mRNA의 발현 정도를 나타낸 것이다.
도 7은 본 발명의 일 실시예에 따른 조절 T 세포와 비 조절 T 세포 내 Lrig-1 단백질의 발현량 비교 결과를 나타낸 것이다.
도 8은 본 발명의 일 실시예에 따른 조절 T 세포의 표면에 Lrig-1 단백질의 발현을 나타낸 것이다.
도 9는 본 발명의 일 실시예에서 항체(A7, C8, E7, G3, A8, B8, D9 및 H6)와 Lrig-1 단백질에 대한 결합력을 분석한 결과를 나타낸 것이다.
도 10은 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A7, C8, E7, G3, A8, B8, D9 및 H6)와 조절 T 세포 내에서 Lrig-1 단백질 유도 Stat3 인산화 조절 기작을 분석한 결과를 나타낸 것이다.
도 11은 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A8, B8, D9 및 H6)를 이용한 암 치료 실험 설계도를 나타낸 것이다.
도 12는 본 발명의 일 실시예에서 Lrig-1 단백질에 특이적인 단일클론항체(A8, B8, D9 및 H6)를 이용한 암 치료 효과를 나타낸 것이다.
도 13은 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6) 10 μg/ml의 에피토프 맵핑 결과를 나타낸 것이다.
도 14는 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6) 100 μg/ml의 에피토프 맵핑 결과를 나타낸 것이다.
도 15는 본 발명의 일 실시예에서 마이크로어레이를 이용하여 Lrig-1 단백질에 대한 단일클론항체(H6)의 에피토프 맵핑 결과를 나타낸 것이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로서, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예
[준비예 1] T 세포 아형 세포 배양
조절 T 세포(Treg)에서만 Lrig-1 단백질이 발현되는지 확인하기 위하여, T 세포의 아형(subset)인 Th0, Th1, Th2, Th17 및 iTreg을 준비하였다. 상기 iTreg은 자연적으로 분리한 nTreg과는 달리 하기 조성을 포함하는 배지에서 분화를 인공적으로 유도한 세포를 의미한다.
T 세포의 아형은 우선, 쥐의 비장으로부터 얻은 나이브(naive) T 세포를 분리한 뒤, 우태아혈청(FBS; hyclone, logan, UT) 10%를 포함하는 RPMI1640(Invitrogen Gibco, Grand Island, NY) 영양배지에 하기 표 5의 성분을 각각 더 포함하도록 하여, 37℃, 5 % CO2 배양기 내에서 72시간 배양을 통해 각각의 세포로 분화 유도하였다.
| 분화 세포 | 조성 |
| Th0 | anti-CD3, anti-CD28 |
| Th1 | IL-12, anti-IL-4 항체 |
| Th2 | IL-4, anti-IFNβ |
| Th17 | IL-6, TGFβ, anti-IFNβ, anti-IL-4 |
| iTreg | IL-2, TGFβ |
[실시예 1] Lrig-1 구조 분석
조절 T 세포의 표면 단백질인 Lrig-1 단백질에 특이적인 항체를 제작하기 위하여 Lrig-1 단백질의 세포외 도메인의 3차원 입체 구조를 예측하였다.
우선, 항원 결정기(Epitope) 염기서열 예측을 위해 Lrig-1 단백질의 세포외 도메인(Extracellular domain; ECD)의 구조를 확인하기 위하여 Uniprot(http://www.uniprot.org)과 RCSB Protein Data Bank (http://www.rcsb.org/pdb) 툴을 이용하여 3차원 입체 구조를 예측한 뒤, 그 결과를 도 1 및 2에 나타내었다.
도 1에서 보는 바와 같이, Lrig-1 단백질의 세포외 도메인 중 Lrig-LRR 도메인(아미노산 서열 41 ~ 494번) 내에는 LRR1 내지 LRR15의 총 15개의 류신 리치 부위(Leucine rich region)가 존재하였다. 상기 LRR 도메인 각각은 23 내지 27개의 아미노산으로 구성되고, 류신은 3 내지 5개가 존재하였다.
또한, 도 2에서 보는 바와 같이, Lrig-1 단백질의 세포외 도메인 중 Lrig-1 단백질의 아미노산 서열 494 내지 781번에는 면역글로블린 유사 도메인(Immunoglobulin-like domain)이 3개 존재하였다.
[실시예 2] Lrig-1 mRNA의 조절 T 세포에서의 특이적 발현 확인
Lrig-1 단백질이 조절 T 세포에 특이적인 바이오마커(biomarker)로 작용할 수 있는지 검증하였다.
