KR20170012592A - Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (pcsk9) - Google Patents

Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (pcsk9) Download PDF

Info

Publication number
KR20170012592A
KR20170012592A KR1020177002015A KR20177002015A KR20170012592A KR 20170012592 A KR20170012592 A KR 20170012592A KR 1020177002015 A KR1020177002015 A KR 1020177002015A KR 20177002015 A KR20177002015 A KR 20177002015A KR 20170012592 A KR20170012592 A KR 20170012592A
Authority
KR
South Korea
Prior art keywords
lt
gt
ser
gly
val
Prior art date
Application number
KR1020177002015A
Other languages
Korean (ko)
Inventor
사이먼 마크 잭슨
니겔 펠함 클린턴 워커
데렉 에반 파이퍼
베이 산
웨냔 센
조이스 치 이 찬
채드윅 테렌스 킹
란달 로버트 케쳄
크리스토퍼 메흘린
테레사 아라자스 카라베오
퀴옹 카오
Original Assignee
암젠 인크
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
Priority to US95766807P priority Critical
Priority to US60/957,668 priority
Priority to US896507P priority
Priority to US61/008,965 priority
Priority to US61/010,630 priority
Priority to US1063008P priority
Priority to US8613308P priority
Priority to US61/086,133 priority
Application filed by 암젠 인크 filed Critical 암젠 인크
Priority to PCT/US2008/074097 priority patent/WO2009026558A1/en
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=39951467&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=KR20170012592(A) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Publication of KR20170012592A publication Critical patent/KR20170012592A/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/21Esters, e.g. nitroglycerine, selenocyanates
    • A61K31/215Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
    • A61K31/22Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/335Heterocyclic compounds having oxygen as the only ring hetero atom, e.g. fungichromin
    • A61K31/365Lactones
    • A61K31/366Lactones having six-membered rings, e.g. delta-lactones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins
    • A61K31/40Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
    • A61K31/403Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil condensed with carbocyclic rings, e.g. carbazole
    • A61K31/404Indoles, e.g. pindolol
    • A61K31/405Indole-alkanecarboxylic acids; Derivatives thereof, e.g. tryptophan, indomethacin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/47Quinolines; Isoquinolines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine, rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/66Phosphorus compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1137Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL, OR TOILET PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2299/00Coordinates from 3D structures of peptides, e.g. proteins or enzymes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • C07K2317/14Specific host cells or culture conditions, e.g. components, pH or temperature
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Abstract

전구단백질 전환효소 섭틸리신 켁신 (Subtilisin Kexin) 타입 9 (PCSK9)와 상호작용하는 항원 결합 단백질을 설명한다. It describes a precursor protein converting enzyme Sup Shin Tilly keksin (Subtilisin Kexin) type 9 (PCSK9) with each other antigen-binding proteins that act. 제약상 유효량의 PCSK9에 대한 항원 결합 단백질을 투여함으로써 고콜레스테롤혈증 및 다른 질환을 치료하는 방법을 설명한다. It describes a method of treating hypercholesterolemia and other disease and by administering the antigen binding protein to PCSK9 in a pharmaceutically effective amount. PCSK9에 대한 항원 결합 단백질을 사용하여 샘플 내의 PCSK9의 양을 검출하는 방법을 설명한다. Using the antigen binding proteins of the PCSK9 will be described a method of detecting the amount of PCSK9 in a sample.

Description

전구단백질 전환효소 섭틸리신 켁신 타입 9 (PCSK9)에 대한 항원 결합 단백질 {ANTIGEN BINDING PROTEINS TO PROPROTEIN CONVERTASE SUBTILISIN KEXIN TYPE 9 (PCSK9)} Precursor protein-converting enzyme perturbation Tilly new antigen binding to keksin type 9 (PCSK9) proteins {ANTIGEN BINDING PROTEINS TO PROPROTEIN CONVERTASE SUBTILISIN KEXIN TYPE 9 (PCSK9)}

<관련 출원> <RELATED APPLICATIONS>

본원은 그 전문을 본원에 참조로 포함시킨, 2007년 8월 23일 출원된 미국 특허 가출원 60/957,668, 2007년 12월 21일 출원된 미국 특허 가출원 61/008,965 및 2008년 1월 9일 출원된 미국 특허 가출원 61/010,630을 기초로 한 우선권을 주장한다. The present application is filed January 9 days after including in their entirety herein by reference, August 2007 May 23, U.S. Provisional Patent Application 60/957 668, 12, 2007 May 21, it filed United States Patent Application Provisional Application 61/008 965 and 2008 claims priority to a US Provisional Patent Application based on the 61 / 010,630.

본 발명은 전구단백질 전환효소 섭틸리신 켁신 (subtilisin kexin) 타입 9 (PCSK9)에 결합하는 항원 결합 단백질, 및 항원 결합 단백질의 사용 및 제조 방법에 관한 것이다. The present invention relates to a precursor protein converted antigen-binding protein, and using the antigen binding proteins and method of combining the enzyme Sup Shin Tilly keksin (subtilisin kexin) type 9 (PCSK9).

전구단백질 전환효소 섭틸리신 켁신 타입 9 (PCSK9)는 저밀도 지단백질 수용체 (LDLR) 단백질의 수준을 조절하는데 관여하는 세린 프로테아제이다 ([Horton et al., 2007]; [Seidah and Prat, 2007]). Precursor protein-converting enzyme perturbation Tilly new keksin type 9 (PCSK9) is a serine protease which is involved in controlling the levels of low-density lipoprotein receptor (LDLR) protein ([Horton et al, 2007.]; [Seidah and Prat, 2007]). 시험관내 실험에서는 HepG2 세포에 PCSK9를 첨가하면 세포 표면 LDLR의 수준이 저하됨을 보여주었다 ([Benjannet et al., 2004]; [Lagace et al., 2006]; [Maxwell et al., 2005]; [Park et al., 2004]). In vitro addition of PCSK9 on HepG2 cells showed that the level of cell surface LDLR degraded ([Benjannet et al, 2004.]; [. Lagace et al, 2006]; [. Maxwell et al, 2005]; [ Park et al., 2004]). 마우스를 사용한 실험에서는 PCSK9 단백질 수준을 증가시키면 간에서 LDLR 단백질 수준을 감소시킨 반면 ([Benjannet et al., 2004]; [Lagace et al., 2006]; [Maxwell et al., 2005]; [Park et al., 2004]), PCSK9 녹-아웃 마우스는 간에서 LDLR 수준이 증가되었음을 보여주었다 (Rashid et al., 2005). In the experiments using the mouse, while reducing the LDLR protein levels in the liver by increasing the PCSK9 protein levels ([Benjannet et al, 2004.]; [. Lagace et al, 2006]; [. Maxwell et al, 2005]; [Park . et al, 2004]), PCSK9 knock-out mice have shown that the LDLR levels increased in the liver (Rashid et al, 2005).. 추가로, 증가된 또는 감소된 수준의 혈장 LDL을 일으키는 다양한 인간 PCSK9 돌연변이가 확인되었다 ([Kotowski et al., 2006]; [Zhao et al., 2006]). In addition, a variety of human PCSK9 mutations causing plasma LDL in an increased or decreased level was confirmed ([Kotowski et al, 2006.]; [. Zhao et al, 2006]). PCSK9는 LDLR 단백질과 직접 상호작용하고, LDLR과 함께 세포내 이입되고, 엔도좀 경로 전체에서 LDLR과 함께 동시-면역형광을 내는 것으로 나타났다 (Lagace et al., 2006). PCSK9 is LDLR protein and a direct interaction, and endocytosis with LDLR, concurrent with the LDLR throughout endosomes path was found that the immunofluorescence (Lagace et al, 2006.). PCSK9에 의한 LDLR의 분해는 관찰되지 않았고, 그를 통해 세포외 LDLR 단백질 수준을 저하시키는 메카니즘은 불확실하다. Degradation of the LDLR by PCSK9 has not been observed, is uncertain mechanism that lowered him through the LDLR protein levels outside the cells.

PCSK9는 세린 프로테아제의 섭틸리신 (S8) 패밀리 내의 프로호르몬-전구단백질 전환효소이다 (Seidah et al., 2003). PCSK9 is in the pro hormone interference Tilly new (S8) family of serine proteases-a precursor protein-converting enzyme (Seidah et al, 2003.). 인간은 S8A 및 S8B 하위패밀리 사이에 분류될 수 있는 9개의 프로호르몬-전구단백질 전환효소를 갖는다 (Rawlings et al., 2006). Humans Nine pro hormone classifiable between S8A and S8B Subfamily - has a bulb proteins converting enzyme (Rawlings et al, 2006.). 푸린 (furin), PC1/PC3, PC2, PACE4, PC4, PC5/PC6 및 PC7/PC8/LPC/SPC7은 하위패밀리 S8B 내에 분류된다. Purine (furin), PC1 / PC3, PC2, PACE4, PC4, PC5 / PC6 and PC7 / PC8 / LPC / SPC7 are classified into sub-families S8B. 마우스 푸린 및 PC1으로부터의 상이한 도메인의 결정 및 NMR 구조를 통해 섭틸리신-유사 프로-도메인 및 촉매 도메인, 및 촉매 도메인에 대한 직접적 C-말단의 P 도메인이 밝혀졌다 ([Henrich et al., 2003]; [Tangrea et al., 2002]). Mouse through the crystal and NMR structure of a different domain from the purine and PC1 interference Tilly Shin-like pro-domain and a catalytic domain, and a domain of P directly C- terminal to the catalytic domain has been found ([Henrich et al, 2003. ];. [Tangrea et al, 2002]). 상기 하위패밀리 내의 아미노산 서열 유사성에 기초하여, 7개의 모든 멤버는 유사한 구조를 갖는 것으로 예측된다 (Henrich et al., 2005). Based on amino acid sequence similarities in the sub-family, all the members 7 is predicted to have a similar structure (Henrich et al., 2005). SKI-1/S1P 및 PCSK9는 하위패밀리 S8A 내에 분류된다. SKI-1 / S1P and PCSK9 are classified into sub-families S8A. 이들 단백질을 사용한 서열 비교에서는 또한 섭틸리신-유사 프로-도메인 및 촉매 도메인의 존재를 제안한다 ([Sakai et al., 1998]; [Seidah et al., 2003]; [Seidah et al., 1999]). The sequence comparison with these proteins also interference Tilly Shin-like pro- suggests the existence of a domain and a catalytic domain ([Sakai et al, 1998.];. [. Seidah et al, 2003]; [Seidah et al, 1999 ). 이들 단백질에서, 촉매 도메인에 대해 C-말단의 아미노산 서열은 보다 가변적이고, P 도메인의 존재를 제안하지 않는다. In these proteins, the amino acid sequence of the C- terminal to the catalytic domain and is more variable, does not suggest the presence of the P domain.

프로호르몬-전구단백질 전환효소는 효소원 (zymogen)으로서 발현되고, 이들은 다중 단계 과정을 통해 성숙한다. Pro hormone-converting enzyme precursor protein is expressed as an enzyme source (zymogen), which is matured through the multi-step process. 상기 과정에서 프로-도메인의 기능은 이중이다. In the process of pro-domain is a function of the dual. 프로-도메인은 먼저 샤퍼론 (chaperone)으로서 작용하고, 촉매 도메인의 적합한 폴딩을 위해 요구된다 (Ikemura et al., 1987). Pro-domain first and then acts as a Shopper Ron (chaperone), it is required for proper folding of the catalytic domain (Ikemura et al, 1987.). 일단 촉매 도메인이 접히면, 프로-도메인과 촉매 도메인 사이에 자가 촉매 반응이 일어난다. Once the catalytic domain is in contact himyeon, pro- causing a self-catalytic reaction between a domain and the catalytic domain. 상기 초기 절단 반응 후에, 프로-도메인은 촉매 도메인에 결합된 상태로 남아, 여기서 촉매 활성의 억제제로서 작용한다 (Fu et al., 2000). The initial cut after the reaction, the pro-domain is still in a state of being coupled to a catalytic domain, where it acts as an inhibitor of the catalytic activity (Fu et al, 2000.). 조건이 정확하면, 성숙은 프로-도메인 내의 부위에서 제2 자가촉매 사건과 함께 진행된다 (Anderson et al., 1997). If the conditions are correct, mature pro - it is the second party proceeds with catalytic event in the region in the domain (Anderson et al, 1997.). 상기 제2 절단 사건이 일어난 후, 프로-도메인 및 촉매 도메인은 해리하여, 활성 프로테아제를 생성시킨다. After the second cutting events, pro-domain and the catalytic domain is dissociated, to produce the active protease.

PCSK9 효소원의 자가 촉매 반응은 Gln152 및 Ser153 (VFAQ|SIP) 사이에서 일어나고 (Naureckiene et al., 2003), 세포로부터 그의 분비를 위해 요구되는 것으로 나타났다 (Seidah et al., 2003). Autocatalytic reaction of PCSK9 enzyme source is Gln152 and Ser153 | taking place between (VFAQ SIP) (. Naureckiene et al, 2003), shown to be required for its secretion from the cells (Seidah et al, 2003.). PCSK9의 프로-도메인 내의 부위에서 제2 자가촉매 사건은 관찰되지 않았다. Of PCSK9 pro-second autocatalytic event at a site within the domain was observed. 정제된 PCSK9는 비-환원 SDS-PAGE에 의해 분리할 수 있는 다음과 같은 2개의 종으로 이루어진다; Purified PCSK9 is a non-made up of two species, such as the following, which can be separated by reducing SDS-PAGE; 17 Kd에서 프로-도메인, 및 65 Kd에서 촉매 도메인 + C-말단 도메인. In the 17 Kd pro-domain, and a catalytic domain + C- terminal domain in the 65 Kd. PCSK9는 그의 억제성 프로-도메인 없이 단리되지 않았고, PCSK9의 촉매 활성의 측정은 가변적이었다 ([Naureckiene et al., 2003]; [Seidah et al., 2003]). PCSK9 is their inhibitory pro-domain was not isolated without the measurement of the catalytic activity of PCSK9 was variable ([Naureckiene et al, 2003.]; [Seidah et al, 2003.]).

일부 실시태양에서, 본 발명은 PCSK9에 대한 항원 결합 단백질을 포함한다. In some embodiments, the invention includes antigen binding proteins for the PCSK9.

일부 측면에서, 본 발명은 A) (i) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 내의 CDRH1로부터의 CDRH1; In some aspects, the present invention is A) (i) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64 , 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 from the CDRH1 of CDRH1 in a sequence selected from the group consisting of; (ii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 내의 CDRH2로부터의 CDRH2; (Ii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 of CDRH2 from CDRH2 in the sequence selected from the group consisting of; (iii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 내의 CDRH3으로부터의 CDRH3; (Iii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 60, and CDRH3 from the CDRH3 in the sequence selected from the group consisting of; 및 (iv) 4개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRH로 이루어지는 군 중에서 선택되는 하나 이상의 중쇄 상보성 결정 구역 (CDRH); And (iv) (i) containing at least one amino acid substitution, deletion or insertion of an amino acid of four or less, (ii), and at least one heavy chain complementarity is selected from the group consisting of CDRH of (iii) determining section (CDRH) .; B) (i) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL1로부터의 CDRL1; B) (i) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 in the sequence CDRL1 from CDRL1 selected from the group consisting of; (ii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL2로부터의 CDRL2; (Ii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 in CDRL2 from the CDRL2 sequence selected from the group consisting of; (iii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL3으로부터의 CDRL3; (Iii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, from 39, 40, 42, 44, 46, and CDRL3 in a sequence selected from the group consisting of CDRL3; 및 (iv) 4개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRL로 이루어지는 군 중에서 선택되는 하나 이상의 경쇄 상보성 결정 구역 (CDRL); And (iv) (i) containing at least one amino acid substitution, deletion or insertion of an amino acid of four or less, (ii), and at least one light chain complementarity is selected from the group consisting of a CDRL of (iii) determining section (CDRL) .; 또는 C) A)의 하나 이상의 중쇄 CDRH 및 B)의 하나 이상의 경쇄 CDRL을 포함하는, PCSK9에 결합하는 단리된 항원 결합 단백질을 포함한다. Or it comprises C) A) at least one heavy chain CDRH and the isolated antigen binding protein which, binding to PCSK9 including at least one light chain CDRL of B) of. 일부 실시태양에서, 단리된 항원 결합 단백질은 A)의 적어도 하나의 CDRH 및 B)의 적어도 하나의 CDRL을 포함한다. And in some embodiments, the isolated antigen binding protein comprises at least one CDRL of at least one CDRH and B) in A). 일부 실시태양에서, 단리된 항원 결합 단백질은 A)의 적어도 2개의 CDRH 및 B)의 적어도 2개의 CDRL을 포함한다. And in some embodiments, the isolated antigen binding protein comprises at least two of the at least two CDRL CDRH and B) in A). 일부 실시태양에서, 단리된 항원 결합 단백질은 상기 CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 및 CDRL3을 포함한다. In some embodiments, the isolated antigen binding protein comprises the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and CDRL3. 일부 실시태양에서, A)의 CDRH는 (i) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH1로부터 선택된 CDRH1 아미노산 서열; In some embodiments, A) of the CDRH are CDRH1 amino acid sequence selected from CDRH1 in a sequence selected from the group consisting of (i) SEQ ID NO: 67, 79, 89, and 49; (ii) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH2로부터 선택된 CDRH2 아미노산 서열; (Ii) CDRH2 amino acid sequence selected from within SEQ ID NO: CDRH2 selected from the group consisting of SEQ ID NO: 67, 79, 89, and 49; (iii) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH3으로부터 선택된 CDRH3 아미노산 서열; (Iii) CDRH3 amino acid sequence selected from SEQ ID NO: 67, 79, 89, and CDRH3 in the sequence selected from the group consisting of 49; 및 (iv) 2개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRH로 이루어지는 군 중의 적어도 하나로부터 선택된다. And (iv) is selected from at least one of the group consisting of CDRH 2 (i), (ii) containing at least one amino acid substitution, deletion or insertion of amino acids or fewer, and (iii). 또한, B)의 CDRL은 (i) 서열 12, 35, 32, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL1로부터 선택된 CDRL1 아미노산 서열; Also, CDRL1 amino acid sequence selected from CDRL1 in a sequence selected from the group consisting of a CDRL of (i) SEQ ID NO: 12, 35, 32, and 23 of B); (ii) 서열 12, 35, 32, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL2로부터 선택된 CDRL2 아미노산 서열; (Ii) CDRL2 amino acid sequence selected from within SEQ ID NO: CDRL2 selected from the group consisting of SEQ ID NO: 12, 35, 32, and 23; (iii) 서열 12, 35, 32, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL3으로부터 선택된 CDRL3 아미노산 서열; (Iii) CDRL3 amino acid sequence selected from SEQ ID NO: 12, 35, 32, 23, and CDRL3 in a sequence selected from the group consisting of; 및 (iv) 2개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRL; And (iv) the 2 (i), (ii) containing at least one amino acid substitution, deletion or insertion of amino acids or fewer, and (iii) CDRL; 또는 C) A)의 하나 이상의 중쇄 CDRH 및 B)의 하나 이상의 경쇄 CDRL로 이루어지는 군 중의 적어도 하나로부터 선택된다. Or at least one selected from the group consisting of at least one light chain CDRL of C) A) at least one heavy chain CDRH and B) of the. 일부 실시태양에서, A)의 CDRH는 (i) 서열 67 내의 CDRH1 아미노산 서열의 CDRH1 아미노산 서열; In some embodiments, A) of the CDRH are CDRH1 amino acid sequence of a CDRH1 amino acid sequence in (i) SEQ ID NO: 67; (ii) 서열 67 내의 CDRH2 아미노산 서열의 CDRH2 아미노산 서열; (Ii) CDRH2 amino acid sequence of the CDRH2 amino acid sequence in SEQ ID NO: 67; (iii) 서열 67 내의 CDRH3 아미노산 서열의 CDRH3 아미노산 서열; (Iii) CDRH3 amino acid sequence of CDRH3 amino acid sequence in SEQ ID NO: 67; 및 (iv) 2개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRH로 이루어지는 군 중의 적어도 하나로부터 선택되고; And (iv) is selected from at least one of the group consisting of CDRH 2 of one or more amino acid substitutions, deletions or insertions which contains (i), (ii), and (iii) the amino acid sequence of one or less; 상기 B)의 CDRL은 (i) 서열 12 내의 CDRL1 아미노산 서열의 CDRL1 아미노산 서열; CDRL1 amino acid sequence of a CDRL1 amino acid sequence in a CDRL of said B) is (i) SEQ ID NO: 12; (ii) 서열 12 내의 CDRL2 아미노산 서열의 CDRL2 아미노산 서열; (Ii) CDRL2 amino acid sequence of CDRL2 amino acid sequence in SEQ ID NO: 12; (iii) 서열 12 내의 CDRL3 아미노산 서열의 CDRL3 아미노산 서열; (Iii) CDRL3 amino acid sequence of CDRL3 amino acid sequence in SEQ ID NO: 12; 및 (iv) 2개 이하의 아미노산의 하나 이상의 아미노산 치환, 결실 또는 삽입을 함유하는 (i), (ii), 및 (iii)의 CDRL; And (iv) the 2 (i), (ii) containing at least one amino acid substitution, deletion or insertion of amino acids or fewer, and (iii) CDRL; 또는 C) A)의 하나 이상의 중쇄 CDRH 및 B)의 하나 이상의 경쇄 CDRL로 이루어지는 군 중의 적어도 하나로부터 선택된다. Or at least one selected from the group consisting of at least one light chain CDRL of C) A) at least one heavy chain CDRH and B) of the. 일부 실시태양에서, 항원 결합 단백질은 A) 서열 67 내의 CDRH1 서열의 CDRH1, 서열 67 내의 CDRH2 서열의 CDRH2, 및 서열 67 내의 CDRH3 서열의 CDRH3, 및 B) 서열 12 내의 CDRL1 서열의 CDRL1, 서열 12 내의 CDRL2 서열의 CDRL2, 및 서열 12 내의 CDRL3 서열의 CDRL3을 포함한다. In some embodiments, the antigen binding protein is in the A) SEQ ID NO: 67 in the CDRH1 CDRH1 of the sequence, sequence CDRH2 of the CDRH2 sequences in 67, and SEQ ID NO: CDRH3 of the CDRH3 sequences in the 67, and B) sequence CDRL1, sequence CDRL1 sequence in 12 of 12 It includes a CDRL2, and a CDRL3 of SEQ ID NO: CDRL3 SEQ ID NO: 12 in the sequence of CDRL2. 일부 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 아미노산 서열과 적어도 80%의 서열 동일성을 갖는 중쇄 가변 구역 (VH), 및/또는 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 아미노산 서열과 적어도 80%의 서열 동일성을 갖는 경쇄 가변 구역 (VL)을 포함한다. In some embodiments, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, heavy chain variable regions (VH), and / or sequences having 89, 65, 79, 80, 76, 77, 78, 83, 69, a sequence identity of 81, and at least 80% amino acid sequence selected from the group consisting of 60 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38 and 39, and the light chain comprises a light chain variable regions (VL) having a sequence identity of 40, 42, 44, and at least 80% amino acid sequence selected from the group consisting of 46. 일부 실시태양에서, VH는 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 아미노산 서열과 적어도 90%의 서열 동일성을 갖고/갖거나, VL은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 아미노산 서열과 적어도 90%의 서열 동일성을 갖는다. In some embodiments, VH is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and having at least sequence identity of 90% with the amino acid sequence selected from the group consisting of 60 / have or, VL is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 at least has a sequence identity of 90% with the amino acid sequence selected from the group consisting of. 일부 실시태양에서, VH는 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되고/되거나, VL은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택된다. In some embodiments, VH is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 selected from the group consisting of and / or, VL is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, is selected from the group consisting of 44, and 46 .