상기 검증을 위하여, 쥐의 비장으로부터 CD4 비드를 통해 자석 활성 세포 분류기(magnet-activated cell sorting; MACS)를 이용하여 CD4+ T 세포를 분리하였다. 이후, CD25 항체를 이용하여 형광 활성 세포 분류기(FACS)를 이용해 조절 T (CD4+CD25+ T) 세포 및 비 조절 T (CD4+CD25- T) 세포를 분리하였다. 각각의 세포 및 상기 준비예 1에서 분화된 세포는 트리졸(Trizol)을 이용하여 mRNA를 추출한 뒤, 게노믹 RNA는 gDNA 추출 키트(Qiagen)를 이용하여 업체에서 제공한 프로토콜에 의해 gDNA를 제거하였다. gDNA가 제거된 mRNA는 BDsprint cDNA 합성 키트 (Clonetech)를 통해 cDNA로 합성하였다.
상기 cDNA에서 Lrig-1 mRNA의 발현량을 정량적으로 확인하기 위하여 실시간 중합효소연쇄반응(real time PCR)을 수행하였다.
상기 실시간 중합효소연쇄반응은 SYBR Green (Molecular Probes)을 이용하여 업체에서 제공한 프로토콜에 의해 95℃에서 3분, 61℃에서 15초, 72℃에서 30초씩 40 사이클의 조건으로, 하기 표 6의 프라이머를 이용하여 수행하였고, 상대적인 유전자 발현량은 △CT 방법을 이용하여 계산하였으며, HPRT를 이용하여 일반화(normalization) 하여, 그 결과를 도 3 내지 6에 나타내었다.
| 프라이머 | 서열 |
| 쥐 Lrig-1 | Forward 5' - GAC GGA ATT CAG TGA GGA GAA CCT - 3' |
| Reverse 5' - CAA CTG GTA GTG GCA GCT TGT AGG - 3' | |
| 쥐 Lrig-2 | forward 5' - TCA CAA GGA ACA TTG TCT GAA CCA- 3' |
| reverse 5' - GCC TGA TCT AAC ACA TCC TCC TCA- 3' | |
| 쥐 Lrig-3 | forward 5' - CAG CAC CTT GAG CTG AAC AGA AAC - 3' |
| reverse 5' - CCA GCC TTT GGT AAT CTC GGT TAG - 3' | |
| 쥐 FOXP3 | forward 5' - CTT TCA CCT ATC CCA CCC TTA TCC - 3' |
| reverse 5' - ATT CAT CTA CGG TCC ACA CTG CTC - 3' | |
| ACTG1 | forward 5' - GGC GTC ATG GTG GGC ATG GG - 3' |
| reverse 5' - ATG GCG TGG GGA AGG GCG TA - 3' |
도 3에서 보는 바와 같이, 비 조절 T (CD4+CD25- T) 세포에 비하여 조절 T (CD4+CD25+ T) 세포에서 Lrig-1의 발현이 18.1배 높은 것을 알 수 있다. 이는, 기존에 알려져 있는 조절 T 세포의 마커인 Lag3 및 Ikzf4와 비교하였을 때 약 10배 정도 발현양이 높은 수준이었다.
또한, 도 4 및 5에서 보는 바와 같이, 다른 종류의 면역세포에 비하여 조절 T 세포, 특히 유도된 조절 T 세포(iTreg)에 비해 자연적으로 분리한 조절 T 세포(nTreg)에서 Lrig-1 mRNA의 발현이 현저하게 높았다.
또한, 도 6에서 보는 바와 같이, Lrig 패밀리에 해당하는 Lrig-1, Lrig-2 및 Lrig-3 중에서 Lrig-1의 발현이 가장 높았다.
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포, 특히 자연적으로 존재하는 조절 T 세포에서 특이적으로 발현하는 것을 알 수 있다.
[실시예 3] Lrig-1 단백질의 조절 T 세포에서의 특이적 발현 확인
Lrig-1 mRNA로부터 발현된 Lrig-1 단백질이 조절 T 세포에서만 특이적으로 발현되는지 확인하였다.
조절 T 세포 특이적인 전사 인자인 FOXP3 프로모터에 RFP(Red fluorescence protein)이 결합된 FOXP3-RFP 주입(Knock-in) 쥐를 이용하여, 상기 쥐의 비장으로부터 CD4 비드로 자석 활성 세포 분류기(magnet-activated cell sorting; MACS)를 이용하여 CD4+ T 세포를 분리하였다. 이후, RFP 단백질을 이용하여, 형광 활성 세포 분류기(FACS)를 통해 조절 T (CD4+RFP+ T) 세포 및 비 조절 T(CD4+RFP- T) 세포를 분리하여 얻었다. 각각의 상기 세포는 구입한 Lrig-1 항체 및 음성 대조군은 아이소타입(isotype)을 통해 염색하여 형광 활성 세포 분류기로 Lrig-1의 발현량을 측정하여, 그 결과를 도 7에 나타내었다.
도 7에서 보는 바와 같이, 점선으로 표시되는 비 조절 T 세포의 경우 음성 대조군과 거의 동일한 Lrig-1의 발현 수준을 보였지만, 조절 T 세포의 경우 Lrig-1의 발현 수준이 높은 세포가 다수 존재하였다.
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포에서 특이적으로 발현하는 것을 알 수 있다.
[실시예 4] 조절 T 세포 표면에서의 Lrig-1 단백질 특이적 발현 확인
Lrig-1 단백질이 세포 치료의 타겟이 되기 위해서는 조절 T 세포의 표면에 발현되어야 더욱 효과적으로 타겟 치료를 할 수 있으므로, Lrig-1 단백질이 표면에서의 발현 여부를 확인하였다.
상기 준비예 1의 각각의 분화된 T 세포 아형을 항-CD4-APC 및 항 Lrig-1-PE 항체로 염색하고, 형광 이용 세포 분류기(Fluorescence-Activated Cell Sorter; FACS)를 이용하여 각각의 세포 표면에서 Lrig-1의 발현량을 측정하여, 그 결과를 도 8에 나타내었다.
도 8에서 보는 바와 같이, 활성화된 T 세포(activated T cell), Th1 세포, Th2 세포, Th17 세포 및 나이브(Naive) T 세포에서는 Lrig-1의 발현이 0.77 내지 15.3의 양으로 발현되는 반면, 분화가 유도된 T 세포(iTreg)에서는 83.9로 높게 발현되었다.
상기 결과를 통해 본 발명에 따른 Lrig-1 단백질은 조절 T 세포(Treg) 세포에서 특이적으로 발현될 뿐만 아니라, 특히 조절 T 세포의 표면에서 더욱 높게 발현되는 것을 알 수 있다.
[제조예 1 내지 8] Lrig-1 단백질에 특이적인 단일클론항체의 제작
본 발명에 따른 Lrig-1 단백질에 특이적인 항체를 제작하였다. 본 항체는 특정 항원 결정기를 정하여 생산하지 않고, Lrig-1 단백질에 어느 부위든지 결합할 수 있는 항체를 생산하였다.
상기 항체를 제작하기 위하여 Lrig-1 단백질이 발현되는 세포를 제작하였다. 보다 상세하게는, 서열번호 2에 해당하는 DNA 단편 및 pcDNA(hygro)를 절단 효소로 절단한 뒤, 37℃에서 배양하여 라이게이션(Lrigation) 하여, Lrig-1 단백질의 DNA 서열이 삽입(insert) 되어 있는 pcDNA를 제작하였다. 상기 제작된 서열번호 2가 삽입된 pcDNA는 L세포에 형질주입(transfection)을 통해 도입되어 L 세포의 표면에 Lrig-1 단백질이 발현될 수 있도록 하였다.
상기 세포 표면에 발현되는 Lrig-1에 결합할 수 있는 경쇄(Lright chain) 및 중쇄(heavy chain) 아미노산의 서열을 Human scFv library에서 선별하여, 총 8개의 중쇄 및 경쇄를 선별하였다.
상기 선별된 중쇄 및 경쇄 아미노산 서열을 mlgG2a Fc 영역과 융합하여 단일클론항체(monoclonal antibody)를 제작하였다. 상기 단일클론항체의 서열은 하기 표 7과 같다.
| 구분 | 클론 | 위치 | 아미노산 서열 | 서열정보 |
| 제조예 1 | A7 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSGYDMSWVRQAPGKGLEWVSLIYPDSGNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDAGLSWAGAFDYWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 30 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVTWYQQLPGTAPKLLIYSDSHRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCGSWDYSLSAYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 31 | ||
| 제조예 2 | C8 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYYMSWVRQAPGKGLEWVSGISPGDSSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGLYSNPNEPFDYWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 32 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCTGSSSNIGSNYVSWYQQLPGTAPKLLIYDDSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLNGYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 33 | ||
| 제조예 3 | E7 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSGISPDGSNIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVGLRCRYEACSYAYGMDVWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 34 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYSDSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCATWDSSLNGYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 35 | ||
| 제조예 4 | G3 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYDMSWVRQAPGKGLEWVSSISPSSGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDLDAFWRPSFDYWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 36 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNNVNWYQQLPGTAPKLLIYSDSHRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGSWDDSLSAYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 37 | ||
| 제조예 5 | A8 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYDMSWVRQVPGKGLEWVSWISHGGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGLCKTGLCYYYDAMDVWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 38 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCTGSSSNIGNNSVTWYQQLPGTAPKLLIYADNNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAWDSSLSAYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 39 | ||
| 제조예 6 | B8 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGLEWVSGISHDSGSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHWTTFDYWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 40 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNNVTWYQQLPGTAPKLLIYANSNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGAWDYSLSAYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 41 | ||
| 제조예 7 | D9 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSAIYPGGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDILPCPWGRCYYDYAMDVWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 42 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCSDSSSNIGSNTVSWYQQLPGTAPKLLIYADNNRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 43 | ||
| 제조예 8 | H6 clone | 중쇄 | EVQLLESGGGLVQPGGSLRLSCAASGFTFSNYAMSWVRQAPGKGLEWVSVISHGGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARVISNCHLGVCYYSNGMDVWGQGTLVTVSSTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK | 서열번호 44 |
| 경쇄 | QSVLTQPPSASGTPGQRVTISCSGSSSNIGNNDVYWYQQLPGTAPKLLIYSDSQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCGTWDYSLSGYVFGGGTKLTVLRTVAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC | 서열번호 45 |
[실시예 5] 본 발명에 따른 항체의 Lrig-1 단백질에 대한 결합능 평가
상기 제조예 1 내지 8에서 제작된 본 발명에 따른 단일클론항체가 Lrig-1을 잘 인식하는 지를 확인하기 위하여, Lrig-1을 안정하게 발현하는 L 세포에 상기 제조예 1 내지 8의 항체 각각을 결합시킨 뒤 마우스 항체를 인식할 수 있으면서 eFlour 670이 컨쥬게이션(conjugation)된 2차 항체(secondary antibody)를 넣은 후 FACS를 이용하여 상기 단일클론항체의 Lrig-1 단백질에 대한 결합력을 분석하여 그 결과를 도 9에 나타내었다.