일부 측면에서, 본 발명은 본원에 개시된 임의의 ABP가 결합하는 에피토프에 특이적으로 결합하는 단리된 항원 결합 단백질을 포함한다. In some aspects, the present invention includes the isolated antigen binding protein that specifically binds to an epitope that binds any ABP disclosed herein.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 상기 항원 결합 단백질은 A) (i) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH1에 적어도 80%의 서열 동일성을 갖는 CDRH1; In some aspects, the present invention includes the isolated antigen binding protein binding to PCSK9, and wherein the antigen binding protein A) (i) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53 sequence is selected from, the group consisting of 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 CDRH1 of the one in the CDRH1 having a sequence identity of at least 80%; (ii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH2에 적어도 80%의 서열 동일성을 갖는 CDRH2; (Ii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 CDRH2 having a sequence identity of at least 80% in one or in a CDRH2 of SEQ ID NO selected from the group consisting of; 및 (iii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH3에 적어도 80%의 서열 동일성을 갖는 CDRH3으로 이루어지는 군 중의 적어도 하나로부터 선택되는 하나 이상의 중쇄 CDR (CDRH); And (iii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79 , at least 80, 76, 77, 78, 83, 69, 81, and 60 one in the CDRH3 of SEQ ID NO selected from the group consisting of one selected from at least one of the group consisting of a CDRH3 having a sequence identity of at least 80% of the heavy chain CDR (CDRH); B) (i) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL1에 적어도 80%의 서열 동일성을 갖는 CDRL1; B) (i) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and CDRL1 having a sequence identity of at least 80% to 46 one within CDRL1 of the sequence selected from the group consisting of; (ii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL2에 적어도 80%의 서열 동일성을 갖는 CDRL2; (Ii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and CDRL2 having a sequence identity of at least 80% to 46 in a CDRL2 of SEQ ID NO selected from the group consisting of; 및 (iii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL3에 적어도 80%의 서열 동일성을 갖는 CDRL3으로 이루어지는 군 중의 적어도 하나로부터 선택되는 하나 이상의 경쇄 CDR (CDRL); And (iii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35 , at least 36, 37, 38, 39, 40, 42, 44, and 46 one in the CDRL3 of SEQ ID NO selected from the group consisting of one selected from at least one of the group consisting of a CDRL3 having a sequence identity of at least 80% of the light chain CDR (CDRL); 또는 C) A)의 하나 이상의 중쇄 CDRH 및 B)의 하나 이상의 경쇄 CDRL을 포함한다. Or it comprises C) A) one or more of the at least one light chain CDRL of the heavy chain CDRH and B) of the. 일부 실시태양에서, 항원 결합 단백질은 A) (i) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH1에 적어도 90%의 서열 동일성을 갖는 CDRH1; In some embodiments, the antigen binding protein A) (i) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91 , 64, CDRH1 having a sequence identity of at least 90% to 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and one in the CDRH1 of the sequence selected from the group consisting of 60; (ii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH2에 적어도 90%의 서열 동일성을 갖는 CDRH2; (Ii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and CDRH2 having a sequence identity of at least 90% to 60 in one of the CDRH2 sequence selected from the group consisting of; 및 (iii) 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRH3에 적어도 90%의 서열 동일성을 갖는 CDRH3으로 이루어지는 군 중의 적어도 하나로부터 선택되는 하나 이상의 CDRH; And (iii) SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79 , 80, 76, 77, 78, 83, 69, 81, and one or more of the 60 one in the CDRH3 of SEQ ID NO selected from the group consisting of is selected from at least one of the group consisting of a CDRH3 having a sequence identity of at least 90% CDRH .; B) (i) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL1에 적어도 90%의 서열 동일성을 갖는 CDRL1; B) (i) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, CDRL1 with at least 90% sequence identity of the 44, 46 and one within CDRL1 of the sequence selected from the group consisting of; (ii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL2에 적어도 90%의 서열 동일성을 갖는 CDRL2; (Ii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, CDRL2 having a sequence identity, at least 90% of the 44, 46 and one in the CDRL2 of SEQ ID NO selected from the group consisting of; 및 (iii) 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46으로 이루어지는 군 중에서 선택되는 서열 중 하나 내의 CDRL3에 적어도 90%의 서열 동일성을 갖는 CDRL3으로 이루어지는 군 중의 적어도 하나로부터 선택되는 하나 이상의 CDRL; And (iii) SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35 , 36, 37, 38, 39, 40, 42, 44, and one or more being 46 to select, from at least one of the group consisting of CDRL3 having a sequence identity of at least 90% in one or in the CDRL3 of SEQ ID NO selected from the group consisting of CDRL .; 또는 C) A)의 하나 이상의 중쇄 CDRH 및 B)의 하나 이상의 경쇄 CDRL을 포함한다. Or it comprises C) A) one or more of the at least one light chain CDRL of the heavy chain CDRH and B) of the.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 상기 항원 결합 단백질은 A) (i) 서열 67, 79, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH3으로부터 선택되는 CDRH3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH3과 상이한 CDRH3; In some aspects, the invention is CDRH3 which include the isolated antigen binding protein binding to PCSK9, and said antigen binding protein is selected from A) (i) SEQ ID NO: 67, 79, and CDRH3 in the sequence selected from the group consisting of 49 , (ii) a CDRH3 amino acid sequence (i) by a second amino acid addition, deletion or substitution of amino acids of more or less different from the CDRH3; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 (서열 404) (여기서, X 1 은 D, A, R 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 Y, I, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 3 은 D, A, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 4 는 F, A, L 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 5 는 W, L, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 6 은 S, Y, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 7 은 A, Y, R 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 8 은 Y, P 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 9 는 Y, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 10 은 D, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 11 은 A, M 및 아미노산 부재로 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 ( SEQ ID NO: 404) (wherein, X 1 is D, A, R and amino acid member is selected from the group consisting of, X 2 is Y, I, G and selected from the group consisting of the amino acid member is, X 3 is selected from the group consisting of D, a, G and the amino acid member, X 4 is F, a, is selected from the group consisting of L and the amino acid member, X 5 is W, L, a, and the amino acid is selected from the group consisting of members, X 6 is selected from the group consisting of S, Y, a, and the amino acid member, X 7 is is selected from the group consisting of a, Y, R and the amino acid member, X 8 is selected from the group consisting of Y, P, and the amino acid member, X 9 is selected from the group consisting of Y, G and amino acid member, X 10 is D, is selected from the group consisting of G and the amino acid member, X 11 is as a, M and amino acid member 루어지는 군 중에서 선택되고, X 12 는 F, D 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 13 은 D, V 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 14 는 V 및 아미노산 부재로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH); From selected from the group, and that the lure X 12 is selected from the group consisting of F, D and amino acid member, X 13 is a group consisting of D, is selected from the group consisting of V and amino acid member, X 14 is V and the amino acid member selected) heavy chain complementarity determining section (CDRH) selected from at least one of the group consisting of; B) (i) 서열 12, 35, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL3으로부터 선택되는 CDRL3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL3과 상이한 CDRL3; B) (i) SEQ ID NO: CDRL3, (ii) the amino acid sequence (i) by a second amino acid addition, deletion or substitution of amino acids or fewer are selected from 12, 35, and 23 CDRL3 in a sequence selected from the group consisting of CDRL3 different CDRL3; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 (서열 405) (여기서, X 1 은 Q 및 G로 이루어지는 군 중에서 선택되고, X 2 는 S, T, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 3 은 Y, W 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 4 는 D 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 5 는 S 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 6 은 S 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 7 은 L, T 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 8 은 아미노산 부재, A, 및 S로 이루어지는 군 중에서 선택되고, X 9 는 아미노산 부재, G, A, 및 V로 이루어지는 군 중에서 선택되고, X 10 은 아미노산 부재, S, Y, 및 V로 이루어지는 군 중에서 선택되고, X 11 은 아미노산 부재 및 V로 이루어지는 군 중에서 선택됨)로 이루어지 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 ( SEQ ID NO: 405) (wherein, X 1 is selected from the group consisting of Q and G, X 2 is S , T, a and selected from the group consisting of the amino acid member is, X 3 is selected from the group consisting of Y, W, and the amino acid member, X 4 is selected from the group consisting of D and an amino acid member, X 5 is S and amino acid is selected from the group consisting of members, X 6 is selected from the group consisting of S and amino acid member, X 7 is selected from the group consisting of L, T and amino acid member, X 8 is consisting of the amino acid member, a, and S is selected from the group, X 9 is an amino acid member, G, a, and is selected from the group consisting of V, X 10 is selected from the group consisting of the amino acid member, S, Y, or V, X 11 is an amino acid member, and the V It is done in selected from the group) consisting of 군으로부터 선택되는 CDRL3 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. Comprising a CDRL3 amino acid sequence selected from the group comprises a light chain complementarity determining section (CDRL) selected from at least one of the groups.

일부 측면에서, 본 발명은 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 및 그의 일부 조합으로 이루어지는 군 중에서 선택되는 아미노산 서열을 갖는 경쇄를 포함하는 단리된 항원 결합 단백질을 포함한다. In some aspects, the invention is 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 , it includes the isolated antigen binding protein comprises a light chain comprising the amino acid sequence selected from the group consisting of 35, 36, 37, 38, 39, 40, 42, 44, 46, and a portion thereof in combination.

일부 실시태양에서, 항원 결합 단백질은 적어도 하나의 본원에 개시된 항원 결합 단백질이 결합하는 에피토프에 특이적으로 결합한다. In some embodiments, the antigen binding protein specifically binds to an epitope of the antigen binding proteins described herein to at least one bond. 일부 실시태양에서, 단리된 항원 결합 단백질은 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 60, 및 그의 일부 조합으로 이루어지는 군 중에서 선택되는 아미노산 서열을 갖는 중쇄를 추가로 포함한다. In some embodiments, the isolated antigen binding protein 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62 , further it comprises a heavy chain comprising the amino acid sequence selected from the group consisting of 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 60, and a portion thereof in combination. 일부 실시태양에서, ABP의 아미노산 서열은 서열 12, 35, 23, 및 그의 일부 조합으로 이루어지는 군 중에서 선택된다. In some embodiments, the amino acid sequence of ABP is selected from the group consisting of SEQ ID NO: 12, 35, 23, and a portion thereof in combination. 일부 실시태양에서, ABP의 중쇄는 서열 67의 CDRH3, 서열 67의 CDRH2, 및 서열 67의 CDRH1을 포함하고, 상기 경쇄는 서열 12의 CDRL3, 서열 12의 CDRL2, 및 서열 12의 CDRL1을 포함한다. In some embodiments, be of ABP heavy chain comprises a CDRH1 of SEQ ID NO: 67 CDRH3, SEQ ID NO: 67 of CDRH2, and SEQ ID NO: 67, wherein the light chain comprises a CDRL1 of SEQ ID NO: 12 for CDRL3, SEQ ID NO: 12 for CDRL2, and SEQ ID NO: 12. 일부 실시태양에서, 단리된 항원 결합 단백질은 모노클로날 항체, 폴리클로날 항체, 재조합 항체, 인간 항체, 인간화 항체, 키메라 항체, 다중특이적 항체, 또는 그의 항체 단편이다. In some embodiments, the isolated antigen binding protein is a monoclonal antibody, polyclonal antibody, recombinant antibody, a human antibody, a humanized antibody, a chimeric antibody, a multi-specific antibody, or a antibody fragment. 일부 실시태양에서, 단리된 항원 결합 단백질은 Fab 단편, Fab' 단편, F(ab') 2 단편, Fv 단편, 디아바디 (diabody), 또는 단일쇄 항체 분자이다. In some embodiments, the isolated antigen binding protein is a Fab fragment, Fab 'fragment, F (ab') 2 fragments, Fv fragments, Dia body (diabody), or single-chain antibody molecules. 일부 실시태양에서, 단리된 항원 결합 단백질은 인간 항체이다. In some embodiments, the isolated antigen binding protein is a human antibody. 일부 실시태양에서, 단리된 항원 결합 단백질은 모노클로날 항체이다. In some embodiments, the isolated antigen binding protein is a monoclonal antibody. 일부 실시태양에서, 단리된 항원 결합 단백질은 IgG1-, IgG2-, IgG3- 또는 IgG4-형의 것이다. In some embodiments, the isolated antigen binding protein is of the type IgG1-, IgG2-, IgG3- or IgG4-. 일부 실시태양에서, 단리된 항원 결합 단백질은 IgG4- 또는 IgG2-형의 것이다. In some embodiments, the isolated antigen binding protein is of the type IgG4- or IgG2-. 일부 실시태양에서, 단리된 항원 결합 단백질은 표지기에 커플링된다. In some embodiments, the isolated antigen binding protein is coupled to pyojigi. 일부 실시태양에서, 단리된 항원 결합 단백질은 PCSK9에 결합하기 위해 본원에 설명되는 항원 결합 단백질과 경쟁한다. In some embodiments, the isolated antigen binding protein competes with the antigen binding protein described herein to bind to PCSK9. 일부 실시태양에서, 단리된 항원 결합 단백질은 모노클로날 항체, 폴리클로날 항체, 재조합 항체, 인간 항체, 인간화 항체, 키메라 항체, 다중특이적 항체, 또는 그의 항체 단편이다. In some embodiments, the isolated antigen binding protein is a monoclonal antibody, polyclonal antibody, recombinant antibody, a human antibody, a humanized antibody, a chimeric antibody, a multi-specific antibody, or a antibody fragment. 일부 실시태양에서, 단리된 항원 결합 단백질은 Fab 단편, Fab' 단편, F(ab') 2 단편, Fv 단편, 디아바디, 또는 단일쇄 항체 분자이다. In some embodiments, the isolated antigen binding protein is a Fab fragment, Fab 'fragment, F (ab') 2 fragments, Fv fragments, dia body, or single chain antibody molecule. 일부 실시태양에서, 단리된 항원 결합 단백질은 표지기에 커플링된다. In some embodiments, the isolated antigen binding protein is coupled to pyojigi. 일부 실시태양에서, 단리된 항원 결합 단백질은 LDLR에 대한 PCSK9의 결합을 감소시킨다. In some embodiments, the isolated antigen binding protein reduces the binding of PCSK9 on LDLR. 일부 실시태양에서, 단리된 항원 결합 단백질은 대상에게 투여될 때 대상 내에 존재하는 LDL의 양을 감소시킨다. In some embodiments, the isolated antigen binding protein reduces the amount of LDL present in a subject when administered to a subject. 일부 실시태양에서, 단리된 항원 결합 단백질은 대상에게 투여될 때 대상 내에 존재하는 혈청 콜레스테롤의 양을 감소시킨다. In some embodiments, the isolated antigen binding protein when administered to a subject to reduce the amount of serum cholesterol present in the subject. 일부 실시태양에서, 단리된 항원 결합 단백질은 대상에게 투여될 때 대상 내에 존재하는 LDLR의 양을 증가시킨다. In some embodiments, the isolated antigen binding protein increases the amount of LDLR present in the subject when administered to a subject.

일부 측면에서, 본 발명은 본원에 설명되는 핵산 분자를 포함하는 벡터를 포함한다. In some aspects, the invention includes a vector comprising a nucleic acid molecule described herein. 일부 실시태양에서, 본 발명은 본원에 설명되는 핵산 분자를 포함하는 숙주 세포를 포함한다. In some embodiments, the invention includes a host cell comprising a nucleic acid molecule described herein.

일부 측면에서, 본 발명은 PCSK9에 대한 결합에 대해 본원에 개시된 항원 결합 단백질과 경쟁하는 단리된 항원 결합 단백질을 포함한다. In some aspects, the present invention includes the isolated antigen binding protein for binding to PCSK9 competition with the antigen binding proteins disclosed herein.

일부 측면에서, 본 발명은 본원에 개시된 항원 결합 단백질을 코딩하는 핵산 분자를 포함한다. In some aspects, the invention includes a nucleic acid molecule encoding the antigen binding protein described herein.

일부 측면에서, 본 발명은 적어도 하나의 본원에서 설명되는 항원 결합 단백질을 포함하는 제약 조성물을 포함한다. In some aspects, the invention includes a pharmaceutical composition comprising the antigen binding proteins described herein, at least one.

일부 측면에서, 본 발명은 그를 필요로 하는 환자에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 투여하는 것을 포함하는, 환자에서 상승된 혈청 콜레스테롤 수준과 연관된 병태를 치료 또는 예방하는 방법을 포함한다. In some aspects, the method of this invention for treating or preventing a condition associated with elevated serum cholesterol levels in a patient comprising administering to the isolated antigen binding protein to a patient him require disclosed in at least one of the present application of an effective amount of It includes.

일부 측면에서, 본 발명은 유효량의 적어도 하나의 본원에 개시된 항원 결합 단백질을 투여하는 것을 포함하는, 대상에서 LDLR에 대한 PCSK9의 결합을 억제하는 방법을 포함한다. In some aspects, the invention involves a method of inhibiting the binding of PCSK9 on, LDLR in a subject comprising administering at least one antigen binding protein as described herein in an effective amount.

일부 측면에서, 본 발명은 PCSK9에 선택적으로 결합하는 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 100 pM보다 작은 K d 로 PCSK9에 결합한다. In some aspects, the invention comprises an antigen binding protein to selectively bind to PCSK9, wherein the antigen binding protein is coupled to a PCSK9 with K d less than 100 pM.

일부 측면에서, 본 발명은 그를 필요로 하는 대상에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여하는 것을 포함하는, 대상에서 상승된 혈청 콜레스테롤 수준과 연관된 병태를 치료 또는 예방하는 방법을 포함한다. In some aspects, the present invention increases in the isolated antigen binding protein at the same time as substances that increase the utilization of the LDLR protein, or that a subject him require disclosed in at least one of the present application of an effective amount which comprises sequential administration, the subject that includes a method for treating or preventing a condition associated with serum cholesterol levels.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 투여하는 것을 포함하는, 대상에서 혈청 콜레스테롤 수준을 저하시키는 방법을 포함한다. In some aspects, the invention involves a method of lowering the serum cholesterol levels in comprising administering the isolated antigen binding protein disclosed herein to at least one of an effective amount to a subject, subject.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여하는 것을 포함하는, 대상에서 혈청 콜레스테롤 수준을 저하시키는 방법을 포함한다. In some aspects, the present invention is lowering the serum cholesterol levels in comprising administering the isolated antigen binding proteins that are disclosed in at least one of the present application of an effective amount to a subject a substance and at the same time or sequentially to increase the utilization of the LDLR protein, the target It includes a method of.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 투여하는 것을 포함하는, 대상에서 LDLR 단백질 수준을 증가시키는 방법을 포함한다. In some aspects, the invention includes a method of increasing the LDLR protein levels in a subject comprising administering to the isolated antigen binding protein disclosed herein to at least one of an effective amount to a subject.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여하는 것을 포함하는, 대상에서 LDLR 단백질 수준을 증가시키는 방법을 포함한다. In some aspects, the present invention is increased, LDLR protein levels in a subject comprising administering to the isolated antigen binding proteins that are disclosed in at least one of the present application of an effective amount to a subject a substance and at the same time or sequentially to increase the utilization of the LDLR protein It includes a method of.

일부 측면에서, 본 발명은 본원에 개시된 ABP, 및 LDLR 단백질의 이용률을 증가시키는 물질을 포함하는 제약 조성물을 포함한다. In some aspects, the invention includes a pharmaceutical composition comprising a substance that increases the utilization of the ABP, and LDLR protein disclosed herein. 일부 실시태양에서, LDLR 단백질의 이용률을 증가시키는 물질은 스타틴을 포함한다. In some embodiments, the substance that increases the utilization of the LDLR protein comprises a statin. 일부 실시태양에서, 스타틴은 아토르바스타틴, 세리바스타틴, 플루바스타틴, 로바스타틴, 메바스타틴, 피타바스타틴, 프라바스타틴, 로수바스타틴, 심바스타틴, 및 이들의 몇몇 조합으로 이루어지는 군 중에서 선택된다. In some embodiments, the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, rosuvastatin pravastatin, simvastatin, and some combination thereof.

일부 측면에서, 본 발명은 상기 항원 결합 단백질을 분비하는 숙주 세포로부터 상기 항원 결합 단백질을 제조하는 단계를 포함하는, 본원에서 설명되는 항원 결합 단백질의 제조 방법을 포함한다. In some aspects, the invention includes a method for preparing antigen-binding proteins described, the present comprises the step of producing the antigen-binding protein from a host cell that secretes said antigen binding protein.

일부 측면에서, 본 발명은 적어도 하나의 본원에서 설명되는 항원 결합 단백질, 및 제약상 허용되는 부형제를 포함하는 제약 조성물을 포함한다. In some aspects, the invention includes a pharmaceutical composition comprising an excipient which is acceptable antigen-binding protein, and a pharmaceutically described in at least one of the present application. 일부 실시태양에서, 제약 조성물은 추가의 활성 물질을 추가로 포함한다. In some embodiments, the pharmaceutical composition further comprises as an additional active substance. 일부 실시태양에서, 상기 추가의 활성 물질은 방사선 동위원소, 방사선 핵종, 독소, 또는 치료 및 화학치료군으로 이루어지는 군 중에서 선택된다. In some embodiments, the active material of the further is selected from the group consisting of radioisotope, radionuclide, toxin, or therapeutic treatment, and chemical treatment.

일부 측면에서, 본 발명은 환자에서 상승된 혈청 콜레스테롤 수준과 연관된 병태를 치료 또는 예방하는 방법을 포함한다. In some aspects, the invention includes a method for treating or preventing a condition associated with an elevated serum cholesterol level in a patient. 상기 방법은 그를 필요로 하는 환자에게 유효량의 적어도 하나의 본원에 개시되는 단리된 항원 결합 단백질을 투여하는 것을 포함한다. The method comprises administering to the isolated antigen binding protein to a patient requiring him disclosed herein to at least one of an effective amount. 일부 실시태양에서, 병태는 고콜레스테롤혈증이다. In some embodiments, the condition is a high-cholesterol.

일부 측면에서, 본 발명은 유효량의 적어도 하나의 본원에서 설명되는 항원 결합 단백질을 투여하는 것을 포함하는, 환자에서 LDLR에 대한 PCSK9의 결합을 억제하는 방법을 포함한다. In some aspects, the invention involves a method of inhibiting the binding of PCSK9 on LDLR in the patient comprising administering at least one of the antigen binding proteins described herein in an effective amount.

일부 측면에서, 본 발명은 100 pM보다 작은 K d 로 PCSK9에 결합하는 항원 결합 단백질을 포함한다. In some aspects, the present invention will be less than the K d of 100 pM includes antigen binding proteins that bind to PCSK9. 일부 실시태양에서, 항원 결합 단백질은 10 pM보다 작은 K d 로 결합한다. In some embodiments, the antigen binding protein binds to the K d less than 10 pM. 일부 실시태양에서, 항원 결합 단백질은 5 pM보다 작은 K d 로 결합한다. In some embodiments, the antigen binding protein binds to the K d less than 5 pM.

일부 측면에서, 본 발명은 그를 필요로 하는 대상에게 유효량의 적어도 하나의 본원에 설명되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여하는 것을 포함하는, 대상에서 상승된 혈청 콜레스테롤 수준과 연관된 병태를 치료 또는 예방하는 방법을 포함한다. In some aspects, the present invention increases in the isolated antigen binding protein at the same time as substances that increase the utilization of the LDLR protein, or to a subject that he needs to be described in at least one of the present application of an effective amount which comprises sequential administration, the subject that includes a method for treating or preventing a condition associated with serum cholesterol levels. 일부 실시태양에서, LDLR 단백질의 이용률을 증가시키는 물질은 스타틴을 포함한다. In some embodiments, the substance that increases the utilization of the LDLR protein comprises a statin. 일부 실시태양에서, 스타틴은 아토르바스타틴, 세리바스타틴, 플루바스타틴, 로바스타틴, 메바스타틴, 피타바스타틴, 프라바스타틴, 로수바스타틴, 심바스타틴, 및 이들의 몇몇 조합으로 이루어지는 군 중에서 선택된다. In some embodiments, the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, rosuvastatin pravastatin, simvastatin, and some combination thereof.

일부 측면에서, 본 발명은 대상에서 혈청 콜레스테롤 수준을 저하시키는 방법을 포함한다. In some aspects, the invention involves a method of lowering the serum cholesterol level in a subject. 상기 방법은 대상에게 유효량의 적어도 하나의 본원에서 설명되는 단리된 항원 결합 단백질을 투여하는 것을 포함한다. The method comprises administering to the isolated antigen binding protein described herein, at least one of an effective amount to a subject.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 설명되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여하는 것을 포함하는, 대상에서 혈청 콜레스테롤 수준을 저하시키는 방법을 포함한다. In some aspects, the present invention is lowering the serum cholesterol levels in comprising administering the isolated antigen binding protein described in at least one of the present application of an effective amount to a subject a substance and at the same time or sequentially to increase the utilization of the LDLR protein, the target It includes a method of. 일부 실시태양에서, LDLR 단백질의 이용률을 증가시키는 물질은 스타틴을 포함한다. In some embodiments, the substance that increases the utilization of the LDLR protein comprises a statin. 일부 실시태양에서, 스타틴은 아토르바스타틴, 세리바스타틴, 플루바스타틴, 로바스타틴, 메바스타틴, 피타바스타틴, 프라바스타틴, 로수바스타틴, 심바스타틴, 및 이들의 몇몇 조합으로 이루어지는 군 중에서 선택된다. In some embodiments, the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, rosuvastatin pravastatin, simvastatin, and some combination thereof.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에서 제공되는 단리된 항원 결합 단백질을 투여함으로써, 대상에서 LDLR 단백질 수준을 증가시키는 방법을 포함한다. In some aspects, the present invention is by administration of the isolated antigen binding protein provided herein in at least one of an effective amount to a subject, and includes a method for increasing the LDLR protein levels in the subject.

일부 측면에서, 본 발명은 대상에게 유효량의 적어도 하나의 본원에 설명되는 단리된 항원 결합 단백질을 LDLR 단백질의 이용률을 증가시키는 물질과 동시에 또는 순차적으로 투여함으로써, 대상에서 LDLR 단백질 수준을 증가시키는 방법을 포함한다. In some aspects, the method of the invention increase the antigen binding protein, the LDLR protein levels in a, by administering the substances simultaneously or sequentially to increase the utilization of the LDLR protein, the target is isolated as described in at least one of the present application of an effective amount to a subject It includes. 일부 실시태양에서, LDLR 단백질 수준의 이용률을 증가시키는 물질은 스타틴을 포함한다. In some embodiments, the substance that increases the utilization of the LDLR protein levels include statins. 일부 실시태양에서, 스타틴은 아토르바스타틴, 세리바스타틴, 플루바스타틴, 로바스타틴, 메바스타틴, 피타바스타틴, 프라바스타틴, 로수바스타틴, 심바스타틴, 및 이들의 몇몇 조합으로 이루어지는 군 중에서 선택된다. In some embodiments, the statin is selected from the group consisting of atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, rosuvastatin pravastatin, simvastatin, and some combination thereof.

일부 측면에서, 본 발명은 PCSK9에 결합하고, 저밀도 지단백질 수용체 (LDLR)에 대한 PCSK9의 LDLR 저하 효과를 감소시키는 중화 항체를 포함한다. In some aspects, the invention comprises a neutralizing antibody for binding to PCSK9, and reduce the LDLR-lowering effect of PCSK9 on low density lipoprotein receptor (LDLR). 일부 실시태양에서, 항체는 PCSK9에 특이적으로 결합한다. In some embodiments, the antibody binds specifically to PCSK9. 일부 실시태양에서, 항체는 PCSK9의 촉매 도메인에 결합한다. In some embodiments, the antibody binds to the catalytic domain of PCSK9. 일부 실시태양에서, 항체는 서열 3의 잔기 31-447 내의 에피토프에 결합한다. In some embodiments, the antibody binds to an epitope within residues 31-447 of SEQ ID NO: 3. 일부 실시태양에서, 항체는 서열 3에 적어도 90% 동일한 아미노산 서열을 갖는 PCSK9에 결합한다. In some embodiments, the antibody binds to PCSK9 having at least 90% identical to the amino acid sequence SEQ ID NO: 3.

일부 측면에서, 본 발명은 PCSK9에 결합하는 중화 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 서열 3의 잔기 31-447 내의 위치에서 PCSK9에 결합한다. In some aspects, the invention comprises a neutralizing antigen binding proteins, in which an antigen binding protein that bind to PCSK9 binds to PCSK9 at positions within SEQ ID NO: 3 residues 31-447. 일부 실시태양에서, 항원 결합 단백질이 PCSK9에 결합될 때, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, In some embodiments, when the antigen binding protein is coupled to PCSK9, an antibody is located at less than 8 angstroms, from at least one of the following residues of the PCSK9: S153, I154, P155, R194, D238, A239, I369, S372, D374 , C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150 , A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374 , V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288 , A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194 , E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239 , G244, M247, I369, S372, C375, 또는 C378. S372, C375, or C378. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, 또는 Q382. In some embodiments, the antibody is located at less than 8 angstroms, from at least one of the following residues of the PCSK9: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380 , S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, or Q382. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 5 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, 또는 S381. In some embodiments, the antibody is located at less than 5 angstroms, from at least one of the following residues of the PCSK9: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380 or S381. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 2개로부터 5 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, 또는 S381. In some embodiments, the antibody is located at less than 5 angstroms, from at least two of the following residues of the PCSK9 dog: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, or S381. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 4개로부터 5 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, 또는 S381. In some embodiments, the antibody is located at less than 5 angstroms from at least four of the following residues of the PCSK9: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, or S381. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, 또는 Q387. In some embodiments, the antibody is located at less than 8 angstroms, from at least one of the following residues of the PCSK9: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255 , Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187 , E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372 , S373, C378, F379, T385, S386, or Q387. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 5 옹스트롬 이하에 위치한다: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, 또는 G384. In some embodiments, the antibody is located at less than 5 angstroms, from at least one of the following residues of the PCSK9: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255 , Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, or G384. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 2개로부터 5 옹스트롬 이하에 위치한다: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, 또는 G384. In some embodiments, the antibody is located at less than 5 angstroms, from at least two of the following residues of the PCSK9 dog: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, or G384. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 4개로부터 5 옹스트롬 이하에 위치한다: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, 또는 G384. In some embodiments, the antibody is located at less than 5 angstroms from at least four of the following residues of the PCSK9: W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, or G384. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, S372, C375, 또는 C378. In some embodiments, the antibody is located at less than 8 angstroms, from at least one of the following residues of the PCSK9: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238 , K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, S372, C375, or C378. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 5 옹스트롬 이하에 위치한다: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, 또는 F379. In some embodiments, the antibody is located at less than 5 angstroms, from at least one of the following residues of the PCSK9: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238 , K243, S373, D374, S376, T377, or F379. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 2개로부터 5 옹스트롬 이하에 위치한다: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, 또는 F379. In some embodiments, the antibody is located at less than 5 angstroms, from at least two of the following residues of the PCSK9 dog: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, or F379. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 4개로부터 5 옹스트롬 이하에 위치한다: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, 또는 F379. In some embodiments, the antibody is located at less than 5 angstroms from at least four of the following residues of the PCSK9: S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, or F379.

일부 측면에서, 본 발명은 PCSK9에 결합하여 PCSK9가 LDLR에 결합할 가능성을 감소시키는, PCSK9에 결합하는 중화 항체를 포함한다. In some aspects, the invention comprises a neutralizing antibody which binds to bind to PCSK9 PCSK9 which reduces the likelihood of binding to LDLR, PCSK9.

일부 실시태양에서, PCSK9에 결합하는 항체 또는 항원 결합 분자가 고려된다. In some embodiments, the antibody or antigen-binding molecules that bind to PCSK9 is considered. 항체는 서열 3의 잔기 31-447 내의 위치에서 PCSK9에 결합한다. Antibody binds to PCSK9 at the position in the sequence of residues 331-447. 일부 실시태양에서, 항체 또는 항원 결합 분자는 PCSK9에 결합될 때 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, In some embodiments, the antibody or antigen-binding molecule is located when joined to PCSK9 by at least one of the following residues of PCSK9 in less than 8 angstroms: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, S372, C375, 또는 C378. S372, C375, or C378.

일부 실시태양에서, 항체가 PCSK9의 잔기의 8 옹스트롬 이내에서 PCSK9에 결합하는 것을 차단하는 단리된 항체 또는 항원 결합 분자를 제공한다. In some embodiments, there is provided an isolated antibody or antigen-binding molecule to the antibody blocks binding to PCSK9 at less than 8 angstroms of residues of PCSK9. 일부 실시태양에서, PCSK9의 잔기는 다음의 PCSK9 잔기 중 적어도 하나로부터 선택된다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, S372, C375, 또는 C378. In some embodiments, the residues of PCSK9 is selected from at least one of the following PCSK9 residues of: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, Q382, W72, F150, A151, Q152, T214, R215, F216, H217, A220, S221, K222, S225, H226, C255, Q256, G257, K258, N317, F318, T347, L348, G349, T350, L351, E366, D367, D374, V380, S381, Q382, S383, G384, K69, D70, P71, S148, V149, D186, T187, E211, D212, G213, R218, Q219, C223, D224, G227, H229, L253, N254, G259, P288, A290, G291, G316, R319, Y325, V346, G352, T353, G365, I368, I369, S372, S373, C378, F379, T385, S386, Q387, S153, S188, I189, Q190, S191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, S373, D374, S376, T377, F379, I154, T187, H193, E195, I196, M201, V202, C223, T228, S235, G236, A239, G244, M247, I369, S372, C375, or C378 .

일부 실시태양에서, LDLR이 PCSK9에 결합하는 위치와 겹치는 위치에서 PCSK9에 결합하는 단리된 항체 또는 항원 결합 분자를 제공한다. In some embodiments, there is provided an isolated antibody or antigen binding molecule that binds to LDLR PCSK9 at a position that overlaps with the position which binds to PCSK9. 일부 실시태양에서, LDLR이 PCSK9에 결합하는 위치는 S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, 및 S381로 이루어지는 군 중에서 선택되는 적어도 하나의 아미노산 잔기를 포함한다. In some embodiments, LDLR this position to bind to PCSK9 is at least selected from the group consisting of S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, and S381 It includes a single amino acid residue.

일부 실시태양에서, PCSK9에 결합하는 단리된 항체 또는 항원 결합 분자를 제공한다. In some embodiments, there is provided an isolated antibody or antigen-binding molecules that bind to PCSK9. 일부 실시태양에서, 항체 또는 항원 결합 분자는 EGFa가 PCSK9 상의 다음의 잔기 중 적어도 하나의 8 옹스트롬 이내에서 PCSK9에 결합할 가능성을 감소시킨다: S153, I154, P155, R194, D238, A239, I369, S372, D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, 또는 Q382. In some embodiments, the antibody or antigen-binding molecules to reduce the likelihood of EGFa binding to PCSK9 at: least one of less than 8 angstroms from a residue of on PCSK9: S153, I154, P155, R194, D238, A239, I369, S372 , D374, C375, T377, C378, F379, V380, S381, W156, N157, L158, E159, H193, E195, H229, R237, G240, K243, D367, I368, G370, A371, S373, S376, or Q382.

일부 실시태양에서, EGFa가 결합하고/하거나 Ab 21B12가 결합하고/하거나 31H4가 결합하는 표면과 겹치는 PCSK9의 표면에 결합하는 항체, 항원 결합 단백질, 또는 항원 결합 분자를 제공한다. In some embodiments, the EGFa binding and / or Ab 21B12 is bonded and / or to provide an antibody, antigen-binding proteins, or antigen-binding molecules that bind to the surface of the overlapping surfaces that PCSK9 and 31H4 binding. 일부 실시태양에서, 도면에 도시된 것과 유사한 방식으로 PCSK9에 결합하는 항체, 항원 결합 단백질, 또는 항원 결합 분자를 제공한다. In some embodiments, binding to a PCSK9 as in the similar manner shown in the Figure antibodies, provides an antigen-binding proteins, or antigen-binding molecule.

일부 실시태양에서, 상기 실시태양은 중화 항체 또는 항원 결합 단백질이다. In some embodiments, the embodiment is a neutralizing antibody or antigen-binding protein. 일부 실시태양에서, 항원 결합 단백질은 LDLR 또는 그의 단편 (예를 들어 EGFa)이 아니다. In some embodiments, the antigen binding protein is not the LDLR or fragment thereof (e.g. EGFa).

일부 측면에서, 본 발명은 단리된 중화 항체를 제공하고, 여기서 항체가 PCSK9에 결합할 때, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 8 옹스트롬 이하에 위치한다: 서열 3의 T468, R469, M470, A471, T472, R496, R499, E501, A502, Q503, R510, H512, F515, P540, P541, A542, E543, H565, W566, E567, V568, E569, R592, E593, S465, G466, P467, A473, I474, R476, G497, E498, M500, G504, K506, L507, V508, A511, N513, A514, G516, V536, T538, A539, A544, T548, D570, L571, H591, A594, S595, 및 H597. In some aspects, the invention provides an isolated neutralizing antibody, wherein when the antibody to bind to PCSK9, an antibody is located at less than 8 angstroms, from at least one of the following residues of the PCSK9: of the Sequence 3 T468, R469, M470 , A471, T472, R496, R499, E501, A502, Q503, R510, H512, F515, P540, P541, A542, E543, H565, W566, E567, V568, E569, R592, E593, S465, G466, P467, A473 , I474, R476, G497, E498, M500, G504, K506, L507, V508, A511, N513, A514, G516, V536, T538, A539, ​​A544, T548, D570, L571, H591, A594, S595, and H597. 일부 실시태양에서, 항체는 PCSK9의 다음의 잔기 중 적어도 하나로부터 5 옹스트롬 이하에 위치한다: 서열 3의 T468, R469, M470, A471, T472, R496, R499, E501, A502, Q503, R510, H512, F515, P540, P541, A542, E543, H565, W566, E567, V568, E569, R592, 및 E593. In some embodiments, the antibody is located at less than 5 angstroms, from at least one of the following residues of the PCSK9: of the Sequence 3 T468, R469, M470, A471, T472, R496, R499, E501, A502, Q503, R510, H512, F515, P540, P541, A542, E543, H565, W566, E567, V568, E569, R592, and E593.

일부 측면에서, 본 발명은 단리된 항원 결합 단백질을 포함한다. In some aspects, the present invention includes the isolated antigen binding protein. 항원 결합 단백질은 A) 서열 89 내의 CDRH1 서열의 CDRH1, 서열 89 내의 CDRH2 서열의 CDRH2, 및 서열 89 내의 CDRH3 서열의 CDRH3, 및 B) 서열 32 내의 CDRL1 서열의 CDRL1, 서열 32 내의 CDRL2 서열의 CDRL2, 및 서열 32 내의 CDRL3 서열의 CDRL3 서열을 포함한다. Antigen-binding protein A) SEQ ID NO: CDRL2 of CDRH1 sequence CDRH1, CDRH2 of the CDRH2 sequences in SEQ ID NO: 89, and SEQ ID NO: CDRH3 of the CDRH3 sequences in the 89, and B) CDRL1 of CDRL1 sequence in SEQ ID NO: 32, CDRL2 sequence in SEQ ID NO: 32 in a 89, and a CDRL3 of SEQ ID NO: CDRL3 SEQ ID NO: 32 in the sequence.

일부 측면에서, 본 발명은 서열 1의 PCSK9 단백질에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 상기 단리된 항원 결합 단백질과 변이체 PCSK9 단백질 사이의 결합은 단리된 항원 결합 단백질과 서열 1 및/또는 서열 303의 PCSK9 단백질 사이의 결합의 50% 미만이다. In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9 protein of SEQ ID NO: 1, wherein the bond between the the isolated antigen binding protein and the mutant PCSK9 protein is an isolated antigen binding protein and SEQ ID NO: 1 and / or is less than 50% of the bond between the protein of SEQ ID NO: 303 PCSK9. 일부 실시태양에서, 변이체 PCSK9 단백질은 서열 1에 제시된 바와 같이 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554로 이루어지거나 그를 포함하는 군 중에서 선택되는 위치에 잔기의 적어도 하나의 돌연변이를 포함한다. In some embodiments, the mutant PCSK9 protein is 207 as shown in SEQ ID NO: 1, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129 and the location is selected from the group that made or containing them 311, 313, 337, 519, 521, and 554 includes at least one mutation of the residues. 일부 실시태양에서, 적어도 하나의 돌연변이는 R207E, D208R, E181R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, 및 E582R을 포함하거나 그로 이루어지는 군 중에서 선택된다. In some embodiments, the at least one mutation comprises a R207E, D208R, E181R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, and E582R, or selected from the group consisting of thereof. 일부 실시태양에서, 적어도 하나의 돌연변이는 D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, 및 Q554R로 이루어지는 군 중에서 선택된다. In some embodiments, the at least one mutation is selected from the group consisting of D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and Q554R.

일부 측면에서, 본 발명은 제1 방식으로 서열 303의 PCSK9 단백질에 결합하고 제2 방식으로 PCSK9의 변이체에 결합하는 항원 결합 단백질을 포함한다. In some aspects, the present invention coupled to a protein of SEQ ID NO: 303 PCSK9 in a first manner and comprises an antigen-binding proteins that bind to variants of PCSK9 in a second manner. PCSK9 변이체는 서열 303 및/또는 서열 1의 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554를 포함하거나 그로 이루어지는 군 중에서 선택되는 위치에서 적어도 하나의 점 돌연변이를 갖는다. PCSK9 variants sequence 303 and / or SEQ ID NO: 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313 , 337, 519, 521, and 554 include or have at least one point mutation at a position selected from the group consisting of thereof. 일부 실시태양에서, 제1 방식은 제1 EC50, 제1 Bmax, 또는 제1 EC50과 제1 Bmax를 포함한다. In some embodiments, the first manner comprises a first EC50, first Bmax, or the first and EC50 first Bmax. 일부 실시태양에서, 제2 방식은 제2 EC50, 제2 Bmax, 또는 제2 EC50과 제2 Bmax를 포함한다. In some embodiments, the second system includes a second EC50, Bmax second, or second and EC50 second Bmax. 제1 방식에 대한 값은 제2 방식에 대한 값과 상이하다. Value for the first manner is different from the value for the second scheme. 일부 실시태양에서, 제1 방식은 제1 EC50을 포함하고, 제2 방식은 제2 EC50을 포함하고, 점 돌연변이는 R207E, D208R, E181R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, 및 E582R로 이루어지거나 그를 포함하는 군 중에서 선택된다. In some embodiments, the first method claim including 1 EC50, and the second method is the second EC50 include, and point mutations R207E, D208R, E181R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, It comprises a A390R, A413R, and E582R or is selected from the group comprising them. 일부 실시태양에서, 제1 EC50은 제2 EC50과 적어도 20% 상이하다. In some embodiments, the EC50 of claim 1 is different from at least 20% and a 2 EC50. 일부 실시태양에서, 제1 EC50은 제2 EC50과 적어도 50% 상이하다. In some embodiments, the EC50 of claim 1 is different from at least 50% and a 2 EC50. 일부 실시태양에서, 제2 EC50은 제1 EC50보다 더 큰 수치값이다. In some embodiments, the EC50 of claim 2 is a larger value than the EC50 of claim 1. 일부 실시태양에서, 제1 EC50은 다중 비드 (bead) 결합 분석에 의해 결정된다. In some embodiments, the EC50 of claim 1 is determined by a binding assay multiple beads (bead). 일부 실시태양에서, 제2 EC50은 1 ㎛보다 더 크다. In some embodiments, the 2 EC50 is greater than 1 ㎛. 일부 실시태양에서, 항원 결합 단백질은 중화 항원 결합 단백질이다. In some embodiments, the antigen binding protein is a neutralizing antigen binding proteins. 일부 실시태양에서, 중화 항원 결합 단백질은 경쟁적 중화 항원 결합 단백질이다. In some embodiments, the neutralized antigen binding protein is a competitive neutralizing antigen binding proteins. 일부 실시태양에서, 중화 항원 결합 단백질은 비-경쟁적 중화 항원 결합 단백질이다. In some embodiments, neutralizing antigen binding proteins are non-competitive neutralizing antigen binding proteins. 일부 실시태양에서, 제1 방식은 제1 Bmax를 포함하고, 제2 방식은 제1 Bmax와 상이한 제2 Bmax를 포함한다. In some embodiments, the first scheme, comprising: a first Bmax second scheme comprises a first and a different second Bmax Bmax. PCSK9 변이체는 D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, 및 Q554R로 이루어지거나 그를 포함하는 군 중에서 선택되는 적어도 하나의 점 돌연변이를 갖는다. PCSK9 variants have at least one point mutation is selected from the group that made or containing them as D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and Q554R. 일부 실시태양에서, 제2 Bmax는 제1 Bmax의 약 10%이다. In some embodiments, the 2 Bmax is about 10% of Bmax of claim 1. 일부 실시태양에서, 제1 Bmax는 제2 Bmax와 적어도 20% 상이하다. In some embodiments, the Bmax 1 is different from at least 20% and a 2 Bmax. 일부 실시태양에서, 제1 Bmax는 제2 Bmax와 적어도 50% 상이하다. In some embodiments, the Bmax 1 is different from at least 50% and a 2 Bmax.

일부 측면에서, 본 발명은 서열 3의 PCSK9 단백질에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질의 에피토프는 서열 1의 다음의 아미노산 중 적어도 하나를 포함한다: 207, 208, 181, 185, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554. In some aspects, the invention is an epitope including the isolated antigen binding protein, wherein the antigen binding proteins that bind to PCSK9 protein of SEQ ID NO: 3 comprises at least one of the following amino acids of SEQ ID NO: 207, 208, 181, 185, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and 554.

일부 측면에서, 본 발명은 서열 1의 아미노산 서열을 포함하는 PCSK9 단백질에 결합하는 단리된 중화 항원 결합 단백질을 포함하고, 여기서 중화 항원 결합 단백질은 LDLR에 대한 PCSK9의 LDLR 저하 효과를 감소시킨다. In some aspects, the present invention includes an isolated neutralizing antigen binding proteins that bind to PCSK9 protein comprising the amino acid sequence of SEQ ID NO: 1, wherein the neutralizing antigen binding proteins reduce the LDLR-lowering effect of PCSK9 on LDLR. 일부 실시태양에서, 항원 결합 단백질은 LDLR 비-경쟁적 중화 항원 결합 단백질이다. In some embodiments, the antigen binding protein LDLR non-competitive neutralizing antigen binding proteins. 일부 실시태양에서, 항원 결합 단백질은 LDLR 경쟁적 중화 항원 결합 단백질이다. In some embodiments, the antigen binding protein is an LDLR-competitive neutralizing antigen binding proteins.

일부 측면에서, 본 발명은 단리된 항원 결합 단백질을 포함하고, 상기 항원 결합 단백질은 A) 서열 49 내의 CDRH1 서열의 CDRH1, 서열 49 내의 CDRH2 서열의 CDRH2, 및 서열 49 내의 CDRH3 서열의 CDRH3, 및 B) 서열 23 내의 CDRL1 서열의 CDRL1, 서열 23 내의 CDRL2 서열의 CDRL2 서열, 및 서열 23 내의 CDRL3 서열의 CDRL3을 포함한다. In some aspects, the present invention was isolated with an antigen-binding protein, wherein the antigen binding protein A) SEQ ID NO: CDRH3 of the CDRH3 sequences in CDRH2, and SEQ ID NO: 49 CDRH1, CDRH2 sequences in SEQ ID NO: 49 CDRH1 sequence within 49, and B ) a CDRL1 of SEQ ID NO: 23 in the sequence CDRL1, CDRL2 of SEQ ID NO: CDRL2 SEQ ID NO: 23 in the sequence, and a CDRL3 of the CDRL3 sequences in SEQ ID NO: 23.

일부 측면에서, 본 발명은 결정화된 PCSK9 단백질, 및 PCSK9에 결합하는 항원 결합 단백질을 포함하는 조성물을 포함한다. In some aspects, the invention includes a composition comprising an antigen binding protein that binds to a crystallized PCSK9 protein, and PCSK9. 조성물은 결정화된 PCSK9 단백질을 포함하고, 여기서 PCSK9 단백질의 3차원 구조는 약 2.2 옹스트롬 이상의 해상력으로 결정될 수 있다. Composition three-dimensional structure of the PCSK9 protein, wherein the crystallization comprises a PCSK9 protein may be determined by the resolving power of at least about 2.2 angstroms. 일부 실시태양에서, 항원 결합 단백질은 항체 또는 그의 단편이다. In some embodiments, the antigen binding protein is an antibody or a fragment thereof.

일부 측면에서, 본 발명은 결정화된 PCSK9 단백질 및 적어도 LDLR 단백질의 EGFa 섹션을 포함하고, 여기서 LDLR 단백질의 EGFa 섹션에는 PCSK9 단백질이 결합하고, 상기 결정화된 PCSK9 단백질은 PCSK9 단백질의 3차원 구조가 약 2.2 옹스트롬 이상의 해상력으로 결정될 수 있는 것이다. In some aspects, the present invention is included the EGFa section of a crystallized PCSK9 protein and at least LDLR protein, wherein EGFa section of the LDLR proteins PCSK9 protein binding, and the crystallization PCSK9 protein is the three-dimensional structure of the PCSK9 protein 2.2 angstroms will be determined that the more the resolution. 일부 실시태양에서, 분자 모델은 컴퓨터 판독 매체 상에 존재한다. In some embodiments, the molecular model is present on a computer readable medium.

일부 측면에서, 본 발명은 혈청 콜레스테롤 저하를 위한 의약의 제조에 있어서 본원에서 설명되는 항원 결합 단백질의 용도를 포함한다. In some aspects, the invention includes the use of an antigen binding protein described herein in the manufacture of a medicament for lowering serum cholesterol.