도 9에서 보는 바와 같이, 본 발명에 따른 Lrig-1 단백질 특이적인 단일클론항체(A7, A8, B8, C8, D9, E7, G3 및 H6) 모두 L 세포의 표면에 존재하는 Lrig-1 단백질을 효과적으로 인식하여 결합한 것을 확인할 수 있었다.
[실시예 6] 본 발명에 따른 항체의 조절 T 세포 내 신호전달경로의 조절
상기 제조예 1 내지 8에서 제작된 본 발명에 따른 단일클론항체가 Lrig-1 단백질을 통하여 조절 T 세포 내의 신호전달경로에 어떠한 영향을 미치는 지를 분석하기 위하여, 상기 제조예 1 내지 8의 항체를 조절 T 세포에 처리하여 상기 조절 T 세포의 표면에 존재하는 Lrig-1를 자극한 뒤, 포스포티로신 면역 블롯(phosphotyrosine immunoblot)을 통하여 자극받은 조절 T 세포 내에 존재하는 Stat3 단백질의 티로신 인산화(tyrosine phosphorylation) 정도를 분석하고, 그 결과를 도 10에 나타내었다.
도 10에서 보는 바와 같이, 본 발명에 따른 Lrig-1 단백질 특이적인 단일클론항체(A7, C8, E7 및 G3)는 Stat3의 인산화(phosphorylation)를 Th17 세포와 같은 수준으로 증가를 시키는 것을 확인할 수 있었다. 한편, 본 발명에 따른 Lrig-1 단백질 특이적인 단일클론항체(A8, B8, D9 및 H6)는 Stat3의 인산화(phosphorylation)를 iTreg 세포와 같은 수준으로 계속하여 유지 및 감소시키는 것을 확인할 수 있었다.
[실시예 7] A8, B8, D9 및 H6 항체의 암 치료 효과
상기 제조예 5 내지 8에서 제작된 본 발명에 따른 단일클론항체(A8, B8, D9 및 H6)의 고형암에 대한 치료 효과를 확인하기 위하여, 도 11에서 보는 바와 같이, B16F10 흑색종 세포(melanoma cell)를 마우스 등에 3X105 세포의 양으로 피하 주사(subcutaneous injection)한 뒤, 4일, 8일, 12일 째에 상기 제조예 5 내지 8의 항체를 200 ug의 양으로 복강 내 주사하였다. 상기 멜라노마 세포 이식 후 시간의 경과에 따른 종양의 부피 변화를 측정하여 그 결과를 도 12에 나타내었다.
도 12에서 보는 바와 같이, 본 발명에 따른 Lrig-1 단백질 특이적인 단일클론항체(A8, B8, D9 및 H6)를 처리한 경우 항체를 처리하지 않은 음성 대조군에 비하여 종양의 크기가 현저히 감소한 것을 확인할 수 있었다.
이를 통하여, 본 발명에 따른 Lrig-1 단백질 특이적인 단일클론항체는 다양한 고형암 세포의 성장을 억제하여, 이를 효과적으로 예방, 개선 또는 치료할 수 있는 것을 알 수 있다.
[실시예 8] 본 발명에 따른 Lrig-1 단백질의 에피토프 결정
조절 T 세포 표면에 존재하는 Lrig-1 단백질에서 각 LRR 도메인과 Ig-like 도메인에 존재하는 상기 제조예 8의 H6 항체의 결합 에피토프를 발굴하기 위하여 하기의 실험을 수행하였다.
1. 실험 준비
(1) 마이크로어레이
Lrig-1 단백질의 펩타이드 절단을 방지하기 위하여 상기 Lrig-1 단백질의 C- 및 N-터미널에 GSGSGSG 링커를 신장시켰다. 신장된 항원 서열은 14개 아미노산의 펩타이드-펩타이드 중복으로 인하여 15개 아미노산으로 번역되었다. 최종 LRIG1 펩타이드의 마이크로어레이 결과 1,091개의 상이한 펩타이드가 듀플리케이트(duplicate)로 확인되었고, 추가적인 HA (YPYDVPDYAG, 102 spots) 컨트롤 펩타이드에 의해 프레임(framed) 되었다.