일부 측면에서, 본 발명은 대상에서 상승된 혈청 콜레스테롤 수준과 연관된 병태를 치료 또는 예방하기 위한 의약의 제조에 있어서 본원에 설명된 항원 결합 단백질의 용도를 포함한다. In some aspects, the present invention provides for the preparation of a medicament for treating or preventing a condition associated with an elevated serum cholesterol level in a subject includes the use of an antigen binding protein described herein.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH1로부터 선택되는 CDRH1, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH1과 상이한 CDRH1; In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9, wherein the antigen binding protein A) (i) selected from SEQ ID NO: 67, 79, 89, and 49 CDRH1 in a sequence selected from the group consisting of CDRH1, (ii) the amino acid sequence of (i) by a second amino acid addition, deletion or substitution of amino acids or fewer CDRH1 that differs from CDRH1; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 (서열 406) (여기서, X 1 은 G이고, X 2 는 Y, F, 및 G로 이루어지는 군 중에서 선택되고, X 3 은 T 및 S로 이루어지는 군 중에서 선택되고, X 4 는 L 및 F로 이루어지는 군 중에서 선택되고, X 5 는 T, S, 및 N으로 이루어지는 군 중에서 선택되고, X 6 은 S 및 A로 이루어지는 군 중에서 선택되고, X 7 은 Y 및 F로 이루어지는 군 중에서 선택되고, X 8 은 G, S, 및 Y로 이루어지는 군 중에서 선택되고, X 9 는 I, M, 및 W로 이루어지는 군 중에서 선택되고, X 10 은 S, N 및 H로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH1 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), B) (i) 서열 12, 32, 35, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL1로부터 선택되는 CDRL1, (ii) 아 And from (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 ( SEQ ID NO: 406) (Here, X 1 is G, X 2 is a group consisting of Y, F, and G is selected from the selected and, X 3 is the group consisting of T and S, X 4 is selected from the group consisting of L and F, X 5 is selected from the group consisting of T, S, and N, X 6 is S and is selected from the group consisting of a, X 7 is selected from the group consisting of Y, F, X 8 is selected from the group consisting of G, S, and Y, X 9 is from the group consisting of I, M, and W selected and, X 10 is S, N, and from the group consisting of H is selected) the heavy chain complementarity determining section (CDRH selected from at least one of the group consisting of a CDRH1 amino acid sequence selected from the group consisting of a), B) (i) SEQ ID NO: 12 , CDRL1 selected from CDRL1 in a sequence selected from the group consisting of 32, 35, and 23, (ii) O 노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL1과 상이한 CDRL1; Acid sequence of (i) by a second amino acid addition, deletion or substitution of amino acids of more or less different from the CDRL1 CDRL1; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 (서열 407) (여기서, X 1 은 T 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 G 및 S로 이루어지는 군 중에서 선택되고, X 3 은 S, T, 및 G로 이루어지는 군 중에서 선택되고, X 4 는 S이고, X 5 는 S이고, X 6 은 N, D, 및 S로 이루어지는 군 중에서 선택되고, X 7 은 I, V, 및 N으로 이루어지는 군 중에서 선택되고, X 8 은 G 및 I로 이루어지는 군 중에서 선택되고, X 9 는 A 및 G로 이루어지는 군 중에서 선택되고, X 10 은 G, Y, S, 및 N으로 이루어지는 군 중에서 선택되고, X 11 은 Y 및 N으로 이루어지는 군 중에서 선택되고, X 12 는 D, S, T, 및 F로 이루어지는 군 중에서 선택되고, X 13 은 V이고, X 14 는 S, N, 및 H로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRL1 아미노산 서열로 이루어지는 군 중의 And from (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 ( SEQ ID NO: 407) (wherein, X 1 is the group consisting of T and amino acid member selected and, X 2 is selected from the group consisting of G and S, X 3 is selected from the group consisting of S, T, and G, X 4 is S, and X 5 is S, X 6 is N, D , and is selected from the group consisting of S, X 7 is I, V, and is selected from the group consisting of N, X 8 is selected from the group consisting of G and I, X 9 is selected from the group consisting of A and G and, X 10 is selected from the group consisting of G, Y, S, and N, X 11 is selected from the group consisting of Y and N, X 12 is selected from the group consisting of D, S, T, and F of, and X 13 is V, X 14 is a group consisting of a CDRL1 amino acid sequence selected from the group consisting of selected) from the group consisting of S, N, and H 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. And the light chain comprises a light chain complementarity determining section (CDRL) selected from at least one. 당업자는 단일 ABP 또는 항체가 하나 이상의 상기 선택사항을 만족할 수 있고 여전히 본 실시태양에 대해 설명된 발명 내에 있음을 알 것이다. Those skilled in the art will recognize that it is possible to satisfy the single ABP or antibody is one or more of the optional still be within the invention described for this embodiment.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH2로부터 선택되는 CDRH2, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH2와 상이한 CDRH2; In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9, wherein the antigen binding protein A) (i) selected from SEQ ID NO: 67, 79, 89, and 49 CDRH2 in the sequence selected from the group consisting of CDRH2, (ii) the amino acid sequence of two CDRH2 of (i) by an amino acid addition, deletion or substitution of amino acids or less different from that CDRH2; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 (서열 408) (여기서, X 1 은 W, S, L 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 V, I, 및 E로 이루어지는 군 중에서 선택되고, X 3 은 S, W, 및 I로 이루어지는 군 중에서 선택되고, X 4 는 F, S, 및 N으로 이루어지는 군 중에서 선택되고, X 5 는 Y, S, D, 및 H로 이루어지는 군 중에서 선택되고, X 6 은 N, S, 및 G로 이루어지는 군 중에서 선택되고, X 7 은 S 및 G로 이루어지는 군 중에서 선택되고, X 8 은 N, Y, D, 및 R로 이루어지는 군 중에서 선택되고, X 9 는 T, I, 및 E로 이루어지는 군 중에서 선택되고, X 10 은 N, S, Y, 및 D로 이루어지는 군 중에서 선택되고, X 11 은 Y이고, X 12 는 A 및 N으로 이루어지는 군 중에서 선택되고, X 13 은 Q, D, 및 P로 이루어지는 군 중에서 선택되고, X 14 는 K 및 S로 이루어지는 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 ( SEQ ID NO: 408) (wherein, X 1 is W, S, selected from the group consisting of L and the amino acid member, X 2 is selected from the group consisting of V, I, and E, X 3 is selected from the group consisting of S, W, and I, X 4 is F, S, and is selected from the group consisting of N, X 5 is Y, S, D, and is selected from the group consisting of H, X 6 is selected from the group consisting of N, S, and G, X 7 is S, and is selected from the group consisting of G, X 8 is selected from the group consisting of N, Y, D, and R, X 9 is selected from the group consisting of T, I, and E, X 10 is N, S, Y , and it is selected from the group consisting of D, and X 11 is Y, X 12 is selected from the group consisting of A and N, X 13 is selected from the group consisting of Q, D, and P, X 14 is K, and consisting of S 중에서 선택되고, X 15 는 L 및 V로 이루어지는 군 중에서 선택되고, X 16 은 Q 및 K로 이루어지는 군 중에서 선택되고, X 17 은 G 및 S로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH2 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), B) (i) 서열 12, 32, 35, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL2로부터 선택되는 CDRL2, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL2와 상이한 CDRL2; Is selected from, X 15 is a CDRH2 amino acid sequence selected from the group consisting of L and V, and, X 16 is selected from the group consisting of Q and K, X 17 is selected from the group consisting of selected from the group consisting of G and S) a complementary heavy chain selected from at least from the group consisting of SEQ ID NO one crystal area (CDRH), B) (i) SEQ ID NO: 12, 32, 35, and 23 CDRL2, (ii selected from CDRL2 in a sequence selected from the group consisting of a) the amino acid SEQ ID NO: 2 amino acids of the amino acid sequence of no more than addition, CDRL2 of (i) by deletion or replacement with a different CDRL2; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 (서열 409) (여기서, X 1 은 G, E, S, 및 D로 이루어지는 군 중에서 선택되고, X 2 는 N, V, 및 Y로 이루어지는 군 중에서 선택되고, X 3 은 S 및 N으로 이루어지는 군 중에서 선택되고, X 4 는 N, Q, 및 K로 이루어지는 군 중에서 선택되고, X 5 는 R이고, X 6 은 P이고, X 7 은 S임)로 이루어지는 군 중에서 선택되는 CDRL2 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 ( SEQ ID NO: 409) (wherein, X 1 is selected from the group consisting of G, E, S, and D, X 2 is N, V, and R is selected from the group consisting of Y, X 3 is selected from the group consisting of S and N, X 4 is selected from the group consisting of N, Q, and K, X 5 is R, X 6 is P, X 7 includes an S Im) a light chain complementarity determining is selected from at least one of the group consisting of a CDRL2 amino acid sequence selected from the group consisting of a zone (CDRL).

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 67, 79, 89, 및 49로 이루어지는 군 중에서 선택되는 서열 내의 CDRH3으로부터 선택되는 CDRH3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH3과 상이한 CDRH3; In some aspects, the invention includes the isolated antigen binding protein that bind to PCSK9, wherein antigen binding protein A) (i) selected from SEQ ID NO: 67, 79, 89, and 49 CDRH3 in the sequence selected from the group consisting of CDRH3, (ii) the amino acid sequence of (i) by a second amino acid addition, deletion or substitution of amino acids in the CDRH3 or fewer different CDRH3 that; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 (서열 410) (여기서, X 1 은 D 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 Y, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 3 은 D, I 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 4 는 F, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 5 는 W, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 6 은 S, L 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 7 은 A, Y, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 8 은 Y, Q 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 9 는 G, Y, 및 L로 이루어지는 군 중에서 선택되고, X 10 은 Y, D, 및 V로 이루어지는 군 중에서 선택되고, X 11 은 G, A, 및 P로 이루어지는 군 중에서 선택되고, X 12 는 M 및 F로 이루어 And from (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 ( SEQ ID NO: 410) (wherein, X 1 is a group consisting of D and an amino acid member selected and, X 2 is selected from the group consisting of Y, a, and the amino acid member, X 3 is selected from the group consisting of D, I, and the amino acid member, X 4 is selected from the group consisting of F, a, and the amino acid member , X 5 is selected from the group consisting of W, a and the amino acid member, X 6 is selected from the group consisting of S, L and the amino acid member, X 7 is selected from the group consisting of a, Y, G and amino acid member , X 8 is Y, is selected from the group consisting of Q and amino acid member, X 9 is G, Y, and is selected from the group consisting of L, X 10 is selected from the group consisting of Y, D, and V, X 11 is selected from the group consisting of G, a, and P, X 12 is composed of M and F 지는 군 중에서 선택되고, X 13 은 D이고, X 14 는 V 및 Y로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH3 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), 및 B) (i) 서열 12, 32, 35, 및 23으로 이루어지는 군 중에서 선택되는 서열 내의 CDRL3으로부터 선택되는 CDRL3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL3과 상이한 CDRL3; Which is selected from the group, and X 13 is D, X 14 is selected from the group consisting of V and Y), the heavy chain complementarity determining section (CDRH selected from at least one of the group consisting of a CDRH3 amino acid sequence selected from the group consisting of a), and B) by (i) SEQ ID NO: 12, 32, 35, and 23 CDRL3 selected from the CDRL3 in a sequence selected from the group consisting of, (ii) the amino acid sequence is 2 amino acids of the amino acid sequence of no more than addition, deletion or substitution ( of i) CDRL3 different CDRL3; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 (서열 411) (여기서, X 1 은 Q, A, G 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 S, V, T 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 3 은 Y, N, 및 W로 이루어지는 군 중에서 선택되고, X 4 는 S 및 D로 이루어지는 군 중에서 선택되고, X 5 는 S, Y, 및 D로 이루어지는 군 중에서 선택되고, X 6 은 S 및 T로 이루어지는 군 중에서 선택되고, X 7 은 L 및 S로 이루어지는 군 중에서 선택되고, X 8 은 S, T, 및 N으로 이루어지는 군 중에서 선택되고, X 9 는 G, S, 및 A로 이루어지는 군 중에서 선택되고, X 10 은 S, M, W, 및 Y로 이루어지는 군 중에서 선택되고, X 11 은 V임)로 이루어지는 군 중에서 선택되는 CDRL3 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 ( SEQ ID NO: 411) (wherein, X 1 is Q, it is selected from the group consisting of A, G and amino acid member , X 2 is selected from the group consisting of S, V, T, and the amino acid member, X 3 is selected from the group consisting of Y, N, and W, X 4 is selected from the group consisting of S and D, X 5 is selected from the group consisting of S, Y, and D, X 6 is an S and is selected from the group consisting of T, X 7 is selected from the group consisting of L and S, X 8 is S, T, and N in is selected from the group consisting of, X 9 is a group consisting of G, S, and A is selected from the group, the X 10 is selected from the group consisting of S, M, W, and Y, X 11 V consisting Im) comprising a CDRL3 amino acid sequence selected and the light chain comprises a light chain complementarity determining section (CDRL) selected from at least one of the groups. 일부 실시태양에서, 임의의 상기 아미노산은 보존적 아미노산 치환에 의해 교체될 수 있다. In some embodiments, any of the amino acid may be replaced by a conservative amino acid substitution.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 및 58로 이루어지는 군 중에서 선택되는 서열 내의 CDRH1로부터 선택되는 CDRH1, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH1과 상이한 CDRH1; In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9, wherein the antigen binding protein A) (i) SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56 , 57, and 58 CDRH1 selected from CDRH1 in a sequence selected from the group consisting of, (ii) the amino acid sequence of 2 amino acids or fewer amino acids added, deleted or CDRH1 of (i) by substitution with a different CDRH1; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 (서열 412) (여기서, X 1 은 G, P, 및 A로 이루어지는 군 중에서 선택되고, X 2 는 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 3 은 T, P, S 및 A, C, V, L, 및 I로 이루어지는 군 중에서 선택되고, X 4 는 L, F, I, V, M, A, 및 Y로 이루어지는 군 중에서 선택되고, X 5 는 T, P, S, 및 A로 이루어지는 군 중에서 선택되고, X 6 은 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 7 은 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 8 은 G, P, 및 A로 이루어지는 군 중에서 선택되고, X 9 는 I, L, V, M, A, 및 F로 이루어지는 군 중에서 선택되고, X 10 은 S, T, A, 및 C로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH1 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), B) (i) 서열 14 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 ( SEQ ID NO: 412) (wherein, X 1 is selected from the group consisting of G, P, and A, X 2 is Y, W, F, T, and is selected from the group consisting of S, X 3 is T, P, S and a, C, V, is selected from the group consisting of L, and I, X 4 is L, F, is selected from the group consisting of I, V, M, a, and Y, X 5 is selected from the group consisting of T, P, S, and a, X 6 is from the group consisting of S, T, a, and C selected and, X 7 is Y, W, F, T, and is selected from the group consisting of S, X 8 is selected from the group consisting of G, P, and a, X 9 is I, L, V, M, a, and is selected from the group consisting of F, X 10 is S, T, a, and selected from the group consisting of C) determining the heavy chain complementarity is selected from at least one of the group consisting of a CDRH1 amino acid sequence selected from the group consisting of zone (CDRH), B) (i) SEQ ID NO: 14 , 15, 16, 17, 18, 19, 20, 21, 22, 23, 및 24로 이루어지는 군 중에서 선택되는 서열 내의 CDRL1로부터 선택되는 CDRL1, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL1과 상이한 CDRL1; , 15, 16, 17, 18, 19, 20, 21, 22, 23, and 24 selected from CDRL1 in a sequence selected from the group consisting of CDRL1, (ii) amino acid sequence of the second amino acid portion of amino acids or fewer, CDRL1 of (i) by deletion or replacement with a different CDRL1; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 (서열 413) (여기서, X 1 은 T 및 S로 이루어지는 군 중에서 선택되고, X 2 는 G, P, 및 A로 이루어지는 군 중에서 선택되고, X 3 은 T 및 S로 이루어지는 군 중에서 선택되고, X 4 는 S, N, T, A, C, 및 Q로 이루어지는 군 중에서 선택되고, X 5 는 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 6 은 D 및 E로 이루어지는 군 중에서 선택되고, X 7 은 V, I, M, L, F, 및 A로 이루어지는 군 중에서 선택되고, X 8 은 G, P, 및 A로 이루어지는 군 중에서 선택되고, X 9 는 G, A, R, P, V, L, I, K, Q, 및 N으로 이루어지는 군 중에서 선택되고, X 10 은 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 11 은 N 및 Q로 이루어지는 군 중에서 선택되고, X 12 는 Y, S, W, F, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 13 은 V, I, M, L, F, 및 A로 이루어지는 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 ( SEQ ID NO: 413) (wherein, X 1 is selected from the group consisting of T and S among selected from and, X 2 is the group consisting of G, P, and a, and X 3 is the group consisting of T and is selected from the group consisting of S, X 4 is S, N, T, a, C, and Q selected and, X 5 is a S, T, A, and is selected from the group consisting of C, X 6 is selected from the group consisting of D and E, X 7 is V, I, M, L, F, and A is selected from the group consisting of, X 8 is G, P, and is selected from the group consisting of a, X 9 is selected from the group consisting of G, a, R, P, V, L, I, K, Q, and N , and X 10 is Y, W, F, T, and is selected from the group consisting of S, X 11 is selected from the group consisting of N and Q, X 12 is Y, S, W, F, T, a, selected from the group consisting of C and, X 13 is made of a V, I, M, L, F, and A 중에서 선택되고, X 14 는 S, T, A, 및 C로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRL1 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. Selected from and and X 14 is a determining light chain complementarity is selected from S, T, A, and at least one of the group consisting of a CDRL1 amino acid sequence selected from the group consisting of selected from the group consisting of C) Area (CDRL).

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 및 58로 이루어지는 군 중에서 선택되는 서열 내의 CDRH2로부터 선택되는 CDRH2, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH2와 상이한 CDRH2; In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9, wherein the antigen binding protein A) (i) SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56 , 57, and 58 CDRH2 selected from the CDRH2 in the sequence selected from the group consisting of, (ii) the amino acid sequence of 2 amino acids or fewer amino acids added, deleted, or different from the CDRH2 of (i) substituted by a CDRH2; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 (서열 414) (여기서, X 1 은 W, Y, 및 F로 이루어지는 군 중에서 선택되고, X 2 는 V, I, M, L, F, 및 A로 이루어지는 군 중에서 선택되고, X 3 은 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 4 는 A, F, V, L, I, Y, 및 M으로 이루어지는 군 중에서 선택되고, X 5 는 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 6 은 N 및 Q로 이루어지는 군 중에서 선택되고, X 7 은 G, P, 및 A로 이루어지는 군 중에서 선택되고, X 8 은 N 및 Q로 이루어지는 군 중에서 선택되고, X 9 는 T 및 S로 이루어지는 군 중에서 선택되고, X 10 은 N 및 Q로 이루어지는 군 중에서 선택되고, X 11 은 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 12 는 A, V, L, 및 I로 이루어지는 군 중에서 선택되고, X 13 은 Q, E, N, 및 D로 이루어지는 군 중에서 And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 X 13 X 14 X 15 X 16 X 17 ( SEQ ID NO: 414) (wherein, X 1 is W, Y, and is selected from the group consisting of F, X 2 is selected from the group consisting of V, I, M, L, F, and a, X 3 is selected from the group consisting of S, T, a, and C , X 4 is a is N and a, F, V, L, I, Y, and is selected from the group consisting of M, X 5 is selected from the group consisting of Y, W, F, T, and S, X 6 consisting of Q is selected from the group, X 7 is selected from the group consisting of G, P, and a, X 8 is selected from the group consisting of N and Q, X 9 is selected from the group consisting of T and S, X 10 is selected from the group consisting of N and Q, X 11 is selected from the group consisting of Y, W, F, T, and S, X 12 is selected from the group consisting of a, V, L, and I among, X 13 is a group consisting of Q, E, N, and D 선택되고, X 14 는 K, R, Q, 및 N으로 이루어지는 군 중에서 선택되고, X 15 는 L, F, V, I, M, A, 및 Y로 이루어지는 군 중에서 선택되고, X 16 은 Q 및 N으로 이루어지는 군 중에서 선택되고, X 17 은 G, P, 및 A로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH2 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), B) (i) 서열 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 및 24로 이루어지는 군 중에서 선택되는 서열 내의 CDRL2로부터 선택되는 CDRL2, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL2와 상이한 CDRL2; Selected and, X 14 is selected from the group consisting of K, R, Q, and N, X 15 is selected from the group consisting of L, F, V, I, M, A, and Y, X 16 is Q, and is selected from the group consisting of N, X 17 is G, P, and the group A in selected) CDRH2 amino acid sequence of the heavy chain complementarity determining section (CDRH selected from at least one of the group consisting of a) is selected from the group consisting of consisting of a, B ) (i) SEQ ID NO: 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, and CDRL2, (ii selected from CDRL2 in a sequence selected from the group consisting of 24) the amino acid sequence is more than two the addition of amino acids, different from the CDRL2 of (i) by the deletion or substitution CDRL2; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 (서열 415) (여기서, X 1 은 E 및 D로 이루어지는 군 중에서 선택되고, X 2 는 V, I, M, L, F, 및 A로 이루어지는 군 중에서 선택되고, X 3 은 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 4 는 N 및 Q로 이루어지는 군 중에서 선택되고, X 5 는 R, K, Q, 및 N으로 이루어지는 군 중에서 선택되고, X 6 은 P 및 A로 이루어지는 군 중에서 선택되고, X 7 은 S, T, A, 및 C로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRL2 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 ( SEQ ID NO: 415) (wherein, X 1 is selected from the group consisting of E and D, X 2 is V, I, M, L, F selected from, the group consisting of a, and X 3 is S, T, a, and is selected from the group consisting of C, X 4 is selected from the group consisting of N and Q, X 5 is R, K, Q, and is selected from the group consisting of N, X 6 is selected from the group consisting of P and a, X 7 is made of a CDRL2 amino acid sequence selected from the group consisting of selected from the group consisting of S, T, a, and C) and the light chain comprises a light chain complementarity determining section (CDRL) selected from at least one of the groups.

일부 측면에서, 본 발명은 PCSK9에 결합하는 단리된 항원 결합 단백질을 포함하고, 여기서 항원 결합 단백질은 A) (i) 서열 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 및 58로 이루어지는 군 중에서 선택되는 서열 내의 CDRH3으로부터 선택되는 CDRH3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRH3과 상이한 CDRH3; In some aspects, the present invention includes the isolated antigen binding protein that bind to PCSK9, wherein the antigen binding protein A) (i) SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56 , 57, and 58 are selected from within a CDRH3 sequence selected from the group consisting of CDRH3, (ii) the amino acid sequence of 2 amino acids or fewer amino acids added, deleted or CDRH3 of (i) by substitution with a different CDRH3; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 (서열 416) (여기서, X 1 은 G, P, A 및 아미노산 부재로 이루어지는 군 중에서 선택되고, X 2 는 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 3 은 G, V, P, A, I, M, L, 및 F로 이루어지는 군 중에서 선택되고, X 4 는 M, L, F, 및 I로 이루어지는 군 중에서 선택되고, X 5 는 D 및 E로 이루어지는 군 중에서 선택되고, X 6 은 V, I, M, L, F, 및 A로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRH3 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 중쇄 상보성 결정 구역 (CDRH), B) (i) 서열 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 및 24로 이루어지는 군 중에서 선택되는 서열 내의 CDRL3으로부터 선택되는 CDRL3, (ii) 아미노산 서열이 2개 이하의 아미노산의 아미노산 부가, 결실 또는 치환에 의해 (i)의 CDRL3과 상이한 CDRL3; And (iii) X 1 X 2 X 3 X 4 X 5 X 6 ( SEQ ID NO: 416) (wherein, X 1 is selected from the group consisting of G, P, A, and the amino acid member, X 2 is Y, W, F, is selected from the group consisting of T, and S, X 3 is selected from the group consisting of G, V, P, a, I, M, L, and F, X 4 is made of a M, L, F, and I is selected from the group, X 5 is selected from the group consisting of D and E, X 6 is made of a CDRH3 amino acid sequence selected from the group consisting of selected from the group consisting of V, I, M, L, F, and a) sequence selected from the group consisting of crystal heavy chain complementarity is selected from at least one zone (CDRH), B) (i) SEQ ID NO: 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, and 24 from the group is selected from within CDRL3 CDRL3, (ii) a CDRL3 amino acid sequence (i) by a second amino acid addition, deletion or substitution of amino acids of more or less different from the CDRL3; 및 (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 (서열 417) (여기서, X 1 은 S, N, T, A, C, 및 Q로 이루어지는 군 중에서 선택되고, X 2 는 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 3 은 Y, W, F, T, 및 S로 이루어지는 군 중에서 선택되고, X 4 는 T 및 S로 이루어지는 군 중에서 선택되고, X 5 는 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 6 은 S, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 7 은 N, S, Q, T, A, 및 C로 이루어지는 군 중에서 선택되고, X 8 은 M, V, L, F, I, 및 A로 이루어지는 군 중에서 선택되고, X 9 는 V, I, M, L, F, 및 A로 이루어지는 군 중에서 선택됨)로 이루어지는 군 중에서 선택되는 CDRL3 아미노산 서열로 이루어지는 군 중의 적어도 하나로부터 선택되는 경쇄 상보성 결정 구역 (CDRL)을 포함한다. And (iii) X 1 X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 ( SEQ ID NO: 417) (wherein, X 1 is selected from the group consisting of S, N, T, A, C, and Q , X 2 is selected from the group consisting of S, T, a, and C, X 3 is selected from the group consisting of Y, W, F, T, and S, X 4 is selected from the group consisting of T and S and, X 5 is S, T, a, and is selected from the group consisting of C, X 6 is S, T, a, and is selected from the group consisting of C, X 7 is N, S, Q, T, a , and is selected from the group consisting of C, X 8 is selected from the group consisting of M, V, L, F, I, and A, X 9 is a group consisting of V, I, M, L, F, and A among comprising a CDRL3 amino acid sequence selected from the group consisting of selected) and the light chain comprises a light chain complementarity determining section (CDRL) selected from at least one of the group.

도 1a는 성숙형의 PCSK9의 아미노산 서열을 도시한 것이고, 프로-도메인을 밑줄친다. Figure 1a depicts the amino acid sequence of the mature PCSK9, pro- beats underscore the domain.
도 1b-1e는 PCSK9의 아미노산 및 핵산 서열을 도시한 것이고, 프로-도메인을 밑줄치고 신호 서열은 굵게 도시한다. The hit underlined domain signal sequence is shown in bold - Fig. 1b-1e is depicts the amino acid and nucleic acid sequence of the PCSK9, Pro.
도 2a-2d는 다양한 항원 결합 단백질의 다양한 경쇄의 서열 비교 표이다. Figure 2a-2d is a sequence comparison table of the various light chains of the various antigen-binding protein. 도 2c는 도 2a에서 시작한 서열의 계속이다. 2c is a continuation of the sequence starting in Figure 2a. 도 2d는 도 2b에서 시작한 서열의 계속이다. Figure 2d is a continuation of the sequence starting in Figure 2b.
도 3a-3d는 다양한 항원 결합 단백질의 다양한 중쇄의 서열 비교 표이다. Figure 3a-3d is a sequence comparison table of the various heavy chains of the various antigen-binding protein. 도 3c는 도 3a에서 시작한 서열의 계속이다. Figure 3c is a continuation of the sequence starting in Figure 3a. 도 3d는 도 3b에서 시작한 서열의 계속이다. Fig. 3d is a continuation of the sequence started in FIG. 3b.
도 3e-3jj는 항원 결합 단백질의 일부 실시태양의 가변 도메인에 대한 아미노산 및 핵산 서열을 도시한 것이다. Figure 3e-3jj shows the amino acid and nucleic acid sequence for the variable domain of the some embodiments of the antigen binding proteins.
도 3kk는 다양한 불변 도메인에 대한 아미노산 서열을 도시한 것이다. FIG 3kk shows the amino acid sequence for a variety of constant domains.
도 3ll-3bbb는 항원 결합 단백질의 일부 실시태양의 가변 도메인에 대한 아미노산 및 핵산 서열을 도시한 것이다. FIG 3ll-3bbb shows the amino acid and nucleic acid sequence for the variable domain of the some embodiments of the antigen binding proteins.
도 3ccc-3jjj는 항원 결합 단백질의 일부 실시태양의 다양한 중쇄 및 경쇄의 서열 비교 표이다. FIG 3ccc-3jjj is a variety of heavy and light chain of the sequence comparison table of some embodiments of the antigen binding proteins.
도 4a는 인간 PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4a is a binding curve of the antigen binding protein to human PCSK9.
도 4b는 인간 PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4b is a binding curve of the antigen binding protein to human PCSK9.
도 4c는 사이노몰거스 (cynomolgus) PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4c is a binding curve of the antigen binding proteins for the Gus (cynomolgus) nomol between PCSK9.
도 4d는 사이노몰거스 PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4d is a binding curve of the antigen binding protein to cynomolgus PCSK9.
도 4e는 마우스 PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4e is a binding curve of the antigen-binding protein for mouse PCSK9.
도 4f는 마우스 PCSK9에 대한 항원 결합 단백질의 결합 곡선이다. Figure 4f is a binding curve of the antigen-binding protein for mouse PCSK9.
도 5a는 단백질의 상대 순도 및 농도를 입증하는, PCSK9 및 다양한 항원 결합 단백질을 포함한 SDS PAGE 실험의 결과를 도시한 것이다. Figure 5a shows the result of SDS PAGE experiment, including the relative purity and, PCSK9 and various antigen-binding protein to demonstrate the concentration of the protein.
도 5b 및 5c는 21B12에 대한 비아코어 (biacore) 용액 평형 분석으로부터의 그래프를 도시한 것이다. Figures 5b and 5c shows a graph from the Biacore (biacore) solution equilibrium analysis to 21B12.
도 5d는 비아코어 포획 분석으로부터의 운동학 그래프를 도시한 것이다. Figure 5d shows a graph of the kinetics from the Biacore analysis capture.
도 5e는 3개의 ABP에 대한 비닝 (binning) 결과를 도시하는 막대 그래프를 도시한 것이다. Figure 5e illustrates a bar graph showing a binning (binning) results for three ABP.
도 6a는 시험관 내 PCSK9:LDLR 결합 분석에서 PCSK9에 대한 항원 결합 단백질 31H4 IgG2의 억제 곡선이다. Figure 6a vitro PCSK9: antigen binding to PCSK9 at LDLR binding assay is the inhibition curve of the protein 31H4 IgG2.
도 6b는 시험관 내 PCSK9:LDLR 결합 분석에서 PCSK9에 대한 항원 결합 단백질 31H4 IgG4의 억제 곡선이다. Figure 6b vitro PCSK9: antigen binding to PCSK9 at LDLR protein binding assay is the inhibition curve of the 31H4 IgG4.
도 6c는 시험관 내 PCSK9:LDLR 결합 분석에서 PCSK9에 대한 항원 결합 단백질 21B12 IgG2의 억제 곡선이다. Figure 6c vitro PCSK9: antigen binding to PCSK9 at LDLR binding assay is the inhibition curve of the protein 21B12 IgG2.
도 6d는 시험관 내 PCSK9:LDLR 결합 분석에서 PCSK9에 대한 항원 결합 단백질 21B12 IgG4의 억제 곡선이다. Figure 6d is in vitro PCSK9: antigen binding to PCSK9 at LDLR protein binding assay is the inhibition curve of the 21B12 IgG4.
도 7a는 PCSK9의 LDL 흡수 차단 효과를 감소시키는 ABP의 효과를 보여주는, 세포 LDL 흡수 분석에서 항원 결합 단백질 31H4 IgG2의 억제 곡선이다. Figure 7a is a curve showing the inhibitory effect of the ABP to reduce the LDL absorption blocking effect of PCSK9, the antigen binding protein in the cell LDL absorption analysis 31H4 IgG2.
도 7b는 PCSK9의 LDL 흡수 차단 효과를 감소시키는 ABP의 효과를 보여주는, 세포 LDL 흡수 분석에서 항원 결합 단백질 31H4 IgG4의 억제 곡선이다. Figure 7b is the inhibition curve of the antigen binding protein 31H4 IgG4 in the ABP it shows the effect of reducing the LDL absorption blocking effect of PCSK9, cellular LDL uptake analysis.
도 7c는 PCSK9의 LDL 흡수 차단 효과를 감소시키는 ABP의 효과를 보여주는, 세포 LDL 흡수 분석에서 항원 결합 단백질 21B12 IgG2의 억제 곡선이다. Figure 7c is a curve showing the inhibition effect of the ABP to reduce the LDL absorption blocking effect of PCSK9, the antigen binding protein in the cell LDL absorption analysis 21B12 IgG2.
도 7d는 PCSK9의 LDL 흡수 차단 효과를 감소시키는 ABP의 효과를 보여주는, 세포 LDL 흡수 분석에서 항원 결합 단백질 21B12 IgG4의 억제 곡선이다. Figure 7d is an inhibition curve of antigen binding protein 21B12 IgG4 in the ABP shows the effect of reducing the LDL absorption blocking effect of PCSK9, cellular LDL uptake analysis.
도 8a는 ABP 31H4의 마우스에서 혈청 콜레스테롤 저하 능력을 도시하는 그래프이다 (IgG 대조군 처리 마우스에 상대적인 변화) (* p<0.01). Figure 8a is a graph showing the serum cholesterol lowering ability in mice of ABP 31H4 (relative change in the control IgG treated mice) (* p <0.01).
도 8b는 ABP 31H4의 마우스에서 혈청 콜레스테롤 저하 능력을 도시하는 그래프이다 (시간 = 0시간에 상대적인 변화) (# p,0.05). Figure 8b is a graph showing the serum cholesterol lowering ability in mice of ABP 31H4 (relative change with time = 0 hours) (# p, 0.05).
도 8c는 C57Bl/6 마우스에서 HDL 콜레스테롤 수준에 대한 ABP 31H4의 효과를 도시하는 그래프이다 (* p<0.01). Figure 8c is a graph showing the effect of ABP 31H4 on HDL cholesterol levels in C57Bl / 6 mice (* p <0.01).
도 8d는 C57Bl/6 마우스에서 HDL 콜레스테롤 수준에 대한 ABP 31H4의 효과를 도시하는 그래프이다 (# p<0.05). Figure 8d is a graph showing the effect of ABP 31H4 on HDL cholesterol levels in the C57Bl / 6 mouse (# p <0.05).
도 9는 다양한 시점 후에 존재하는 간 LDLR 단백질의 양을 향상시키는 ABP 31H4의 능력의 웨스턴 블롯 분석을 도시한 것이다. Figure 9 shows a Western blot analysis of the ability of ABP 31H4 to increase the amount of LDLR protein between present after various time points.
도 10a는 야생형 마우스에서 총 혈청 콜레스테롤을 저하시키는 항원 결합 단백질 31H4의 능력을 도시하는 그래프이다. Figure 10a is a graph showing the antigen binding ability of the protein 31H4 to lower the total serum cholesterol in the wild type mice.
도 10b는 야생형 마우스에서 HDL을 저하시키는 항원 결합 단백질 31H4의 능력을 도시하는 그래프이다. Figure 10b is a graph showing the antigen binding ability of the protein 31H4 lowering the HDL from wild type mice.
도 10c는 다양한 항원 결합 단백질 31H4 및 16F12의 혈청 콜레스테롤 저하 능력을 도시하는 그래프이다. Figure 10c is a graph showing a range of antigen binding capacity of the serum cholesterol-lowering protein 31H4 and 16F12.
도 11a는 혈청 콜레스테롤을 저하시키는 항원 결합 단백질의 지속기간 및 능력을 시험하기 위한 주입 프로토콜을 도시한 것이다. Figure 11a shows the injection protocol for testing the duration and power of the antigen binding protein to lower the serum cholesterol.
도 11b는 도 11a의 프로토콜의 결과를 도시하는 그래프이다. Figure 11b is a graph showing the results of the protocol of Figure 11a.
도 12a는 HepG2 세포에서 스타틴 및 ABP 21B12의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12a shows a LDLR level in response to a combination of a statin and ABP 21B12 in HepG2 cells.
도 12b는 HepG2 세포에서 스타틴 및 ABP 31H4의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12b shows the LDLR level in response to a combination of a statin and ABP 31H4 in HepG2 cells.
도 12c는 HepG2 세포에서 스타틴 및 ABP 25A7.1 ("25A7" 중화 항체에 대조적인 비중화 항체)의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12c shows the LDLR level in response to a combination of a statin and ABP 25A7.1 ( "25A7" contrast ratio antibodies to neutralizing antibodies) in HepG2 cells.
도 12d는 PCSK9를 과다발현하는 HepG2 세포에서 스타틴 및 ABP 21B12의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12d illustrates a LDLR level in response to a combination of a statin and ABP 21B12 in HepG2 cells over-expressing PCSK9.
도 12e는 PCSK9를 과다발현하는 HepG2 세포에서 스타틴 및 ABP 31H4의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12e shows the levels of LDLR response to a combination of a statin and ABP 31H4 in HepG2 cells over-expressing PCSK9.
도 12f는 PCSK9를 과다발현하는 HepG2 세포에서 스타틴 및 ABP 25A7.1 ("25A7" 중화 항체에 대조적인 비중화 항체)의 조합물에 반응한 LDLR 수준을 도시한 것이다. Figure 12f shows the LDLR level in response to a combination of a statin and ABP 25A7.1 ( "25A7" contrast ratio antibodies to neutralizing antibodies) in HepG2 cells over-expressing PCSK9.
도 13a는 PCSK9에 대한 다양한 ABP의 다양한 경쇄 아미노산 서열을 도시한 것이다. Figure 13a shows a range of the light chain amino acid sequence of ABP for the various PCSK9. 점 (.)은 아미노산 부재를 나타낸다. The dot (.) Represents the amino acid member.
도 13b는 PCSK9에 대한 다양한 ABP에 대한 경쇄 분지도 (cladogram)를 도시한 것이다. Figure 13b shows the light chain branching (cladogram) for a variety of ABP for the PCSK9.
도 13c는 PCSK9에 대한 다양한 ABP의 다양한 중쇄 아미노산 서열을 도시한 것이다. Figure 13c shows a different heavy chain amino acid sequence of ABP for the various PCSK9. 점 (.)은 아미노산 부재를 나타낸다. The dot (.) Represents the amino acid member.
도 13d는 PCSK9에 대한 다양한 ABP에 대한 중쇄 계통수 (dendrogram)를 도시한 것이다. Figure 13d shows a phylogenetic tree heavy chain (dendrogram) for a variety of ABP for the PCSK9.
도 13e는 경쇄 및 중쇄 CDR의 비교, 및 그로부터 컨센서스가 유래되는 군의 지정을 도시한 것이다. Figure 13e shows a comparison, and the designation of the group from which the consensus is derived from the light and heavy chain CDR.
도 13f는 제1군 및 제2군에 대한 컨센서스 서열을 도시한 것이다. Figure 13f shows the consensus sequence for a first group and a second group.
도 13g는 제3군 및 제4군에 대한 컨센서스 서열을 도시한 것이다. Figure 13g shows the consensus sequence for the third group and the fourth group.
도 13h는 제1군 및 제2군에 대한 컨센서스 서열을 도시한 것이다. Figure 13h shows the consensus sequence for a first group and a second group. 점 (.)은 동일한 잔기를 나타낸다. The dot (.) Represent the same moiety.
도 13i는 제2군에 대한 컨센서스 서열을 도시한 것이다. Figure 13i shows the consensus sequence for the second group. 점 (.)은 동일한 잔기를 나타낸다. The dot (.) Represent the same moiety.
도 13j는 제3군 및 제4군에 대한 컨센서스 서열을 도시한 것이다. Figure 13j shows the consensus sequence for the third group and the fourth group. 점 (.)은 동일한 잔기를 나타낸다. The dot (.) Represent the same moiety.
도 14a는 다양한 ABP (10 mg/kg에서)의 생체 내 LDL 저하 능력을 도시하는 그래프이다. Figure 14a is a graph showing the in vivo ability of lowering LDL variety of ABP (at 10 mg / kg).
도 14b는 다양한 ABP (30 mg/kg에서)의 생체 내 LDL 저하 능력을 도시하는 그래프이다. Figure 14b is a graph showing the in vivo ability of lowering LDL variety of ABP (at 30 mg / kg).
도 15a 및 도 15b는 항원 결합 단백질의 다양한 실시태양의 다양한 경쇄의 서열 비교 표이다. Figs. 15a and 15b is a table comparing various exemplary variant sequences of the light chain of the aspect of the antigen binding proteins. 도 15b는 도 15a에서 시작된 서열의 계속이다. Figure 15b is a continuation of the sequence is started in Fig. 15a.
도 15c 및 도 15d는 항원 결합 단백질의 다양한 실시태양의 다양한 경쇄의 서열 비교 표이다. Figure 15c and Figure 15d is a table comparing various embodiments different sequences of the light chain of the aspect of the antigen binding proteins. 도 15d는 도 15c에서 시작된 서열의 계속이다. Fig. 15d is a continuation of the sequence started in FIG. 15c.
도 16a는 PCSK9의 ProCat 또는 VD 섹션에 결합하는 Ab 21B12의 능력을 시험하기 위해 사용된 겔의 도면이다. Figure 16a is a diagram of a gel used to test the ability of the Ab binding to the 21B12 ProCat or VD sections of PCSK9.
도 16b는 PCSK9의 ProCat 또는 VD 섹션에 결합하는 Ab 31H4의 능력을 시험하기 위해 사용된 겔의 도면이다. Figure 16b is a diagram of a gel used to test the ability of the Ab binding to the 31H4 ProCat or VD sections of PCSK9.
도 17은 PCSK9, 및 LDLR의 EGFa 섹션의 구조도이다. 17 is a structural diagram of a section of EGFa PCSK9, and LDLR.
도 18a는 PCSK9 및 31H4 Ab의 구조도이다. Figure 18a is a structural diagram of PCSK9 and 31H4 Ab.
도 18b는 PCSK9 및 31H4 Ab의 구조도이다. Fig 18b is a structural diagram of PCSK9 and 31H4 Ab.
도 19a는 PCSK9, 31H4 Ab, 및 21B12 Ab의 구조도이다. Figure 19a is a PCSK9, a structure of Ab 31H4, 21B12 and Ab.
도 19b는 PCSK9 및 21B12 Ab의 구조도이다. Fig 19b is a structural diagram of PCSK9 and 21B12 Ab.
도 20a는 PCSK9에 결합된 항체 31H4 및 21B12의 구조와 겹쳐놓은 PCSK9, 및 LDLR로부터의 EGFa의 구조도이다. Figure 20a is a structural diagram of EGFa from PCSK9 superimposed with the structures of the antibodies 31H4 and 21B12 binding to PCSK9, and LDLR.
도 20b는 PCSK9 및 LDLR의 구조적 모델의 도면이다. Figure 20b is a view of the structural model of PCSK9 and LDLR.
도 20c는 별도의 관점으로부터 PCSK9 및 LDLR의 구조적 모델의 도면이다. Figure 20c is a view of the structural model of PCSK9 and LDLR from a separate point of view.
도 20d는 PCSK9 및 LDLR의 구조적 모델의 도면이고, 여기서 31H4 및 21B12의 구조도를 포함시킨다. Figure 20d is a view of the structural model of PCSK9 and LDLR, here to include a structural view of the 31H4 and 21B12.
도 20e는 표시된 축 둘레에 90도 회전시킨 도 20D의 구조적 모델의 도면이다. Figure 20e is a view of the structural model of Fig. 20D rotated 90 degrees to the axis shown.
도 20f는 표시된 축 둘레에 180도 회전시킨 도 20D의 구조적 모델의 도면이다. Figure 20f is a view of the structural model of Figure 20D was 180 degrees on the axis shown.
도 21a는 PCSK9 및 31A4의 구조도이다. Figure 21a is a structural diagram of PCSK9 and 31A4.
도 21b는 PCSK9 및 31A4의 구조도이다. Fig 21b is a structural diagram of PCSK9 and 31A4.
도 21c는 PCSK9 및 31A4의 구조도이다. Figure 21c is a schematic block diagram of PCSK9 and 31A4.
도 21d는 전장 PCSK9 및 31A4의 구조적 모델의 도면이다. Figure 21d is a view of a structural model of a full-length PCSK9 and 31A4.
도 22는 인간 ABP 서열과 이. Figure 22 is a human with ABP sequences. 콜라이 ( E. coli )에 대해 생성되고 결정 구조에 대해 사용된 ABP 서열 사이의 다양한 차이를 확인하는 ABP 서열의 세트이다. E. coli is a set of ABP sequences to determine a range of the difference between the ABP sequences used for the generation and crystal structures for (E. coli).
도 23은 다양한 비닝 결과의 표이다. 23 is a table of various binning results.
도 23a는 다양한 비닝 결과를 도시하는 표의 제1 부분이다. Figure 23a is a table showing a variety of the first portion binning results.
도 23b는 다양한 비닝 결과를 도시하는 표의 제2 부분이다. Figure 23b is a table, the second part showing a different binning results.
도 23c는 다양한 비닝 결과를 도시하는 표의 제3 부분이다. Figure 23c is a table showing a third part of different binning results.
도 23d는 다양한 비닝 결과를 도시하는 표의 제4 부분이다. Figure 23d is a table showing a fourth part of a range of binning results.
도 24a는 비-환원 조건 하의 웨스턴 블롯의 도면이다. Figure 24a is a non-drawing of a Western blot under reducing conditions.
도 24b는 환원 조건 하의 웨스턴 블롯의 도면이다. Figure 24b is a diagram of Western blot under reducing conditions.
도 25a는 PCSK9의 표면 점유율 (coverage)의 도면이다. Figure 25a is a view of a surface occupancy (coverage) of PCSK9.
도 25b는 PCSK9의 표면 점유율의 도면이다. Figure 25b is a view of the surface share of PCSK9.
도 25c는 PCSK9의 표면 점유율의 도면이다. Figure 25c is a view of the surface share of PCSK9.
도 25d는 PCSK9의 표면 점유율의 도면이다. Figure 25d is a view of the surface share of PCSK9.
도 25e는 PCSK9의 표면 점유율의 도면이다. Figure 25e is a view of the surface share of PCSK9.
도 25f는 PCSK9의 표면 점유율의 도면이다. Figure 25f is a view of the surface share of PCSK9.
도 26은 다양한 항체의 에피토프를 검사하기 위해 PCSK9 아미노산 서열 및 PCSK9 변이체 내에서 돌연변이된 모든 잔기의 서열 비교이다. 26 is a sequence comparison of all the mutants within the amino acid sequence of PCSK9 and PCSK9 mutants to test the different epitopes of the antibody moiety.
도 27a는 21B12를 사용하여 PCSK9의 결정 구조 상으로 매핑 (mapping)할 때, 21B12 에피토프 적중 (hit)을 도시한 것이다. Figure 27a is, showing the 21B12 epitope hit (hit) when using the 21B12 to mapping (mapping) onto the crystal structure of PCSK9.
도 27b는 31H4 및 21B1을 사용하여 PCSK9의 결정 구조 상으로 매핑할 때, 31H4 에피토프 적중을 도시한 것이다. Figure 27b is, showing the 31H4 epitope hit when using the 31H4 and 21B1 to be mapped onto the crystal structure of PCSK9.
도 27c는 31H4 및 21B12를 사용하여 PCSK9의 결정 구조 상으로 매핑할 때, 31A4 에피토프 적중을 도시한 것이다. Figure 27c is, showing the 31A4 epitope hit when mapped onto the crystal structure of PCSK9 using the 31H4 and 21B12.
도 27d는 31H4 및 21B12를 사용하여 PCSK9의 결정 구조 상으로 매핑할 때, 12H11 에피토프 적중을 도시한 것이다. Figure 27d is, showing the 12H11 epitope hit when mapped onto the crystal structure of PCSK9 using the 31H4 and 21B12.
도 27e는 31H4 및 21B12를 사용하여 PCSK9의 결정 구조 상으로 매핑할 때, 3C4 에피토프 적중을 도시한 것이다. Figure 27e is, showing the 3C4 epitope hit when mapped onto the crystal structure of PCSK9 using the 31H4 and 21B12.
도 28a는 PCSK9의 다양한 부분에 대한 다양한 ABP의 결합 능력을 입증하는 그래프이다. Figure 28a is a graph demonstrating binding ability of ABP for the various different parts of PCSK9.
도 28b는 PCSK9의 다양한 부분에 대한 다양한 ABP의 결합 능력을 입증하는 그래프이다. Figure 28b is a graph demonstrating binding ability of ABP for the various different parts of PCSK9.
도 28c는 2개의 ABP의 LDLR 결합 능력을 비교하는 그래프이다. Figure 28c is a graph comparing the LDLR binding capacity of the two ABP.
도 28d는 2개의 ABP의 세포 LDL 흡수 활성을 비교하는 그래프이다. Figure 28d is a graph that compares two ABP cellular LDL uptake activity.

PCSK9에 결합하는 항원 결합 단백질 (예를 들어 항체 및 그의 기능적 결합 단편)을 본원에서 개시한다. An antigen binding protein that bind to PCSK9 (for example antibody and a functional binding fragment thereof) disclosed herein. 일부 실시태양에서, 항원 결합 단백질은 PCSK9에 결합하고, 다양한 방식으로 PCSK9가 기능하는 것을 방지한다. In some embodiments, the antigen binding protein is prevented from binding to PCSK9, and, the PCSK9 function in a variety of ways. 일부 실시태양에서, 항원 결합 단백질은 다른 물질과 상호작용하는 PCSK9의 능력을 차단하거나 감소시킨다. In some embodiments, the antigen binding protein to block the ability of the PCSK9 to interact with other materials or reduced. 예를 들어, 일부 실시태양에서, 항원 결합 단백질은 PCSK9가 LDLR에 결합할 가능성을 방지하거나 감소시키는 방식으로 PCSK9에 결합한다. For example, in some embodiments, the antigen binding protein is coupled to a PCSK9 PCSK9 in a manner to prevent or reduce the likelihood of binding to LDLR. 다른 실시태양에서, 항원 결합 단백질은 PCSK9에 결합하지만 LDLR과 상호작용하는 PCSK9의 능력을 차단하지 않는다. In another embodiment, antigen binding proteins binding to PCSK9, but does not block the ability of the PCSK9 LDLR and mutual acting. 일부 실시태양에서, 항원 결합 단백질은 인간 모노클로날 항체이다. In some embodiments, the antigen binding protein is an antibody to a human monoclonal day.

본 명세서에 비추어 당업자가 알 수 있는 바와 같이, PCSK9와 LDLR 사이의 상호작용을 변경시키면 LDL에 결합하기 위해 이용가능한 LDLR의 양을 증가시킬 수 있고, 이는 다시 대상에서 혈청 LDL의 양을 감소시켜, 대상의 혈청 콜레스테롤 수준을 감소시킨다. As can be any person skilled in the art know in view of this specification, when changing the interaction between PCSK9 and LDLR can increase the amount of LDLR available for binding to LDL, which reduces the amount of serum LDL in the back target, It reduces serum cholesterol level of the subject. 따라서, PCSK9에 대한 항원 결합 단백질은 상승된 혈청 콜레스테롤 수준을 갖거나, 상승된 혈청 콜레스테롤 수준의 위험이 있거나, 그들의 혈청 콜레스테롤 수준의 감소가 유익할 수 있는 대상을 치료하기 위한 다양한 방법 및 조성물에서 사용될 수 있다. Thus, antigen binding to PCSK9 protein is to be used in for the treatment of which can have an elevated serum cholesterol level, or the beneficial reduction in the risk or the elevated serum cholesterol levels, their serum cholesterol level target various methods and compositions can. 따라서, 혈청 콜레스테롤을 저하시키거나, 유지하거나, 그의 증가를 방지하기 위한 다양한 방법 및 기술이 본원에서 설명된다. Therefore, lowering serum cholesterol, or maintaining, or a variety of methods and techniques for preventing their increase are described herein. 일부 실시태양에서, 항원 결합 단백질은 PCSK9와 LDLR 사이의 결합을 허용하지만, 항원 결합 단백질은 LDLR에 대한 PCSK9의 불리한 활성을 방지하거나 감소시킨다. In some embodiments, the antigen binding protein allows for the coupling between PCSK9 and LDLR, however, the antigen binding proteins prevent the adverse activity of PCSK9 on LDLR or decrease. 일부 실시태양에서, 항원 결합 단백질은 LDLR에 대한 PCSK9의 결합을 방지하거나 감소시킨다. In some embodiments, the antigen binding protein prevents the binding of PCSK9 on LDLR or decrease.

편의상, 다음 섹션은 본원에서 사용되는 용어의 다양한 의미를 일반적으로 개략한다. For convenience, the following sections are generally outline the various meanings of the terms used herein. 본 논의에 따라, 항원 결합 단백질에 관한 일반적인 측면을 논의한 후, 항원 결합 단백질의 다양한 실시태양의 특성 및 이들을 사용할 수 있는 방식을 입증하는 구체적인 예를 논의한다. According to the present discussion, it will be discussed later discussed the general aspects of the antigen binding proteins, and specific examples to demonstrate various aspects of the solar properties and ways in which people can use the antigen binding protein.

정의 및 실시태양 Definitions and embodiments

상기한 일반적인 설명 및 다음의 상세한 설명이 모두 단지 예시적이고 설명적인 것이고, 청구된 발명의 제한이 아님을 이해해야 한다. Above general description and the will of the following detailed description are exemplary and explanatory only all, it should be understood that not a limitation of the claimed invention. 본원에서, 단수의 사용은 달리 구체적으로 진술하지 않으면 복수를 포함한다. As used herein, use of the singular includes the plural unless specifically stated otherwise. 본원에서, "또는"의 사용은 달리 진술하지 않으면 "및/또는"을 의미하다. As used herein, it is meant to "or" not stated otherwise, if use is "and / or". 또한, 용어 "포함하는" 및 다른 형태, 예를 들어 "포함하다" 및 "포함된"의 사용은 제한하는 것이 아니다. Furthermore, for terminology, and other types "it involves", such as "comprise" and use of "embedded" is not limiting. 또한, "요소" 또는 "성분"과 같은 용어는 구체적으로 달리 진술하지 않으면 하나의 단위를 포함하는 요소 및 성분, 및 하나 초과의 하위단위를 포함하는 요소 및 성분을 모두 포함한다. Further, the terms such as "element" or "component", if not stated otherwise specifically include both elements and components comprising the units of the sub-elements and components comprising one unit, and more than one. 또한, 용어 "부분"의 사용은 모이어티 (moiety)의 일부 또는 전체 모이어티를 포함할 수 있다. In addition, the use of the term "portion" may include some or all of the moieties of moieties (moiety).