(2) 실험 재료
시료: 제조예 8의 H6 단일클론항체
세척 버퍼: PBS, 0.05% Tween 20 (각 배양 후 10초 경과하였을 때, 3회)에 의한 pH 7.4
블러킹 버퍼(Blocking Buffer): Rockland 블러킹 버퍼 MB-070 (첫 어쎄이 30분 전)
배양 버퍼: 10% 블러킹 버퍼를 추가한 세척 버퍼
어쎄이 조건: 배양 버퍼 내 항체의 농도를 1 μg/ml, 10 μg/ml 및 100 μg/ml로 조절; 4℃에서 16 시간 동안 배양하고, 140 rpm으로 교반
2차 항체: 염소 항-인간 IgG (H+L) DyLight680 (0.2 μg/ml); 상온에서 배양 버퍼 내 45분간 염색
대조군 항체: 마우스 단일클론성 항-HA (12CA5) DyLight800 (0.5 μg/ml); 상온에서 배양 버퍼 내 45분간 염색
스캐너: LI-COR Odyssey Imaging System; 스캐닝 오프세트(scanning offset) 0.65 mm, 해상도 21 μm, 7/7 (red = 700 nm/green = 800 nm)의 스캐닝 강도
2. 실험 방법
메인 어쎄이에서 간섭을 일으킬 수 있는 항원-유래 펩타이드와 상호 작용을 일으킬 수 있는 지 확인하기 위하여, 배양 버퍼 내에서 2차 항체 및 대조군 항체를 사용해 LRIG1 펩타이드의 마이크로어레이 복제의 전-염색(pre-staining)을 수행하였다. 이후, 배양 버퍼 내에서 제조예 8의 H6 단일클론항체(1 μg/ml, 10 μg/ml 및 100 μg/ml)와 함께 다른 LRIG1 펩타이드의 마이크로어레이 복제의 추가적 배양을 수행한 뒤, 2차 항체 및 대조군 항체를 사용하여 염색하였다. LI-COR Odyssey Imaging System을 이용하여 7/7 (red/green)의 스캐닝 강도로 판독(read-out)을 수행하였다. 스팟 강도의 정량화 및 펩타이드 해독(peptide annotation)은 16-비트 회색 스케일 TIFF 파일로 나타내었다. PepSlide® Analyzer를 이용하여 마이크로어레이 이미지를 분석하였다. 그 결과는 도 13 내지 15에 나타내었고, 분석된 에피토프 서열은 하기 표 8에 나타내었다.
| 서열목록 | 서열정보 |
| 서열번호 18 | WTRSLNLSYNKL |
| 서열번호 19 | TEVRNTCFPHGPPI |
| 서열번호 20 | RLTQLDLNRNRIR |
| 서열번호 21 | DLNRNRIRLIEGLTF |
| 서열번호 22 | NSIARIHRKGW |
| 서열번호 23 | WLPPWLIGRMLQAF |
| 서열번호 24 | RQVTFGHEGRY |
| 서열번호 25 | FGHEGRYQCVITNHF |
| 서열번호 26 | RLTVNVLPSFTKTPH |
| 서열번호 27 | RRMHVMPDDDVFF |
| 서열번호 28 | FFITDVKIDDAGVYS |
| 서열번호 29 | KGDRPLSLTERHH |
3. 실험 결과
도 13 내지 15에서 보는 바와 같이, 조절 T 세포 상에 존재하는 Lrig-1 단백질에 특이적으로 결합하여 암을 효과적으로 치료하는 단일클론항체(H6)는, Lrig-1 단백질 중 서열번호 18 내지 29의 아미노산 서열로 표시되는 에피토프에 특이적으로 결합하여 상기의 기능을 발휘하는 것임을 확인할 수 있었다. 더욱이, 서열번호 18 및 20으로 표시되는 에피토프는 류신-풍부 단백질(leucine rich repeat)을 공통으로 하고 있으며, 구체적으로는 N-터미널로부터 5번째 아미노산 위치에 본 발명의 식 1의 아미노산 서열로 표시될 수 있는 공통된 서열(consensus sequence)을 포함하고 있음을 수 있었다.
이상에서 본 발명에 대하여 상세하게 설명하였지만 본 발명의 권리범위는 이에 한정되는 것은 아니고, 청구범위에 기재된 본 발명의 기술적 사상을 벗어나지 않는 범위 내에서 다양한 수정 및 변형이 가능하다는 것은 당 기술분야의 통상의 지식을 가진 자에게는 자명할 것이다.