본원에서 사용되는 섹션 표제는 단지 설명의 구성을 위한 것이고, 설명된 주제를 제한하는 것으로 해석되어서는 안 된다. Section headings used herein will only for the configuration of the description are not to be construed as, limiting the described subject. 특허, 특허 출원, 기사, 책, 및 논문을 포함하지만 이로 제한되지 않는, 본원에서 인용되는 모든 문헌 또는 문헌의 일부는 임의의 목적으로 그 전문을 본원에 참조로 명백하게 포함시킨다. Patents, patent applications, articles, books, and papers including, but not limited to, some or all of the literature reference cited herein and include explicitly the professional for any purpose herein by reference. 본원에 따라 사용될 때, 다음 용어는 달리 지시하지 않으면 다음의 의미를 갖는 것으로 이해될 것이다: When used according to the present application, the following terms unless otherwise indicated shall be understood to have the following meanings:

용어 "전구단백질 전환효소 섭틸리신 켁신 타입 9" 또는 "PCSK9"는 서열 1 및/또는 3에 제시된 폴리펩티드 또는 그의 단편, 및 관련 폴리펩티드를 나타내고, 이는 대립유전자 변이체, 스플라이스 (splice) 변이체, 유도체 변이체, 치환 변이체, 결실 변이체, 및/또는 N-말단 메티오닌의 부가를 포함한 삽입 변이체, 융합 폴리펩티드, 및 종간 상동체를 포함하고 이로 제한되지 않는다. The term "precursor protein converting enzyme perturbation Tilly new keksin type 9" or "PCSK9" denotes a polypeptide or a fragment thereof, and related polypeptides set out in SEQ ID NO: 1 and / or 3, which allelic variants, splicing (splice) mutant, derivative including variants, substitution variants, deletion variants, and / or insertion variants, fusion polypeptides, including the addition of an N- terminal methionine, and interspecies homologues, and are not limited. 특정 실시태양에서, PCSK9 폴리펩티드는 말단 잔기, 예를 들어 비제한적으로 리더 (leader) 서열 잔기, 표적화 잔기, 아미노 말단 메티오닌 잔기, 라이신 잔기, 태그 (tag) 잔기 및/또는 융합 단백질 잔기를 포함한다. In certain embodiments, the PCSK9 polypeptide includes terminal residues, such as, but not limited to, leader (leader) sequence residues, targeting residues, amino terminal methionine residues, lysine residues, tag (tag) residues and / or fusion protein residues. "PCSK9"는 또한 FH3, NARC1, HCHOLA3, 전구단백질 전환효소 섭틸리신/켁신 타입 9, 및 신경 세포자멸 조절된 전환효소 1로서 언급되었다. "PCSK9" has also been referred to as FH3, NARC1, HCHOLA3, precursor protein converting enzyme Sup Shin Tilly / keksin type 9, and nerve cell apoptosis in a conversion enzyme control 1. PCSK9 유전자는 분비형 섭틸라제 패밀리의 프로테이나제 K 하위패밀리에 속하는 전구단백질 전환효소 단백질을 코딩한다. The PCSK9 gene encoding a precursor protein converting enzyme protein belonging to secreted proteinase K sub-family of seoptil cyclase family. 용어 "PCSK9"는 전구단백질, 및 전구단백질의 자가 촉매 반응 후에 생성된 생성물 모두를 나타낸다. The term "PCSK9" denotes both the precursor protein, and the resulting product of a precursor protein, after self-catalytic reaction. 자가촉매된 생성물만을 언급할 때 (예를 들어, 절단된 PCSK9에 선택적으로 결합하는 항원 결합 단백질에 대해), 단백질은 "성숙", "절단된", "처리된 (processed)" 또는 "활성" PCSK9로서 언급할 수 있다. When mentioning the self-catalysed product (e. G., For antigen binding protein that binds selectively to the cut PCSK9), proteins are "mature", "truncated", "processed (processed)" or "active" It can be referred to as PCSK9. 비활성 형태만을 언급할 때, 단백질은 "비활성", "전구-형태 (pro-form)", 또는 "비처리된" 형태의 PCSK9로서 언급할 수 있다. When mentioning the inactive form of the protein is "inactive", - may be referred to as "bulb form (pro-form)", or "non-treatment" in the form of PCSK9. 본원에서 사용될 때 용어 PCSK9는 또한 천연 발생 대립유전자, 예를 들어 돌연변이 D374Y, S127R 및 F216L을 포함한다. As used herein the term PCSK9 also includes a naturally-occurring alleles, e.g., mutant D374Y, S127R and F216L. 용어 PCSK9는 또한 PCSK9 아미노산 서열의 번역후 변형을 포함한 PCSK9 분자, 예를 들어 글리코실화된, PEG화된 PCSK9 서열, 그로부터 그의 신호 서열이 절단된 PCSK9 서열, 그로부터 그의 전구-도메인이 촉매 도메인으로부터 절단되지만 촉매 도메인으로부터 분리되지 않은 PCSK9 서열을 포함한다 (예를 들어, 도 1a 및 1b-1e). The term PCSK9 also PCSK9 amino acid after translation of the sequence PCSK9 molecules, including modified, e.g., glycosylated, PEG qualified PCSK9 sequence, from which his signal sequence is cut PCSK9 sequence, from which its bulb-domain, but cut from the catalytic domain catalyst include PCSK9 sequence that is not separated from the domain (e. g., Figures 1a and 1b-1e).

용어 "PCSK9 활성"은 PCSK9의 임의의 생물학적 효과를 포함한다. The term "PCSK9 activity" includes any biological effect of PCSK9. 특정 실시태양에서, PCSK9 활성은 기질 또는 수용체와 상호작용하거나 그에 결합하는 PCSK9의 능력을 포함한다. In certain embodiments, PCSK9 activity, or interacts with the substrate or the receptor it includes the ability of the PCSK9 that binds thereto. 일부 실시태양에서, PCSK9 활성은 LDL 수용체 (LDLR)에 결합하는 PCSK9의 능력에 의해 나타내어진다. In some embodiments, PCSK9 activity is represented by the ability of the PCSK9 binding to the LDL receptor (LDLR). 일부 실시태양에서, PCSK9는 LDLR에 결합하여 그를 수반하는 반응을 촉매한다. In some embodiments, PCSK9 catalyzes the reaction for binding to LDLR accompanying him. 일부 실시태양에서, PCSK9 활성은 LDLR의 이용률을 변경시키는 (예를 들어, 감소시키는) PCSK9의 능력을 포함한다. In some embodiments, PCSK9 activity (e. G., Reduce) the ability of the PCSK9 to change the usage rate of the LDLR. 일부 실시태양에서, PCSK9 활성은 대상에서 LDL의 양을 증가시키는 PCSK9의 능력을 포함한다. In some embodiments, the PCSK9 activity includes the ability of the PCSK9 to increase the amount of LDL in the subject. 일부 실시태양에서, PCSK9 활성은 LDL에 결합하도록 이용가능한 LDLR의 양을 감소시키는 PCSK9의 능력을 포함한다. In some embodiments, PCSK9 activity includes the ability of the PCSK9 to reduce the amount of LDLR available to bind to LDL. 일부 실시태양에서, "PCSK9 활성"은 PCSK9 신호전달로부터 생성되는 임의의 생물학적 활성을 포함한다. In some embodiments, "PCSK9 activity" includes any biological activity resulting from the PCSK9 signaling. 예시적인 활성은 LDLR에 대한 PCSK9 결합, LDLR 또는 다른 단백질을 절단하는 PCSK9 효소 활성, PCSK9 작용을 용이하게 하는 LDLR 이외의 단백질에 대한 PCSK9 결합, APOB 분비를 변경시키는 PCSK9 ([Sun XM et al., "Evidence for effect of mutant PCSK9 on apoliprotein B secretion as the cause of unusually severe dominant hypercholesterolemia, Human Molecular Genetics 14: 1161-1169, 2005] 및 [Ouguerram K et al., "Apolipoprotein B100 metabolism in autosomal-dominant hypercholesterolemia related to mutations in PCSK9, Arterioscler thromb Vase Biol. 24: 1448-1453, 2004]), 간 재생 및 뉴런 세포 분화에서 PCSK9의 역할 (Seidah NG et al., "The secretory proprotein convertase neural apoptosis-regulated convertase 1 (NARC-1): Liver regeneration and neuronal differentiation" PNAS 100: 928-933, 2003), 및 간 글루코스 대사에서 PCSK9의 역할 (Costet et al., "Hepatic PCSK9 expression is regulated by nutritional status via insulin and s PCSK9 ([Sun XM et al. For example activity of PCSK9 binding to a protein other than the LDLR that facilitates PCSK9 binding, PCSK9 activity, PCSK9 action of cutting the LDLR or other protein for the LDLR, change the APOB secretion, "Evidence for effect of mutant PCSK9 on apoliprotein B secretion as the cause of unusually severe dominant hypercholesterolemia, Human Molecular Genetics 14:. 1161-1169, 2005] and [Ouguerram K et al," Apolipoprotein B100 metabolism in autosomal-dominant hypercholesterolemia related to mutations in PCSK9, Arterioscler thromb Vase Biol 24:. 1448-1453, 2004]), the role of PCSK9 in liver regeneration and neuronal cell differentiation (Seidah NG et al, "the secretory proprotein convertase neural apoptosis-regulated convertase 1 (NARC-. 1): liver regeneration and neuronal differentiation "PNAS 100:. 928-933, 2003), and the role of PCSK9 in liver glucose metabolism (Costet et al," Hepatic PCSK9 expression is regulated by nutritional status via insulin and s terol regulatory element-binding protein Ic" J. Biol. Chem. 281(10):6211-18. 2006)을 포함하고 이로 제한되지 않는다. .. Terol regulatory element-binding protein Ic "J. Biol Chem 281 (10):. 6211-18 does not include a 2006) and limited.

본원에서 사용될 때 용어 "고콜레스테롤혈증"은 콜레스테롤 수준이 목적하는 수준을 넘어 상승된 상태를 나타낸다. As used herein the term "hypercholesterolemia" refers to a state of elevated beyond the level of cholesterol level objectives. 일부 실시태양에서, 상기 용어는 혈청 콜레스테롤 수준이 상승된 것을 나타낸다. In some embodiments, the term indicates that the serum cholesterol level elevated. 일부 실시태양에서, 목적하는 수준은 당업자에게 공지된 (그리고 본원에 설명되고 언급된) 다양한 "위험 인자"를 고려한다. In some embodiments, the desired level, which takes into account the number of "risk factors" a (and described herein is referred to) known to those skilled in the art.

용어 "폴리뉴클레오티드" 또는 "핵산"은 단일 가닥 및 이중 가닥 뉴클레오티드 중합체를 모두 포함한다. The term "polynucleotide" or "nucleic acid" includes both single-stranded and double-stranded nucleotide polymer. 폴리뉴클레오티드를 구성하는 뉴클레오티드는 리보뉴클레오티드 또는 데옥시리보뉴클레오티드, 또는 두 종류의 뉴클레오티드의 변형된 형태일 수 있다. Nucleotides constituting the polynucleotide may be a modified form of ribonucleotide or deoxyribonucleic nucleotides, or both types of nucleotides. 상기 변형은 염기 변형, 예를 들어 브로모유리딘 및 이노신 유도체, 리보스 변형, 예를 들어 2',3'-디데옥시리보스, 및 뉴클레오티드간 연결 변형, 예를 들어 포스포로티오에이트, 포스포로디티오에이트, 포스포로셀레노에이트, 포스포로디셀레노에이트, 포스포로아닐로티오에이트, 포스포르아닐라데이트 및 포스포로아미데이트를 포함한다. The transformation base variation, such as bromo-uridine and inosine derivatives, ribose modifications such as 2 ', 3'-dideoxy-ribose, and the connection between the modified nucleotides, such as phosphorothioate, phosphorothioate dt O benzoate, a phosphorothioate seleno benzoate, phosphorothioate di seleno benzoate, la force thio benzoate, not phosphoramidite captive not date and phosphorothioate amidate.

용어 "올리고뉴클레오티드"는 200개 이하의 뉴클레오티드를 포함하는 폴리뉴클레오티드를 의미한다. The term "oligonucleotide" refers to a polynucleotide comprising nucleotides 200 or fewer. 일부 실시태양에서, 올리고뉴클레오티드는 길이가 10 내지 60개 염기이다. In some embodiments, the oligonucleotide is a length of 10-60 bases. 다른 실시태양에서, 올리고뉴클레오티드는 길이가 12, 13, 14, 15, 16, 17, 18, 19, 또는 20 내지 40개 뉴클레오티드이다. In another embodiment, the oligonucleotide is a length of 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides. 올리고뉴클레오티드는 예를 들어, 돌연변이체 유전자의 제작에서 사용하기 위한 단일 가닥 또는 이중 가닥일 수 있다. The oligonucleotide can be, for example, single-stranded or double-stranded for use in the production of a mutant gene. 올리고뉴클레오티드는 센스 또는 안티센스 올리고뉴클레오티드일 수 있다. Oligonucleotides may be sense or antisense oligonucleotides. 올리고뉴클레오티드는 검출 분석을 위한 방사성 표지, 형광 표지, 합텐 또는 항원성 표지를 포함한 표지를 포함할 수 있다. The oligonucleotide can include a label, including radioactive labels, fluorescent labels, hapten or antigenic markers for detection analysis. 올리고뉴클레오티드는 예를 들어, PCR 프라이머, 클로닝 프라이머 또는 혼성화 프로브로서 사용될 수 있다. Oligonucleotides can be used, for example, as PCR primers, cloning primer or hybridization probe.

"단리된 핵산 분자"는 단리된 폴리뉴클레오티드가 자연에서 발견되는 폴리뉴클레오티드의 전부 또는 일부와 회합되지 않거나, 자연에서 그가 연결되지 않은 폴리뉴클레오티드에 연결되는 게놈의 DNA 또는 RNA, mRNA, cDNA, 또는 합성 기원 또는 이들의 몇몇 조합을 의미한다. "An isolated nucleic acid molecule" is the isolated polynucleotide is either not associated with all or a portion of a polynucleotide found in nature, of the genome of which is connected in a natural polynucleotide he is not associated DNA or RNA, mRNA, cDNA, or synthetic the origin or meaning some combination thereof. 본원의 목적에서, 특정 뉴클레오티드 서열을 "구성하는 핵산 분자"는 무손상 염색체를 포함하지 않음을 이해해야 한다. It should be understood for the purpose of the present application, "nucleic acid molecules configured to" a particular nucleotide sequence does not contain an intact chromosome. 명시된 핵산 서열을 "구성하는" 단리된 핵산 분자는 명시된 서열에 추가로, 10 이하 또는 심지어 20 이하의 다른 단백질 또는 그의 일부에 대한 코딩 서열을 포함할 수 있거나, 인용된 핵산 서열의 코딩 구역의 발현을 제어하는 작동가능하게 연결된 조절 서열을 포함할 수 있고/있거나 벡터 서열을 포함할 수 있다. Further specified nucleic acid sequence in a nucleic acid molecule specified in SEQ ID NO isolated "configuring", not more than 10 or even may comprise a coding sequence for a different protein or a portion thereof of less than or equal to 20, the coding expression of the zone of the cited nucleic acid sequences operation may comprise a possibly associated control sequences and / or for controlling may comprise a vector sequence.

달리 명시하지 않으면, 본원에서 논의되는 임의의 단일 가닥 폴리뉴클레오티드 서열의 좌측 단부는 5' 단부이고; Unless otherwise indicated, the left end of any single-stranded polynucleotide sequences discussed herein is the 5 'end and; 이중 가닥 폴리뉴클레오티드 서열의 좌측 방향은 5' 방향으로서 언급된다. The left-hand direction of double-stranded polynucleotide sequence is referred to as the 5 'direction. 초기 (nascent) RNA 전사체의 5'에서 3'으로의 부가 방향은 전사 방향으로서 언급되고; Initial (nascent) adding direction of the "3 in the" 5 of RNA transcripts is referred to as the transcription direction; RNA 전사체의 5' 단부에 5'인 RNA 전사체와 동일한 서열을 갖는 DNA 가닥 상의 서열 구역은 "상류 서열"로서 언급되고; Sequence area on the DNA strand having the same sequence as the RNA transcript 5 'end to 5' of the RNA transcript are referred to as "upstream sequences"; RNA 전사체의 3' 단부에 3'인 RNA 전사체와 동일한 서열을 갖는 DNA 가닥 상의 서열 구역은 "하류 서열"로서 언급된다. Sequence area on the DNA strand having the same sequence as the RNA transcript 3 'end to the 3' of the RNA transcript are referred to as "downstream sequences".

용어 "제어 서열"은 그가 라이게이팅되는 코딩 서열의 발현 및 처리에 영향을 미칠 수 있는 폴리뉴클레오티드 서열을 나타낸다. The term "control sequence" refers to polynucleotide sequences that can affect the expression and processing of coding sequences that lie he gating. 그러한 제어 서열의 성질은 숙주 유기체에 따라 좌우될 수 있다. Nature of such control sequences may depend on the host organism. 특정 실시태양에서, 원핵생물에 대한 제어 서열은 프로모터, 리보솜 결합 부위, 및 전사 종결 서열을 포함할 수 있다. In certain embodiments, control sequences for prokaryotes may include promoter, ribosomal binding site, and a transcription termination sequence. 예를 들어, 진핵생물에 대한 제어 서열은 전사 인자, 전사 인핸서 (enhancer) 서열, 및 전사 종결 서열에 대한 하나 또는 다수의 인식 부위를 포함한 프로모터를 포함할 수 있다. For example, control sequences for eukaryotes may include promoters comprising one or a plurality of recognition sites for transcription factors, transcription enhancer (enhancer) sequence, and a transcription termination sequence. "제어 서열"은 리더 서열 및/또는 융합 파트너 서열을 포함할 수 있다. "Control sequences" can include leader sequences and / or fusion partner sequences.

용어 "벡터"는 단백질 코딩 정보를 숙주 세포 내로 전달하기 위해 사용되는 임의의 분자 또는 엔티티 (entity) (예를 들어, 핵산, 플라스미드, 박테리오파지 또는 바이러스)를 의미한다. The term "vector" refers to any molecule or entity (entity) (e.g., nucleic acid, plasmid, bacteriophage, or virus) used to transfer protein-coding information into a host cell.

용어 "발현 벡터" 또는 "발현 구성체"는 숙주 세포의 형질전환에 적합한 벡터를 나타내고, 그에 작동가능하게 연결된 하나 이상의 이종성 코딩 구역의 발현을 (숙주 세포와 연관하여) 지시하고/하거나 제어하는 핵산 서열을 함유한다. The term "expression vector" or "expression construct" is a nucleic acid that directs expression of a host cell heterologous coding section represents a vector suitable for the transformation, one or more coupled to it operating in the (in association with the host cell), and / or control sequences It contains. 발현 구성체는 그에 작동가능하게 연결된 코딩 구역의 전사, 번역에 영향을 미치거나 제어하고, 인트론이 존재하는 경우에 상기 코딩 구역의 RNA 스플라이싱 (splicing)에 영향을 미치는 서열을 포함할 수 있고 이로 제한되지 않는다. Expression construct may comprise a sequence affecting RNA splicing (splicing) of the coding section in the case of insane or control the transcription, effects on translation of the coding section coupled to it operates and the intron is present which not limited.

본원에서 사용될 때 "작동가능하게 연결된"은 용어가 적용되는 성분들이 적합한 조건 하에 그들의 고유한 기능을 수행하도록 하는 관계에 있는 것을 의미한다. Means in relation to that under suitable are "operably linked" are the components in which the term applies to terms as used herein perform their unique function. 예를 들어, 단백질 코딩 서열에 "작동가능하게 연결된" 벡터 내의 제어 서열은 제어 서열의 전사 활성에 적합한 조건 하에 단백질 코딩 서열의 발현이 달성되도록 그에 라이게이팅된다. For example, the protein coding sequence "operably linked" control sequences within the vector such that it is gated Lai achieve expression of the protein coding sequence under conditions suitable for transcription activity of the control sequences.

용어 "숙주 세포"는 핵산 서열을 사용하여 형질전환된 또는 형질전환될 수 있어서 관심있는 유전자를 발현하는 세포를 의미한다. The term "host cell" means the cells expressing the gene to be able to turn transformed or transfected with a nucleic acid sequence of interest. 상기 용어는 관심있는 유전자가 존재하는 한 자손체가 형태학 또는 유전자 구성에서 원래의 모 세포에 동일하든지 동일하지 않든지 모 세포의 자손체를 포함한다. The term includes the progeny of any not the same either identical to the original parent cell morphology or in genetic body is a progeny of the gene of interest exists, the parent cell configuration.

용어 "형질감염"은 세포에 의한 외래 또는 외인성 DNA의 흡수를 의미하고, 세포는 외인성 DNA가 세포막 내부에 도입될 때 "형질감염된다". The term "transfection" means the uptake of foreign or exogenous DNA by a cell, the cell is an exogenous DNA "is transfected" when introduced inside the cell membrane. 많은 형질감염 기술이 당업계에 잘 공지되어 있고 본원에 개시되어 있다 (예를 들어, 문헌 [Graham et al., 1973, Virology 52:456]; [Sambrook et al., 2001, Molecular Cloning: A Laboratory Manual, 상기 문헌]; [Davis et al., 1986, Basic Methods in Molecular Biology, Elsevier]; [Chu et al., 1981, Gene 13:197] 참조). Many transfection are well known in the art, infected techniques and are disclosed herein (see, e.g., [Graham et al, 1973, Virology 52: 456.]; [Sambrook et al, 2001, Molecular Cloning:. A Laboratory reference 197]):. Manual, supra]; [Chu et al, 1981, Gene 13; [Davis et al, 1986, Basic Methods in Molecular Biology, Elsevier].. 그러한 기술은 하나 이상의 외인성 DNA 모이어티를 적합한 숙주 세포 내로 도입하기 위해 사용될 수 있다. Such techniques may be used to introduce into a suitable host cell, one or more exogenous DNA moieties.

용어 "형질전환"은 세포의 유전자 특징을 변화시키는 것을 의미하고, 세포는 새로운 DNA 또는 RNA를 함유하도록 변형될 때 형질전환된다. Term means that "transfection" is the genetic variation characteristic of the cells, and cells are transformed when modified to contain a new DNA or RNA. 예를 들어, 세포는 형질감염, 형질도입, 또는 다른 기술을 통해 새로운 유전 물질을 도입함으로써 그의 천연 상태로부터 유전적으로 변형되는 경우에 형질전환된다. For example, cells are transfected when the genetically modified from its native state by the introduction of new genetic material via transfection, transduction, or other techniques. 형질감염 또는 형질도입 후에, 형질전환하는 DNA는 세포의 염색체 내로 물리적으로 통합함으로써 세포의 DNA와 재조합될 수 있거나, 복제되지 않으면서 에피좀 요소로서 일시적으로 유지될 수 있거나, 플라스미드로서 독립적으로 복제될 수 있다. After transfection or transduction, transfection DNA to switch by integrating physically into the chromosome of the cell or may be recombinant, and the cell DNA, without being replicated, or may be temporarily held in an epi-bit elements, to be independently replicate as a plasmid can. 세포는 형질전환하는 DNA가 세포의 분열과 함께 복제될 때 "안정하게 형질전환된" 것으로 간주된다. Cells are considered when the DNA to be replicated with the division of the transgenic cell to be "stably transformed".

용어 "폴리펩티드" 또는 "단백질"은 천연 단백질, 즉, 천연 발생 세포 및 비-재조합 세포에 의해 생산되는 단백질의 아미노산 서열을 갖는 거대분자를 의미하거나; The term "polypeptide" or "protein" is a native protein, that is, naturally occurring cells and non-sense macromolecules having the amino acid sequence of the protein produced by the recombinant cell or; 유전공학 처리된 세포 또는 재조합 세포에 의해 생산되고, 천연 단백질의 아미노산 서열을 갖는 분자, 또는 천연 서열의 하나 이상의 아미노산으로부터 결실, 그에 대한 부가, 및/또는 치환을 갖는 분자를 포함한다. It produced by a genetically engineered cell or a recombinant cell, a deletion, molecules having additional, and / or substituted to it from at least one amino acid of the molecule, or a native sequence having the amino acid sequence of the native protein. 상기 용어는 또한 하나 이상의 아미노산이 대응하는 천연 발생 아미노산 및 중합체의 화학적 유사체인 아미노산 중합체를 포함한다. The term also includes a chemically similar amino acid chain of a naturally occurring amino acid polymers and polymers in which one or more amino acid correspondence. 용어 "폴리펩티드" 및 "단백질"은 구체적으로 항원-결합 단백질의 하나 이상의 아미노산으로부터 결실, 그에 대한 부가, 및/또는 치환을 갖는 PCSK9 항원 결합 단백질, 항체, 또는 서열을 포함한다. The term "polypeptide" and "protein" is specifically antigen-containing fruit, PCSK9 antigen binding proteins, antibodies, or sequences having addition, and / or substituted to it from one or more amino acids of the binding protein. 용어 "폴리펩티드 단편"은 전장 천연 단백질에 비해 아미노-말단 결실, 카르복실-말단 결실, 및/또는 내부 결실을 갖는 폴리펩티드를 나타낸다. The term "polypeptide fragment" is amino as compared to full-length native protein - shows a polypeptide having terminal deletion, and / or an internal deletion-terminal deletion, a carboxyl. 그러한 단편은 또한 천연 단백질에 비해 변형된 아미노산을 함유할 수 있다. Such fragments may also contain amino acid modifications compared to the native protein. 특정 실시태양에서, 단편은 길이가 약 5 내지 500개 아미노산이다. In certain embodiments, the fragment length is about 5 to 500 amino acids. 예를 들어, 단편은 길이가 적어도 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, 또는 450개 아미노산이다. For example, the fragment length is at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 110, 150, 200, 250, 300, 350, 400, or 450 amino acids. 유용한 폴리펩티드 단편은 항체의 면역학상 기능적 단편, 예를 들어 결합 도메인을 포함한다. Useful polypeptide fragments include, for Immunology the functional fragment of the antibody, for example, comprises a binding domain. PCSK9-결합 항체의 경우에, 유용한 단편은 CDR 구역, 중쇄 및/또는 경쇄의 가변 도메인, 항체 사슬의 부분 또는 단지 2개의 CDR을 포함하는 그의 가변 구역 등을 포함하고 이로 제한되지 않는다. A PCSK9- for binding antibody, useful fragments include their variable regions containing the CDR zone, heavy and / or light chain of the variable domain, part of an antibody chain or only two CDR and without limitation.