Claims (18)
- 하기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 류신-풍부 반복 도메인(Leucine-rich repeat domain)의 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편:
[식 1]
Lx1Lx2x3N
상기 식 1에서,
x1 내지 x3는 각각 독립적으로 중성 아미노산, 산성 아미노산, 염기성 아미노산 또는 방향족 아미노산이다. - 제1항에 있어서,
상기 x1 내지 x3는 각각 독립적으로 아스파라긴(asparagine; N), 아스파트산(aspartic acid; D), 세린(serine; S), 티로신(tyrosine; Y), 아르기닌(arginine; R), 페닐알라닌(phenylalanine; F), 라이신(lysine, K), 히스티딘(histidine; H), 류신(leucine, L), 발린(valine, V), 트레오닌(threonine, T), 알라닌(alanine; A), 글루타민(glutamine; Q), 글루탐산(glutamic acid; E) 및 글리신(glycine; G)으로 이루어진 군에서 선택되는 아미노산인, 항체 또는 항원 결합 단편. - 제1항에 있어서,
상기 x1은 아스파라긴(asparagine; N), 페닐알라닌(phenylalanine; F), 아스파트산(aspartic acid; D), 라이신(lysine, K), 히스티딘(histidine; H), 발린(valine, V), 아르기닌(arginine; R) 및 트레오닌(threonine, T)으로 이루어진 군에서 선택되는 아미노산이고,
상기 x2는 세린(serine; S), 글루타민(glutamine; Q), 알라닌(alanine; A), 아스파라긴(asparagine; N), 글루탐산(glutamic acid; E), 아스파트산(aspartic acid; D), 페닐알라닌(phenylalanine; F) 및 글리신(glycine; G)으로 이루어진 군에서 선택되는 아미노산이며,
상기 x3는 티로신(tyrosine; Y), 히스티딘(histidine; H), 글리신(glycine; G), 아르기닌(arginine; R), 아스파라긴(asparagine; N), 류신(leucine, L), 라이신(lysine, K) 및 페닐알라닌(phenylalanine; F)으로 이루어진 군에서 선택되는 아미노산인, 항체 또는 항원 결합 단편. - 제1항에 있어서,
상기 에피토프는 10 내지 20 mer으로 이루어지는, 항체 또는 항원 결합 단편. - 제1항에 있어서,
상기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드는, 상기 에피토프의 N-터미널로부터 3 내지 6 번째에 위치하는, 항체 또는 항원 결합 단편. - 제1항에 있어서,
상기 폴리펩티드는 서열번호 4 내지 17 중 어느 하나의 아미노산 서열로 표시되는, 항체 또는 항원 결합 단편 - 서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 Lrig-1 단백질의 에피토프에 특이적으로 결합하는 항체 또는 항원 결합 단편.
- 류신-풍부 반복 도메인(Leucine-rich repeat domain)의 에피토프로서,
하기 식 1로 표시되는 아미노산 서열로 이루어지는 폴리펩티드를 포함하는 에피토프:
[식 1]
Lx1Lx2x3N
상기 식 1에서,
x1 내지 x3는 각각 독립적으로 중성 아미노산, 산성 아미노산, 염기성 아미노산 또는 방향족 아미노산이다. - 류신-풍부 반복 도메인(Leucine-rich repeat domain)의 에피토프로서,
서열번호 18 내지 29 중 어느 하나의 아미노산 서열로 표시되는 폴리펩티드를 포함하는, 에피토프. - 제9항의 에피토프를 코딩하는 핵산 분자.
- 제10항의 핵산 분자가 삽입된 발현 벡터.
- 제11항의 발현 벡터가 형질 감염된 숙주 세포주.
- 제1항 내지 제6항 중 어느 한 항의 항체 또는 항원 결합 단편을 유효 성분으로 포함하는 암의 예방 또는 치료용 약학 조성물.
- 제13항에 있어서,
상기 암은 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암인, 약학 조성물. - 제7항의 항체 또는 항원 결합 단편을 유효 성분으로 포함하는 암의 예방 또는 치료용 약학 조성물.
- 제15항에 있어서,
상기 암은 위암, 간암, 교세포종, 난소암, 대장암, 두경부암, 방광암, 신장세포암, 유방암, 전이암, 전립선암, 췌장암, 흑색종 또는 폐암인, 약학 조성물. - 제1항 내지 제6항 중 어느 한 항의 항체 또는 항원 결합 단편; 및 약물을 포함하는 항체-약물 결합체.