용어 "단리된 단백질"은 대상 단백질이 (1) 정상적으로 발견될 적어도 일부의 다른 단백질이 없거나, (2) 동일한 공급원으로부터, 예를 들어, 동일한 종으로부터의 다른 단백질이 본질적으로 없거나, (3) 상이한 종으로부터의 세포에 의해 발견되거나, (4) 자연에서 그와 회합되는 폴리뉴클레오티드, 지질, 탄수화물, 또는 다른 물질의 적어도 약 50%로부터 분리되거나, (5) 자연에서 회합되지 않은 폴리펩티드와 (공유 또는 비공유 상호작용에 의해) 작동가능하게 회합되거나, (6) 자연에서 발생하지 않는 것을 의미한다. The term "isolated protein" is the protein of (1) or normally at least another protein part is found, (2) from the same source, e.g., other proteins from the same species, or in essence, 3 different or detected by a cell from a species, (4) or separated from at least about 50 percent of polynucleotides, lipids, carbohydrates, or other material that is in association with it in nature, (5) a polypeptide (shared or not associated in nature by non-covalent interactions), or possibly the associated operation, (6) means which does not occur in nature. 대개, "단리된 단백질"은 주어진 샘플의 적어도 약 5%, 적어도 약 10%, 적어도 약 25%, 또는 적어도 약 50%를 구성한다. Usually, an "isolated protein" constitutes at least about 5%, at least about 10%, at least about 25%, or at least about 50% of a given sample. 게놈 DNA, cDNA, mRNA, 또는 합성 기원의 다른 RNA, 또는 그의 임의의 조합은 상기 단리된 단백질을 코딩할 수 있다. Other RNA genome, or a any combination of DNA, cDNA, mRNA, or synthetic origin can be isolated encoding the said protein. 바람직하게는, 단리된 단백질에는 그의 치료, 진단, 예방, 연구 또는 다른 용도를 저해할, 그의 천연 환경에서 발견되는 단백질 또는 폴리펩티드 또는 다른 오염물질이 실질적으로 없다. Preferably, the isolated protein is to inhibit its therapeutic, diagnostic, preventive, research or other purposes, it is substantially free of proteins or polypeptides or other contaminants that are found in its natural environment.

용어 "아미노산"은 당업계에서 그의 일반적인 의미를 포함한다. The term "amino acid" includes its normal meaning in the art.

폴리펩티드 (예를 들어, 항원 결합 단백질, 또는 항체)의 "변이체"는 하나 이상의 아미노산 잔기가 다른 폴리펩티드 서열에 비해 아미노산 서열 내로 삽입되고/되거나 그로부터 결실되고/되거나 치환되는 아미노산 서열을 포함한다. Polypeptide (e. G., Antigen binding protein, or antibody), "variant" is an amino acid in which one or more amino acid residues inserted into the amino acid sequence relative to another polypeptide sequence and / or deleted therefrom and / or substitution of sequences. 변이체는 융합 단백질을 포함한다. Variants include fusion proteins.

용어 "동일성"은 서열들을 정렬하고 비교함으로써 결정할 때 2개 이상의 폴리펩티드 분자 또는 2개 이상의 핵산 분자의 서열들 사이의 관계를 나타낸다. The term "identity" is determined by aligning the sequences, when comparing shows the relationship between two or more sequences of the polypeptide molecules or two or more nucleic acid molecules. "동일성 비율"은 비교된 분자 내의 아미노산 또는 뉴클레오티드 사이의 동일한 잔기의 비율을 의미하고, 비교되는 분자 중 최소의 것의 크기를 기초로 하여 계산한다. "Equivalence ratio" is calculated on the basis of the minimum size of one of the molecules of which the percentage of same residues, and comparison between the amino acid or nucleotide in the compared molecules. 이들 계산을 위해, 정렬 내의 갭 (gap) (존재할 경우)은 바람직하게는 특정 수학 모델 또는 컴퓨터 프로그램 (즉, "알고리즘")에 의해 어드레싱 (addressing)된다. For these calculations, the gap (gap) in the alignment (if any) is preferably addressed (addressing) by a particular mathematical model or computer program (i.e., "algorithms"). 정렬된 핵산 또는 폴리펩티드의 동일성을 계산하기 위해 사용할 수 있는 방법은 문헌 ([Computational Molecular Biology, (Lesk, AM, ed.), 1988, New York: Oxford University Press]; [Biocomputing Informatics and Genome Projects, (Smith, DW, ed.), 1993, New York: Academic Press]; [Computer Analysis of Sequence Data, Part I, (Griffin, AM, and Griffin, HG, eds.), 1994, New Jersey: Humana Press]; [von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press]; [Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds.), 1991, New York: M. Stockton Press]; 및 [Carillo et al., 1988, SIAM J. Applied Math. 48:1073])에 기재된 것을 포함한다. Methods that can be used to calculate the identity of the nucleic acid or polypeptide alignment literature ([Computational Molecular Biology, (Lesk, AM, ed), 1988, New York:. Oxford University Press]; [Biocomputing Informatics and Genome Projects, ( . smith, DW, ed), 1993, New York: Academic Press]; [Computer Analysis of Sequence Data, Part I, (Griffin, AM, and Griffin, HG, eds), 1994, New Jersey:. Humana Press]; [von Heinje, G., 1987, Sequence Analysis in Molecular Biology, New York: Academic Press]; [Sequence Analysis Primer, (Gribskov, M. and Devereux, J., eds.), 1991, New York: M. Stockton include those described in 1073]) and [Carillo et al, 1988, SIAM J. Applied Math 48; Press]...

동일성 비율의 계산시에, 비교되는 서열들은 대개 서열들 사이의 최대 매치 (match)를 제공하는 방식으로 정렬된다. In the calculation of the equivalence ratio, compared to the sequence it is usually arranged in such a manner as to provide a maximum match (match) between the sequences. 동일성 비율을 결정하기 위해 사용할 수 있는 컴퓨터 프로그램의 한 예는 GCG 프로그램 패키지이고, 이는 GAP (Devereux et al., 1984, Nucl. Acid Res. 12:387; 제네틱스 컴퓨터 그룹 (Genetics Computer Group, 위스콘신 대학교 (University of Wisconsin, 미국 위스콘신주 매디슨))를 포함한다. 컴퓨터 알고리즘 GAP은 서열 동일성 비율을 결정해야할 2개의 폴리펩티드 또는 폴리뉴클레오티드를 정렬시키기 위해 사용된다. 서열들은 그들의 각각의 아미노산 또는 뉴클레오티드의 최적 매칭을 위해 정렬된다 (알고리즘에 의해 결정될 때 "매칭된 스팬 (span)"). 갭 개방 패널티 (3x 평균 대각 (average diagonal)으로서 계산됨, 여기서 "평균 대각"은 사용되는 비교 행렬의 대각의 평균이고; "대각"은 특정 비교 행렬에 의해 각각의 완전한 아미노산 매치에 지정된 스코어 또는 수이다) 및 갭 연장 패 . An example of which can be used to determine identity percentage computer program GCG program package, which (Devereux et al GAP, and 1984, Nucl Acid Res 12:.. 387; Genetics Wisconsin Computer Group (Genetics Computer Group, University ( and a University of Wisconsin, USA, Wisconsin, Madison)) computer algorithm GAP is used to align the two polypeptides or polynucleotides do determine the sequence identity percentage. sequences for optimal matching of their respective amino acids or nucleotides . aligned calculated as a gap opening penalty (3x the average diagonal (average diagonal) ( "matched span (span)" as determined by the algorithm), wherein the "average diagonal" is the average of the comparison matrix diagonal are used; " diagonal "is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension L 티 (대체로 갭 개방 패널티의 1/10배임), 및 비교 행렬, 예를 들어 PAM 250 또는 BLOSUM 62를 알고리즘과 연관하여 사용한다. 특정 실시태양에서, 표준 비교 행렬 (PAM 250 비교 행렬에 대해 문헌 [Dayhoff et al., 1978, Atlas of Protein Sequence and Structure 5:345-352]; BLOSUM 62 비교 행렬에 대해 문헌 [Henikoff et al., 1992, Proc. Natl. Acad. Sci. USA 89:10915-10919] 참조)을 또한 알고리즘에 의해 사용한다. T (usually 1/10 times the gap opening penalty), and comparison matrices, for instance in the literature for use in relation to the PAM 250 or BLOSUM 62 and the algorithm. In certain embodiments, a standard comparison matrix (PAM 250 comparison matrix [ . Dayhoff et al, 1978, Atlas of Protein Sequence and Structure 5: 345-352]; BLOSUM 62 comparison matrix for the literature [Henikoff et al, 1992, Proc Natl Acad Sci USA 89:..... 10915-10919] reference) to be also used by the algorithm.

GAP 프로그램을 이용하여 폴리펩티드 또는 뉴클레오티드 서열에 대한 동일성 비율을 결정하는데 사용할 수 있는 파라미터의 예는 다음과 같다: Examples of parameters that can be used using the GAP program to determine the identity percentage to a polypeptide or nucleotide sequence is as follows:

- 알고리즘: [Needleman et al., 1970, J. Mol. - Algorithm:. [Needleman et al, 1970, J. Mol. Biol. Biol. 48:443-453]; 48: 443-453;

- 비교 행렬: 문헌 [Henikoff et al., 1992, 상기 문헌]으로부터 BLOSUM 62; Comparison matrix: BLOSUM from the literature [. Henikoff et al, 1992, supra 62;

- 갭 패널티: 12 (그러나, 단부 갭에 대해서는 패널티가 없음); -Gap penalty: 12 (however, there is no penalty for end gaps);

- 갭 길이 패널티: 4; - Gap-length penalty: 4;

- 유사성의 역치: 0. - Threshold of Similarity: 0.

2개의 아미노산 서열들을 정렬하기 위한 특정 정렬 계획은 2개의 서열의 단지 짧은 구역의 매칭을 생성시킬 수 있고, 상기 작은 정렬된 구역은 2개의 전장 서열들 사이에 유의한 관계가 없는 경우에라도 매우 높은 서열 동일성을 가질 수 있다. 2 certain alignment to align two amino acid sequences plan two only can be generated to match the short section of the sequence, and the small-aligned areas is two full length even in very high sequence if there is no significant relationship between the sequence It may have an identity. 따라서, 선택된 정렬 방법 (GAP 프로그램)은 표적 폴리펩티드의 적어도 50개 또는 다른 수의 연속 아미노산에 이르는 정렬을 생성하도록 원하는 경우에 조정될 수 있다. Accordingly, the selected alignment method (GAP program) can be adjusted if desired to produce the align up to consecutive amino acids of at least 50 of the target polypeptide, or can be different.

본원에서 사용될 때, 20개의 통상적인 (예를 들어, 천연 발생) 아미노산 및 그들의 약어는 통상적인 관례에 따른다 (임의의 목적으로 본원에 참조로 포함시킨 문헌 [Immunology-A Synthesis (2nd Edition, ES Golub and DR Gren, Eds., Sinauer Associates, Sunderland, Mass. (1991))] 참조). As used herein, the twenty conventional (e. G., Naturally occurring) amino acids and their abbreviations follow conventional practices (described which are incorporated by reference herein for any purpose [Immunology-A Synthesis (2nd Edition, ES Golub and DR. Gren, Eds., Sinauer Associates, Sunderland, Mass (1991))] reference). 20개의 통상적인 아미노산의 입체이성질체 (예를 들어, D-아미노산), 비천연 아미노산, 예를 들어 α-, α-이치환된 아미노산, N-알킬 아미노산, 락트산, 및 다른 비통상적인 아미노산이 또한 본 발명의 폴리펩티드에 적합한 성분일 수 있다. Of the twenty conventional amino acids stereoisomers (e.g., D- amino acids), non-natural amino acids such as α-, α- disubstituted The amino acids, N- alkyl amino acids, lactic acid, and other unconventional amino acids also present It may be suitable components for polypeptides of the invention. 비통상적인 아미노산의 예는 4-히드록시프롤린, γ-카르복시글루타메이트, ε-N,N,N-트리메틸라이신, ε-N-아세틸라이신, O-포스포세린, N-아세틸세린, N-포르밀메티오닌, 3-메틸히스티딘, 5-히드록시라이신, σ-N-메틸아르기닌, 및 다른 유사한 아미노산 및 이미노산 (예를 들어, 4-히드록시프롤린)을 포함한다. Examples of unconventional amino acids include 4-hydroxyproline, γ- carboxy glutamate, ε-N, N, N- trimethyl-lysine, ε-acetyl-lysine N-, O- force porcelain, N- acetyl-serine, N- formyl methionine, include 3-methyl-histidine, 5-hydroxy-lysine, σ-N- methyl-arginine, and other similar amino acids and already acid (e. g., 4-hydroxyproline). 본원에서 사용되는 폴리펩티드 표기에서, 표준 관례 및 관습에 따라 좌측 방향은 아미노 말단 방향이고, 우측 방향은 카르복시-말단 방향이다. In the polypeptide notation used herein, the left direction in accordance with standard practice, and practice is the amino terminal direction and the right-hand direction is the carboxy-terminal direction is.

유사하게, 달리 명시하지 않으면, 단일 가닥 폴리뉴클레오티드 서열의 좌측 단부는 5' 단부이고; Similarly, unless otherwise specified, the left end of single-stranded polynucleotide sequences is the 5 'end and; 이중 가닥 폴리뉴클레오티드 서열의 좌측 방향은 5' 방향으로서 언급된다. The left-hand direction of double-stranded polynucleotide sequence is referred to as the 5 'direction. 초기 RNA 전사체의 5'에서 3' 부가의 방향은 전사 방향으로서 언급되고; 5 'to 3' direction of the addition of the initial RNA transcript are referred to as the transcription direction; RNA와 동일한 서열을 갖고 RNA 전사체의 5' 단부에 5'인 DNA 가닥 상의 서열 구역은 "상류 서열"로서 언급되고; Has the same sequence as the RNA sequence area on the DNA strand, the end portion 5 'of the 5 RNA transcripts is referred to as "upstream sequences"; RNA와 동일한 서열을 갖고 RNA 전사체의 3' 단부에 3'인 DNA 가닥 상의 서열 구역은 "하류 서열"로서 언급된다. Has the same sequence as the RNA sequence area on the DNA strand of the RNA transcript 3 'to the end portion 3' is referred to as "downstream sequences".

보존적 아미노산 치환은 대개 생물학적 시스템 내의 합성보다는 화학적 펩티드 합성에 의해 포함되는 비-천연 발생 아미노산 잔기를 포함할 수 있다. Amino acid substitutions are generally non-preserved contained by chemical peptide synthesis rather than synthesis in a biological system can comprise a naturally occurring amino acid residue. 이들은 펩티드모방체 (peptidomimetic) 및 다른 역전 또는 역위 형태의 아미노산 모이어티를 포함한다. These include peptide mimetics (peptidomimetic) and other reversed or inverted forms of amino acid moieties.

천연 발생 잔기는 일반적인 측쇄 특성에 기초한 종류로 나누어질 수 있다: Naturally occurring residues may be divided into types based on common side chain properties:

1) 소수성: 노르류신, Met, Ala, Val, Leu, Ile; 1) hydrophobic: norleucine, Met, Ala, Val, Leu, Ile;

2) 중성 친수성: Cys, Ser, Thr, Asn, Gln; 2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;

3) 산성: Asp, Glu; 3) acidic: Asp, Glu;

4) 염기성: His, Lys, Arg; 4) basic: His, Lys, Arg;

5) 사슬 배향에 영향을 미치는 잔기: Gly, Pro; 5) residues that influence chain orientation: Gly, Pro; And

6) 방향족: Trp, Tyr, Phe. 6) aromatic: Trp, Tyr, Phe.

예를 들어, 비-보존적 치환은 다른 종류의 멤버에 대한 이들 종류 중 하나의 멤버의 교환을 포함할 수 있다. For example, non-conservative substitutions may include the exchange of a member of one of these types to a member of a different kind. 그러한 치환된 잔기는 예를 들어, 비-인간 항체와 상동성인 인간 항체의 구역 내로, 또는 분자의 비-상동성 구역 내로 도입될 수 있다. Such substituted residues are, for example, non-can be introduced into homologous zone - into the zone of a human antibody and a homologous human antibody, or a ratio of the molecule.

항원 결합 단백질 또는 PCSK9 단백질을 변화시키는데 있어서, 특정 실시태양에 따라, 아미노산의 수치 지수 (hydropathic index)가 고려될 수 있다. According to change the antigen binding protein or PCSK9 protein, depending on the specific embodiment, it can be considered an index value (hydropathic index) of the amino acid. 각각의 아미노산은 그의 소수성 및 전하 특징에 기초하여 수치 지수를 지정받았다. Each amino acid has been specified, the index value on the basis of its hydrophobicity and charge characteristics. 이들은 이소류신 (+4.5); These are isoleucine (+4.5); 발린 (+4.2); Valine (+4.2); 류신 (+3.8); Leucine (+3.8); 페닐알라닌 (+2.8); Phenylalanine (+2.8); 시스테인/시스틴 (+2.5); Cysteine ​​/ cystine (+2.5); 메티오닌 (+1.9); Methionine (+1.9); 알라닌 (+1.8); Alanine (+1.8); 글라이신 (-0.4); Glycine (-0.4); 트레오닌 (-0.7); Threonine (-0.7); 세린 (-0.8); Serine (-0.8); 트립토판 (-0.9); Tryptophan (-0.9); 티로신 (-1.3); Tyrosine (-1.3); 프롤린 (-1.6); Proline (-1.6); 히스티딘 (-3.2); Histidine (-3.2); 글루타메이트 (-3.5); Glutamate (-3.5); 글루타민 (-3.5); Glutamine (-3.5); 아스파르테이트 (-3.5); Aspartate (-3.5); 아스파라긴 (-3.5); Asparagine (-3.5); 라이신 (-3.9); Lysine (-3.9); 및 아르기닌 (-4.5)이다. And an arginine (-4.5).

단백질에 상호작용적 생물학적 기능을 부여하는데 있어서 수치 아미노산 지수의 중요성은 당업계에 알려져 있다 (Kyte et al., J. Mol. Biol., 157:105-131 (1982)). According to a given interactive biological function on a protein numerical significance of the amino acid index is known in the art (Kyte et al, J. Mol Biol, 157:... 105-131 (1982)). 특정 아미노산은 유사한 수치 지수 또는 스코어를 갖는 다른 아미노산에 대해 치환되고 여전히 유사한 생물학적 활성을 보유할 수 있음이 알려져 있다. Particular amino acids that are substituted for other amino acids having a similar index or score value can still retain a similar biological activity known. 수치 지수에 기초한 변화를 하는데 있어서, 특정 실시태양에서, 수치 지수가 ±2 내에 있는 아미노산의 치환이 포함된다. According to the change based on the numerical index, in certain embodiments, the index value includes the substitution of amino acids within ± 2. 특정 실시태양에서, 수치 지수가 ±1 내에 있는 아미노산의 치환이 포함되고, 특정 실시태양에서, ±0.5 내에 있는 아미노산의 치환이 포함된다. In certain embodiments, the index value is included in the substituted amino acid is within ± 1, in certain embodiments, includes the substitution of amino acids within ± 0.5.

유사한 아미노산의 치환은 특히 그에 의해 생성된 생물학적 기능성 단백질 또는 펩티드를 본 경우에서와 같이 면역학적 실시태양에서 사용하도록 의도하는 경우에 친수도에 기초하여 효과적으로 이루어질 수 있음이 또한 당업계에서 이해된다. Substitution of similar amino acids are understood in particular thereto a biologically functional protein or peptide generated by in immunological embodiments in that if intended for use in solar based on the parent may be made effective is the art, also as in the present case. 특정 실시태양에서, 그의 인접 아미노산의 친수도에 의해 지배되는 단백질의 최대 국소 평균 친수도는 그의 면역원성 및 항원성, 즉, 단백질의 생물학적 특성과 상호관련된다. In certain embodiments, the parent may mean maximum of the protein localized to be dominated by the parent of his contiguous amino acids may have their immunogenicity and antigenicity, i.e., is related to the biological properties of the proteins and with each other.

이들 아미노산 잔기에 다음의 친수도 값이 지정되었다: 아르기닌 (+3.0); These amino acid residues in the following hydrophilicity values ​​have also been designated: arginine (+3.0); 라이신 (+3.0); Lysine (+3.0); 아스파르테이트 (+3.0±1); Aspartate (+ 3.0 ± 1); 글루타메이트 (+3.0±1); Glutamate (+ 3.0 ± 1); 세린 (+0.3); Serine (+0.3); 아스파라긴 (+0.2); Asparagine (+0.2); 글루타민 (+0.2); Glutamine (+0.2); 글라이신 (0); Glycine (0); 트레오닌 (-0.4); Threonine (-0.4); 프롤린 (-0.5±1); Proline (-0.5 ± 1); 알라닌 (-0.5); Alanine (-0.5); 히스티딘 (-0.5); Histidine (-0.5); 시스테인 (-1.0); Cysteine ​​(-1.0); 메티오닌 (-1.3); Methionine (-1.3); 발린 (-1.5); Valine (-1.5); 류신 (-1.8); Leucine (-1.8); 이소류신 (-1.8); Isoleucine (-1.8); 티로신 (-2.3); Tyrosine (-2.3); 페닐알라닌 (-2.5) 및 트립토판 (-3.4). Phenylalanine (-2.5) and tryptophan (-3.4). 유사한 친수도 값에 기초하여 변화를 이루는데 있어서, 특정 실시태양에서, 그의 친수도 값이 ±2 내에 있는 아미노산의 치환이 포함되고, 특정 실시태양에서, ±1 내에 있는 아미노산의 치환이 포함되고, 특정 실시태양에서, ±0.5 내에 있는 아미노산의 치환이 포함된다. In I similar made hydrophilic changed based on the degree values, in certain embodiments, this is also its hydrophilic value containing the substitution of amino acids within ± 2, and includes a substitution of an amino acid in the In certain embodiments, ± 1, in certain embodiments, it includes the substitution of amino acids within ± 0.5. 또한 친수도에 기초하여 1차 아미노산 서열로부터 에피토프를 확인할 수 있다. In addition, to determine epitopes from primary amino acid sequences on the basis of capital pro. 이들 구역은 또한 "에피토프 코어 구역"으로서 언급된다. These areas are also referred to as "epitope core zone".

예시적인 아미노산 치환을 표 1에 기재한다. An exemplary amino acid substitutions are shown in Table 1.

Figure pat00001

용어 "유도체"는 아미노산 (또는 핵산)의 삽입, 결실, 또는 치환 이외의 화학적 변형을 포함하는 분자를 나타낸다. The term "derivative" refers to a molecule comprising a chemical modification other than the insertion, deletion, or substitution of amino acid (or nucleic acid). 특정 실시태양에서, 유도체는 중합체, 지질, 또는 다른 유기 또는 무기 모이어티와의 화학 결합을 포함하고 이로 제한되지 않는 공유 변형을 포함한다. In a specific embodiment, the derivative comprises a share deformation including chemical bonding with polymers, lipids, or other organic or inorganic moiety and is not limited thereto. 특정 실시태양에서, 화학적으로 변형된 항원 결합 단백질은 화학적으로 변형되지 않은 항원 결합 단백질보다 더 큰 순환 반감기를 가질 수 있다. In certain embodiments, the chemically modified antigen-binding protein may have a greater circulating half-life than the unmodified antigen chemically coupled protein. 특정 실시태양에서, 화학적으로 변형된 항원 결합 단백질은 목적하는 세포, 조직, 및/또는 장기에 대해 개선된 표적화 용량을 가질 수 있다. In certain embodiments, the chemically modified antigen-binding protein may have improved targeting capacity for the target cell, tissue, and / or organs. 일부 실시태양에서, 유도체 항원 결합 단백질은 폴리에틸렌 글리콜, 폴리옥시에틸렌 글리콜, 또는 폴리프로필렌 글리콜을 포함하고 이로 제한되지 않는 하나 이상의 수용성 중합체 부착을 포함하도록 공유 변형된다. In some embodiments, the antigen binding protein derivatives are shared modified to include one or more water-soluble polymer that is not attached to a polyethylene glycol, polyoxyethylene glycol, or polypropylene glycol, and so limited. 예를 들어, 미국 특허 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791,192 및 4,179,337을 참조한다. For example, reference is made to U.S. Patent 4,640,835, 4,496,689, 4,301,144, 4,670,417, 4,791,192 and 4,179,337. 특정 실시태양에서, 유도체 항원 결합 단백질은 모노메톡시-폴리에틸렌 글리콜, 덱스트란, 셀룰로스, 또는 다른 탄수화물계 중합체, 폴리-(N-비닐 피롤리돈)-폴리에틸렌 글리콜, 프로필렌 글리콜 단일중합체, 폴리프로필렌 옥사이드/에틸렌 옥사이드 공-중합체, 폴리옥시에틸화 폴리올 (예를 들어, 글리세롤) 및 폴리비닐 알콜, 및 상기 중합체들의 혼합물을 포함하고 이로 제한되지 않는 하나 이상의 중합체를 포함한다. In a specific embodiment, the antigen binding protein derivative is mono-methoxy-polyethylene glycol, dextran, cellulose, or other carbohydrate based polymers, poly - (N- vinyl pyrrolidone) polyethylene glycol, propylene glycol homopolymers, polypropylene oxide / ethylene oxide co-polymer, polyoxyethylated polyols screen (e. g., glycerol) and polyvinyl alcohol includes, and at least one polymer comprises a mixture of the polymer and are not limited thereto.