- 제7항의 항체 또는 항원 결합 단편; 및 약물을 포함하는 항체-약물 결합체.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020180053052 | 2018-05-09 | ||
| KR20180053052 | 2018-05-09 | ||
| KR1020210087732A KR20210087915A (ko) | 2018-05-09 | 2021-07-05 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020210087732A Division KR20210087915A (ko) | 2018-05-09 | 2021-07-05 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| KR20220142975A true KR20220142975A (ko) | 2022-10-24 |
| KR102652664B1 KR102652664B1 (ko) | 2024-04-02 |
Family
ID=68468070
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020190054510A KR102275514B1 (ko) | 2018-05-09 | 2019-05-09 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
| KR1020210087732A KR20210087915A (ko) | 2018-05-09 | 2021-07-05 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
| KR1020220127074A KR102652664B1 (ko) | 2018-05-09 | 2022-10-05 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Family Applications Before (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| KR1020190054510A KR102275514B1 (ko) | 2018-05-09 | 2019-05-09 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
| KR1020210087732A KR20210087915A (ko) | 2018-05-09 | 2021-07-05 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20210363244A1 (ko) |
| EP (1) | EP3798227A4 (ko) |
| JP (1) | JP7470987B2 (ko) |
| KR (3) | KR102275514B1 (ko) |
| CN (1) | CN112105629A (ko) |
| AU (1) | AU2019267050B2 (ko) |
| BR (1) | BR112020022655A2 (ko) |
| CA (1) | CA3098815A1 (ko) |
| WO (1) | WO2019216675A1 (ko) |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2019267050B2 (en) * | 2018-05-09 | 2024-09-12 | Good T Cells, Inc. | Epitope of regulatory T cell surface antigen and antibody specifically binding thereto |
| WO2020080853A1 (ko) * | 2018-10-17 | 2020-04-23 | 주식회사 굳티셀 | Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도 |
| CN118745217A (zh) * | 2024-02-29 | 2024-10-08 | 漯河医学高等专科学校 | Obscn新抗原表位肽及其在制备防治肿瘤的药物中的应用 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20120085593A (ko) * | 2011-01-24 | 2012-08-01 | 연세대학교 산학협력단 | 조절자 Ｔ 세포에 특이적으로 존재하는 새로운 표면단백질 Ｌｒｉｇ-1의 용도 |
| KR20180022761A (ko) * | 2018-02-26 | 2018-03-06 | 연세대학교 산학협력단 | 조절자 Ｔ 세포에 특이적으로 존재하는 새로운 표면단백질 Ｌｒｉｇ-1의 용도 |
| KR102275514B1 (ko) * | 2018-05-09 | 2021-07-09 | 주식회사 굳티셀 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5595756A (en) * | 1993-12-22 | 1997-01-21 | Inex Pharmaceuticals Corporation | Liposomal compositions for enhanced retention of bioactive agents |
| US20040170982A1 (en) * | 2003-02-14 | 2004-09-02 | Morris David W. | Novel therapeutic targets in cancer |
| US20100120055A1 (en) * | 2006-09-28 | 2010-05-13 | Cell Signaling Technology, Inc. | Tyrosine phosphorylation sites |
| CA2769406A1 (en) * | 2009-08-04 | 2011-02-10 | Biosystems International Sas | Lung cancer biomarkers |
| US9046520B2 (en) * | 2010-02-10 | 2015-06-02 | The United States of America, as represented by the Secretary of the Department of Health and Human Services, Centers for Disease Control and Prevention | Serologic correlates of protection against Bacillis anthracis infection |
| KR101398363B1 (ko) * | 2010-11-17 | 2014-05-22 | 추가이 세이야쿠 가부시키가이샤 | 혈액응고 제viii 인자의 기능을 대체하는 기능을 갖는 다중특이성 항원 결합 분자 |
| US8790651B2 (en) * | 2011-07-21 | 2014-07-29 | Zoetis Llc | Interleukin-31 monoclonal antibody |
| WO2013054320A1 (en) * | 2011-10-11 | 2013-04-18 | Tel Hashomer Medical Research Infrastructure And Services Ltd. | Antibodies to carcinoembryonic antigen-related cell adhesion molecule (ceacam) |
| KR101938699B1 (ko) * | 2012-07-23 | 2019-01-16 | 삼성전자주식회사 | Ｌｒｉｇ１의 항 ｃ―ｍｅｔ 항체 적용 대상 환자 선별을 위한 용도 |
| KR20180116924A (ko) * | 2017-04-18 | 2018-10-26 | 주식회사 굳티셀 | 면역 세포 표면 단백질의 항원 결정기인 폴리펩티드 |
| CN110945024B (zh) * | 2017-04-18 | 2023-05-12 | 古德T细胞有限公司 | Lrig-1蛋白特异性结合分子及其用途 |
| JP7084569B2 (ja) * | 2018-02-23 | 2022-06-15 | トゥルーバインディング，インコーポレイテッド | Ｖｉｓｔａ及びその結合パートナーの相互作用を遮断することによる癌治療 |
-
2019
- 2019-05-09 AU AU2019267050A patent/AU2019267050B2/en active Active
- 2019-05-09 KR KR1020190054510A patent/KR102275514B1/ko active IP Right Grant
- 2019-05-09 US US17/053,600 patent/US20210363244A1/en active Pending
- 2019-05-09 CN CN201980031179.8A patent/CN112105629A/zh active Pending
- 2019-05-09 EP EP19799159.9A patent/EP3798227A4/en active Pending
- 2019-05-09 CA CA3098815A patent/CA3098815A1/en active Pending
- 2019-05-09 JP JP2020561906A patent/JP7470987B2/ja active Active
- 2019-05-09 BR BR112020022655-6A patent/BR112020022655A2/pt unknown
- 2019-05-09 WO PCT/KR2019/005592 patent/WO2019216675A1/ko unknown
-
2021
- 2021-07-05 KR KR1020210087732A patent/KR20210087915A/ko not_active IP Right Cessation
-
2022
- 2022-10-05 KR KR1020220127074A patent/KR102652664B1/ko active IP Right Grant
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20120085593A (ko) * | 2011-01-24 | 2012-08-01 | 연세대학교 산학협력단 | 조절자 Ｔ 세포에 특이적으로 존재하는 새로운 표면단백질 Ｌｒｉｇ-1의 용도 |
| KR20180022761A (ko) * | 2018-02-26 | 2018-03-06 | 연세대학교 산학협력단 | 조절자 Ｔ 세포에 특이적으로 존재하는 새로운 표면단백질 Ｌｒｉｇ-1의 용도 |
| KR102275514B1 (ko) * | 2018-05-09 | 2021-07-09 | 주식회사 굳티셀 | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 |
Non-Patent Citations (6)
| Title |
|---|
| David Coe et al., ‘Depletion of regulatory T cells by anti-GITR mAb as a novel mechanism for cancer immunotherapy’, Cancer Immunol Immunother, Vol. 59, pp1367-1377, 2010.05.18.* * |
| Drew Pardoll, ‘T cells take aim at cancer’, PNAS, Vol. 99, No. 25, pp. 15840-15842, 2002.12.10.* * |
| Marc Beyer et al., ‘Regulatory T cells in cancer’, BLOOD, Vol. 108, No. 3, pp. 804-811, 2006.* * |
| S Nizar et al., ‘T-regulatory cell modulation: the future of cancer immunotherapy?’, British Journal of Cancer, Vol. 100, pp. 1697-1703, 2009.* * |
| Ulf Petrausch et al., ‘Cancer Immunotherapy: The Role Regulatory T cells Play and What can be Done to Overcome their Inhibitory Effects’, Curr Mol Med, Vol. 9, No. 6, pp. 673-682, 2009.* * |
| W Mansoor et al., ‘Engineering T cells for cancer therapy’, British Journal of Cancer, Vol. 93, pp. 1085-1091, 2005.* * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN112105629A (zh) | 2020-12-18 |
| KR102275514B1 (ko) | 2021-07-09 |
| KR20210087915A (ko) | 2021-07-13 |
| JP2021523703A (ja) | 2021-09-09 |
| KR102652664B1 (ko) | 2024-04-02 |
| WO2019216675A1 (ko) | 2019-11-14 |
| BR112020022655A2 (pt) | 2021-02-17 |
| AU2019267050B2 (en) | 2024-09-12 |
| AU2019267050A1 (en) | 2020-11-26 |
| JP7470987B2 (ja) | 2024-04-19 |
| CA3098815A1 (en) | 2019-11-14 |
| EP3798227A1 (en) | 2021-03-31 |
| KR20190129018A (ko) | 2019-11-19 |
| US20210363244A1 (en) | 2021-11-25 |
| EP3798227A4 (en) | 2022-03-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN110799539B (zh) | 抗4-1bb抗体及其制备和使用方法 | |
| KR102652664B1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
| KR102086656B1 (ko) | Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도 | |
| WO2019080872A1 (zh) | 阻断pd-1/pd-l1信号传导途径且活化t细胞的融合蛋白及其用途 | |
| EP4056586A1 (en) | Epitope of regulatory t cell surface antigen, and antibody specifically binding thereto | |
| EA010350B1 (ru) | Антитела против cd3 и способы их применения | |
| KR102302393B1 (ko) | Lrig-1 단백질에 특이적인 결합 분자 및 이의 용도 | |
| KR20210142638A (ko) | Cd3 항원 결합 단편 및 이의 응용 | |
| JP2017526676A (ja) | がんの処置のための併用療法 | |
| JP2022523710A (ja) | Ｃｄ４４に特異的な抗体 | |
| JP2022513008A (ja) | 融合タンパク質およびその使用 | |
| JP2021521817A (ja) | 新規な融合タンパク質およびこれを含む癌の予防または治療用薬学的組成物 | |
| JP2024502758A (ja) | Ｃｄ７３結合タンパク質及びその使用 | |
| EP3998284A1 (en) | Composition for preventing, ameliorating or treating immune checkpoint inhibitor-resistant cancer | |
| KR20230016148A (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
| JP2023546743A (ja) | 抗ｃｄ７３抗体及びその使用 | |
| US20240084026A1 (en) | Anti-4-1bb antibodies and methods of making and using thereof | |
| JP2020514273A (ja) | 白斑症の処置のための抗ヒトｃｘｃｒ３抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| A107 | Divisional application of patent | ||
| E902 | Notification of reason for refusal | ||
| AMND | Amendment | ||
| E601 | Decision to refuse application | ||
| AMND | Amendment | ||
| X701 | Decision to grant (after re-examination) | ||
| GRNT | Written decision to grant |