특정 실시태양에서, 유도체는 폴리에틸렌 글리콜 (PEG) 하위단위로 공유 변형된다. In a specific embodiment, the derivative is shared modified with polyethylene glycol (PEG) subunits. 특정 실시태양에서, 하나 이상의 수용성 중합체는 유도체의 하나 이상의 특정한 위치, 예를 들어 아미노 말단에서 결합된다. In certain embodiments, one or more water-soluble polymer is coupled to one or more of the specific position of the derivative, for example, from the amino terminus. 특정 실시태양에서, 하나 이상의 수용성 중합체는 유도체의 하나 이상의 측쇄에 무작위로 부착된다. In certain embodiments, one or more water-soluble polymers are attached randomly to one or more side chains of the derivative. 특정 실시태양에서, PEG는 항원 결합 단백질에 대한 치료 용량을 개선하기 위해 사용된다. In certain embodiments, PEG is used to improve the therapeutic capacity for antigen-binding protein. 특정 실시태양에서, PEG는 인간화 항체에 대한 치료 용량을 개선하기 위해 사용된다. In certain embodiments, PEG is used to improve the therapeutic capacity for a humanized antibody. 이러한 특정 방법은 예를 들어 임의의 목적으로 본원에 참조로 포함시킨 미국 특허 6,133,426에 논의되어 있다. This particular method, for example, is discussed in U.S. Patent 6,133,426 which is incorporated by reference herein for any purpose.

펩티드 유사체는 제약 산업에서 주형 (template) 펩티드의 것에 유사한 특성을 갖는 비-펩티드 약물로서 일반적으로 사용된다. Non-peptide analogs having similar properties to that of the mold (template) peptide in the pharmaceutical industry - is generally used as a peptide drug. 이들 종류의 비-펩티드 화합물을 "펩티드 모방체" 또는 "펩티드모방체"로 부른다 (임의의 목적으로 본원에 참조로 포함시킨 문헌 ([Fauchere, J., Adv. Drug Res., 15:29 (1986)]; [Veber & Freidinger, TINS, p.392 (1985)]; 및 [Evans et al., J. Med. Chem., 30:1229 (1987)]). 그러한 화합물은 종종 컴퓨터 분자 모델링을 사용하여 개발된다. 치료상 유용한 펩티드에 구조상 유사한 펩티드 모방체가 유사한 치료 또는 예방 효과를 생성하기 위해 사용될 수 있다. 일반적으로, 펩티드모방체는 패러다임 (paradigm) 폴리펩티드 (즉, 생화학적 특성 또는 약물학적 활성을 갖는 폴리펩티드), 예를 들어 인간 항체에 구조상 유사하지만, 당업계에 잘 공지된 방법에 의해 --CH 2 NH--, --CH 2 S--, -CH 2 -CH 2 --, --CH=CH-(시스 및 트란스), --COCH 2 --, --CH(OH)CH 2 --, 및 --CH 2 SO-- 중에서 선택되는 연결로 임의로 교체되는 하 These types of non-peptide compounds referred to as "peptide mimetics" or "peptide mimetics" (literature which is incorporated by reference herein for any purpose ([Fauchere, J., Adv Drug Res, 15:29 (.. 1986)]; [Veber & Freidinger, TINS, p.392 (1985)]; and [Evans et al, J. Med Chem, 30:.... 1229 (1987)]) such compounds are often the computer molecular modeling used and is developed. therapeutically body similar peptide mimic the structure to useful peptides may be used to produce a similar therapeutic or prophylactic effect. generally, peptide mimetics are paradigm (paradigm) polypeptide (i.e., a biochemical property or pharmacological activity having a polypeptide), e.g., structurally similar to human antibodies, by methods well known in the art --CH 2 NH--, --CH 2 S--, -CH 2 -CH 2 -, - -CH = CH- (cis and trans), --COCH 2 -, --CH ( OH) CH 2 - and are optionally replaced with, and connecting selected from --CH 2 SO-- 이상의 펩티드 연결을 갖는다. 동일한 종류의 D-아미노산으로의 컨센서스 서열의 하나 이상의 아미노산의 체계적인 치환 (예를 들어, L-라이신 대신에 D-라이신)은 특정 실시태양에서 보다 안정한 펩티드를 생성하기 위해 사용될 수 있다. 또한, 컨센서스 서열 또는 실질적으로 동일한 컨센서스 서열 변이를 포함하는 구속형 (constrained) 펩티드는 당업계에 공지된 방법에 의해, 예를 들어, 펩티드를 고리화시키는 분자내 디술피드 다리를 형성할 수 있는 내부 시스테인 잔기를 첨가함으로써 생성될 수 있다 (임의의 목적으로 본원에 참조로 포함시킨 문헌 [Rizo and Gierasch, Ann. Rev. Biochem., 61:387 (1992)] 참조). Has a more peptides connection. Systematic substitution of one or more amino acids of the consensus sequence of a D- amino acid of the same type (e.g., D- lysine in place of L- lysine) can be used to generate more stable peptides. In certain embodiments may also, clamping type (constrained) peptide comprising a consensus sequence or a substantially identical consensus sequence variation as is by methods known in the art, for example, that the peptide can form within the disulfide bridge ring crystallized molecule It may be generated by the addition of an internal cysteine ​​residue (which literature [Rizo and Gierasch, Ann Rev. Biochem, 61..: 387 (1992)], incorporated by reference herein for any purpose reference).

생물학적 물질, 예를 들어 폴리펩티드, 핵산, 숙주 세포 등과 연관하여 본 명세서 전체에서 사용될 때 용어 "천연 발생"은 자연에서 발견되는 물질 또는 자연에서 발견되는 물질의 형태를 나타낸다. Biological material, for example when used in a polypeptide, nucleic acid, throughout this specification in connection as a host cell The term "naturally occurring" refers to a form of the substance or substances found in nature that are found in nature.

본원에서 사용될 때 "항원 결합 단백질" ("ABP")은 명시된 표적 항원에 결합하는 임의의 단백질을 의미한다. As used herein, the term "antigen binding protein" ( "ABP") is meant any protein which binds to specified target antigen. 본원에서, 명시된 표적 항원은 PCSK9 단백질 또는 그의 단편이다. Herein, the specified target antigen is a PCSK9 protein or a fragment thereof. "항원 결합 단백질"은 항체 및 그의 결합 부분, 예를 들어 면역학상 기능적 단편을 포함하고 이로 제한되지 않는다. "Antigen binding proteins" is not included in the antibody, and its binding portion, e.g., the immunologic and functional fragments limited. 펩티바디 (peptibody)가 항원 결합 단백질의 다른 예이다. Peptibody (peptibody) is another example of an antigen binding protein. 본원에서 사용될 때 용어 항체 또는 면역글로불린 사슬 (중쇄 또는 경쇄) 항원 결합 단백질의 "면역학상 기능적 단편" (또는 간단히 "단편")은 전장 사슬 내에 존재하는 적어도 일부의 아미노산이 결여되지만 여전히 항원에 특이적으로 결합할 수 있는 항체의 부분 (상기 부분이 얻어지거나 합성되는 방식에 무관하게)을 포함하는 항원 결합 단백질의 물질종이다. As used herein, the term antibody or immunoglobulin chain (heavy or light chain) "Immunology the functional fragment" of the antigen binding proteins (or simply, "fragments") is at least a part of amino acids present in a full-length chain lacking, but still specific for antigenic portion of an antibody capable of binding to a substance species of an antigen binding protein that includes (regardless of the manner in which the portion that is obtained or synthesized). 그러한 단편은 표적 항원에 결합하고, 주어진 에피토프에 대한 결합에 대해 무손상 항체를 포함한 다른 항원 결합 단백질과 경쟁할 수 있는 점에서 생물학적 활성이다. Such fragments are biologically active in that it is capable of binding to the target antigen, and the competition with the other antigen binding proteins, including the intact antibody for binding to a given epitope. 일부 실시태양에서, 단편은 중화 단편이다. In some embodiments, the short fragment is neutralizing. 일부 실시태양에서, 단편은 LDLR과 PCSK9 사이의 상호작용의 가능성을 차단하거나 감소시킬 수 있다. In some embodiments, the fragments may be cut off or reduce the possibility of interaction between the LDLR and PCSK9. 한 측면에서, 그러한 단편은 전장 경쇄 또는 중쇄 내에 존재하는 적어도 하나의 CDR을 보유할 것이고, 일부 실시태양에서 단일 중쇄 및/또는 경쇄 또는 그의 일부를 포함할 것이다. In one aspect, such a fragment would have a least one CDR present in the full-length light or heavy chain, will have a single heavy and / or light chain or a part thereof in some embodiments. 이들 생물학적 활성 단편은 재조합 DNA 기술에 의해 생산할 수 있거나, 무손상 항체를 포함한 항원 결합 단백질의 효소적 또는 화학적 절단에 의해 생산할 수 있다. These biologically active fragments can be produced by enzymatic or chemical cleavage of the antigen binding proteins, including the intact antibody, or can be produced by recombinant DNA technology. 면역학상 기능적 면역글로불린 단편은 Fab, 디아바디 (동일한 사슬 상의 2개의 도메인 사이에 페어링을 허용하기에는 너무 짧은 펩티드 링커를 통해 연결된, 경쇄 가변 도메인과 동일한 폴리펩티드 상의 중쇄 가변 도메인), Fab', F(ab') 2 , Fv, 도메인 항체 및 단일쇄 항체를 포함하고 이로 제한되지 않고, 인간, 마우스, 래트, 카멜리드 또는 토끼를 포함하고 이로 제한되지 않는 임의의 포유동물 공급원으로부터 유래할 수 있다. Immunology the functional immunoglobulin fragment is Fab, Dia body (2 hagieneun allow pairing between domains are linked through a very short peptide linker, the same polypeptide chain variable domains on the light chain variable domains on the same chain), Fab ', F (ab can be derived from a ') 2, Fv, domain antibody and does not contain a single chain antibody, and limited to, human, mouse, rat, camel or any mammalian source of lead including rabbits and are not limited thereto. 본원에 개시된 항원 결합 단백질의 기능적 부분, 예를 들어, 하나 이상의 CDR이 제2 단백질에 또는 소분자에 공유 결합되어, 이중기능적 치료 특성을 갖거나 연장된 혈청 반감기를 갖는 신체 내의 특정 표적에 대해 지시된 치료제를 생성할 수 있음이 추가로 고려된다. A functional portion of the antigen binding proteins described herein, e.g., the at least one CDR is covalently attached to, or a small molecule with a second protein, an instruction for a specific target within the body having a has the dual functional therapeutic properties or an extended serum half-life It is considered to be that added to produce a cure. 당업자가 알 수 있는 바와 같이, 항원 결합 단백질은 비단백질 성분을 포함할 수 있다. As will be appreciated by one skilled in the art, the antigen binding protein may comprise a non-protein component. 본원의 일부 섹션에서, ABP의 예들은 "숫자/문자/숫자" (예를 들어, 25A7)의 용어로 본원에 기재되어 있다. In some sections of the present application, examples of ABP are described herein in terms of "the number / letter / number" (e.g., 25A7). 이들 경우에, 정확한 명칭은 특이적 항체를 표시한다. In these cases, the correct designation indicates the specific antibody. 즉, 25A7로 불리는 ABP는 25A7.1로 불리는 항체와 반드시 동일하지는 않다 (이들이 명세서에서 동일한 것으로 명백하게 교시되지 않으면, 예를 들어, 25A7 및 25A7.3). In other words, it called ABP 25A7 must not identical to the antibody known as 25A7.1 (if they are not explicitly taught to be the same in the specification, for example, 25A7 and 25A7.3). 당업자가 알 수 있는 바와 같이, 일부 실시태양에서 LDLR은 항원 결합 단백질이 아니다. As will be appreciated by one skilled in the art, in some embodiments LDLR is not an antigen binding protein. 일부 실시태양에서, LDLR의 결합 하위섹션, 예를 들어, EGFa는 항원 결합 단백질이 아니다. In some embodiments, the binding of LDLR subsections, for example, EGFa is not antigen-binding protein. 일부 실시태양에서, 그를 통해 PCSK9가 생체 내에서 신호전달하는 다른 분자는 항원 결합 단백질이 아니다. In some embodiments, the other molecule is passed PCSK9 signal in the body therethrough is not the antigen binding protein. 그러한 실시태양은 그 자체로서 명백하게 확인될 것이다. Such embodiments will make apparent as such.

본원에서 설명되는 특정 항원 결합 단백질은 항체이거나, 항체로부터 유래한다. Specific antigen-binding proteins described herein are antibodies, or will be derived from antibodies. 특정 실시태양에서, 항원 결합 단백질의 폴리펩티드 구조는 각각 모노클로날 항체, 이중특이적 항체, 미니바디 (minibody), 도메인 항체, 합성 항체 (때때로 본원에서 "항체 모방체"로서 칭함), 키메라 항체, 인간화 항체, 인간 항체, 항체 융합체 (때때로 본원에서 "항체 컨쥬게이트"로서 칭함), 및 그의 단편을 포함하고 이로 제한되지 않는 항체에 기초한 것이다. In certain embodiments, the polypeptide structure of the antigen binding protein is monoclonal antibody to the respective monoclonal antibodies, bispecific antibodies, mini body (minibody), domain antibodies, synthetic antibodies (sometimes referred to as "Antibody mimetics" herein), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to as "antibody conjugate" herein), and is based on antibodies and fragments thereof including, but not limited thereto. 일부 실시태양에서, ABP는 아비머 (avimer) (단단하게 결합하는 펩티드)를 포함하거나 이로 이루어진다. In some embodiments, the ABP comprises a father made Murray (avimer) (peptide tightly coupled) or therefrom. 이들 다양한 항원 결합 단백질은 본원에서 추가로 설명된다. These various antigen-binding proteins are described further herein.

"Fc" 구역은 항체의 C H 1 및 C H 2 도메인을 포함하는 2개의 중쇄 단편을 포함한다. "Fc" section includes two heavy chain fragments comprising the C H 1 and C H 2 domains of an antibody. 2개의 중쇄 단편은 2개 이상의 디술피드 결합에 의해 및 C H 3 도메인의 소수성 상호작용에 의해 함께 유지된다. Two heavy chain fragments are held together by hydrophobic interactions by two or more disulfide bonds and C H 3 domains.

"Fab 단편"은 하나의 경쇄, 및 하나의 중쇄의 C H 1 및 가변 구역을 포함한다. "Fab fragment" includes a light chain and a heavy chain of the C H 1 and variable regions. Fab 분자의 중쇄는 다른 중쇄 분자와 디술피드 결합을 형성할 수 없다. Of the heavy chain Fab molecule can not form a disulfide bond with another heavy chain molecule.

"Fab 단편"은 하나의 경쇄, 및 VH 도메인 및 C H 1 도메인을 함유하는 하나의 중쇄의 일부, 및 또한 C H 1 및 C H 2 도메인 사이의 구역을 포함하여, 2개의 Fab' 단편의 2개의 중쇄 사이에서 사슬간 디술피드 결합이 형성되어 F(ab') 2 분자를 형성할 수 있다. "Fab fragment" is a portion of one heavy chain that contains one of the light chain, and the VH domain and the C H 1 domain, and also, the two Fab '2 fragments, including the region between C H 1 and C H 2 domain, the inter-chain disulfide bond between the two heavy chains are formed to form a F (ab ') 2 molecule.

"F(ab') 2 단편"은 2개의 경쇄, 및 C H 1 및 C H 2 도메인 사이의 불변 구역의 일부를 함유하는 2개의 중쇄를 포함하여, 2개의 중쇄 사이에서 사슬간 디술피드 결합이 형성된다. "F (ab ') 2 fragment" includes two light chain, and the C H 1 and a disulfide bond between, including two heavy chains containing a portion of the constant region between C H 2 domain, the chain between the two heavy chains are It is formed. 따라서, F(ab') 2 단편은 2개의 중쇄 사이의 디술피드 결합에 의해 함께 유지되는 2개의 Fab' 단편으로 이루어진다. Thus, F (ab ') 2 fragment is two Fab held together by a disulfide bond between the two heavy chain "consists of a fragment.

"Fv 구역"은 중쇄 및 경쇄 모두로부터의 가변 구역을 포함하지만, 불변 구역이 결여된다. "Fv zone" includes the variable regions from both the heavy and light chains, but lacks the constant region.

"단일쇄 항체"는 중쇄 및 경쇄 가변 구역이 가요성 링커에 의해 연결되어 단일 폴리펩티드 사슬을 형성하는 Fv 분자이고, 이것은 항원 결합 구역을 형성한다. "Single-chain antibodies" are the heavy and light chain variable regions connected by a flexible linker, and Fv molecules forms a single polypeptide chain, which forms an antigen-binding region. 단일쇄 항체는 그 개시내용을 본원에 참조로 포함시킨 국제 특허 출원 공개 WO 88/01649와 미국 특허 4,946,778 및 5,260,203에 상세하게 논의되어 있다. Single chain antibodies are discussed in detail in International Patent Application Publication WO 88/01649 and U.S. Patent 4,946,778 and 5,260,203 which include the disclosures herein by reference.

"도메인 항체"는 중쇄의 가변 구역 및 경쇄의 가변 구역만을 함유하는 면역학상 기능적 면역글로불린 단편이다. "Domain antibody" is an immunological the functional immunoglobulin fragment containing only the variable regions and light chain variable regions of the heavy chain. 일부 경우에, 2개 이상의 V H 구역은 펩티드 링커와 공유 연결되어 2가 도메인 항체를 생성한다. If the part is, two or more V H areas are shared with the peptide linker connecting generates a bivalent domain antibody. 2가 도메인 항체의 2개의 V H 구역은 동일하거나 항원을 표적으로 할 수 있다. Two V H regions of bivalent domain antibody may target the same or the antigen.

"2가 항원 결합 단백질" 또는 "2가 항체"는 2개의 항원 결합 부위를 포함한다. "Bivalent antigen-binding protein" or "bivalent antibody" comprises two antigen binding sites. 일부 경우에, 2개의 결합 부위는 동일한 항원 특이성을 갖는다. In some instances, the two binding sites have the same antigen specificity. 2가 항원 결합 단백질 및 2가 항체는 이중특이적일 수 있다 (아래 참조). Divalent antigen-binding protein and divalent antibodies have proven to be bispecific (see below). 특정 실시태양에서, "다중특이적" 또는 "다중기능적" 항체 이외의 2가 항체는 대개 동일한 각각의 그의 결합 부위를 갖는 것으로 생각된다. In certain embodiments, the "multi-specific," or "multi-functional" other than the two antibodies is an antibody is usually thought to have its binding site of the same respectively.

"다중특이적 항원 결합 단백질" 또는 "다중특이적 항체"는 하나 초과의 항원 또는 에피토프를 표적으로 하는 것이다. "Multi-specific antigen binding proteins" or "multi-specific antibody" is to target an antigen or epitopes of more than one.

"이중특이적", "이중-특이적" 또는 "이중기능적" 항원 결합 단백질 또는 항체는 2개의 상이한 항원 결합 부위를 갖는 각각 하이브리드 (hybrid) 항원 결합 단백질 또는 항체이다. "Bispecific", "bi-specific" or a "dual functional" antigen binding proteins or antibodies each hybrid (hybrid) protein or antigen-binding antibody having two different antigen binding sites. 이중특이적 항원 결합 단백질 및 항체는 다중특이적 항원 결합 단백질 항체의 종이고, 하이브리도마의 융합 또는 Fab' 단편의 연결을 포함하고 이로 제한되지 않는 다양한 방법에 의해 생산할 수 있다 (예를 들어, 문헌 ([Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321]; [Kostelny et al., 1992, J. Immunol. 148:1547-1553]) 참조). Bispecific antigen binding proteins and antibodies and a multi-specific antigen binding protein antibody paper, can include fused or Fab 'fragments connection of the hybridoma and to produce by a variety of methods that are not limited to, (e.g., Document ([Songsivilai and Lachmann, 1990, Clin Exp Immunol 79:... 315-321]; [Kostelny et al, 1992, J. Immunol 148:.. 1547-1553]) refer). 이중특이적 항원 결합 단백질 또는 항체의 2개의 결합 부위는 동일하거나 상이한 단백질 표적 상에 존재할 수 있는 2개의 상이한 에피토프에 결합할 것이다. Two binding sites of the bispecific antibody or antigen-binding protein will bind to two different epitopes which may be on the same or different target proteins.

항원 결합 단백질은 해리 상수 (K d )가 ≤10 -7 M인 경우에 그의 표적 항원에 "특이적으로 결합하는" 것으로 말해진다. Antigen binding protein is said to be "specifically binding" to its target antigen when the dissociation constant (K d) of ≤10 -7 M. ABP는 K d 가 ≤5 x 10 -9 M인 경우에 "고 친화도"로, 및 K d 가 ≤5 x 10 -10 M인 경우에 "매우 고 친화도"로 항원에 특이적으로 결합한다. ABP is specific binding to an antigen by a K d ≤5 x 10 -9 to "high affinity," in the case of M, and K d is ≤5 x 10 -10 "very high affinity" when the M . 한 실시태양에서, ABP는 K d 가 ≤10 -9 M이다. In one embodiment, the ABP is a K d ≤10 -9 M. 한 실시태양에서, 오프율 (off-rate)은 <1 x 10 -5 이다. In one embodiment, the off-rates (off-rate) is <1 x 10 -5. 다른 실시태양에서, ABP는 약 10 -9 M 내지 10 -13 M의 K d 로 인간 PCSK9에 결합할 것이고, 또다른 실시태양에서 ABP는 K d ≤5 x 10 -10 으로 결합할 것이다. In another embodiment, ABP will bind to human PCSK9 with K d of approximately 10 -9 M to 10 -13 M, yet ABP In another embodiment will be combined with K d ≤5 x 10 -10. 당업자가 알 수 있는 바와 같이, 일부 실시태양에서, 임의의 또는 모든 항원 결합 단편이 PCSK9에 특이적으로 결합할 수 있다. As will be appreciated by one skilled in the art, in some embodiments, any or all of the antigen-binding fragment may specifically bind to PCSK9.

항원 결합 단백질은 제2 표적에 결합하는 것보다 하나의 표적에 더 강하게 결합할 때 "선택적"이다. Antigen-binding protein is a "selective" when more strongly coupled to one of the target than binding to a second target.

"항원 결합 구역"은 명시된 항원 (예를 들어, 파라토프 (paratope))에 특이적으로 결합하는 단백질, 또는 단백질의 일부를 의미한다. "Antigen-binding zone" means the part of a protein, or a protein that specifically binds to a specified antigen (e. G., Para Saratov (paratope)) enemy. 예를 들어, 항원과 상호작용하고 항원 결합 단백질에 항원에 대한 그의 특이성 및 친화도를 부여하는 아미노산 잔기를 함유하는 항원 결합 단백질의 상기 일부는 "항원 결합 구역"으로서 언급된다. For example, the antigen interacts with the antigen containing amino acid residues to give his specificity and affinity for the antigen on the antigen-binding protein coupled to the portion of the protein is referred to as "antigen binding zone". 항원 결합 구역은 대개 하나 이상의 "상보성 결합 구역" ("CDR")을 포함한다. Antigen binding zone will usually include one or more "complementary binding zone" ( "CDR"). 특정 항원 결합 구역은 또한 하나 이상의 "프레임워크" 구역을 포함한다. Specific antigen-binding zones may also include one or more of a "framework" region. "CDR"은 항원 결합 특이성 및 친화도에 기여하는 아미노산 서열이다. "CDR" is an amino acid sequence that contribute to Fig antigen binding specificity and affinity. "프레임워크" 구역은 항원 결합 구역과 항원 사이의 결합을 촉진하도록 CDR의 적합한 입체형태를 유지하는 것을 도울 수 있다. "Framework" zone can help to maintain the proper conformation of the CDR to facilitate engagement between the antigen binding and antigen zone. 구조적으로, 프레임워크 구역은 항체 내에서 CDR들 사이에 위치할 수 있다. Structurally, the framework regions may be located between the CDR in the antibody. 프레임워크 및 CDR 구역의 예를 도 2a-3d, 3ccc-3jjj, 및 15a-15d에 제시한다. Framework and CDR presents an example of areas in Fig. 2a-3d, 3ccc-3jjj, and 15a-15d. 일부 실시태양에서, 항체 3B6의 경쇄에 대한 CDR에 대한 서열은 다음과 같고: CDR1 TLSSGYSSYEVD (서열 279); In some embodiments, the sequence for the CDR of the light chain of the 3B6 antibody were as follows: CDR1 TLSSGYSSYEVD (SEQ ID NO: 279); CDR2 VDTGGIVGSKGE (서열 280); VDTGGIVGSKGE CDR2 (SEQ ID NO: 280); CDR3 GADHGSGTNFVVV (서열 281), FR은 다음과 같다: FR1 QPVLTQPLFASASLGASVTLTC (서열 282); GADHGSGTNFVVV CDR3 (SEQ ID NO: 281), FR is as follows: QPVLTQPLFASASLGASVTLTC FR1 (SEQ ID NO: 282); FR2 WYQQRPGKGPRFVMR (서열 283); WYQQRPGKGPRFVMR FR2 (SEQ ID NO: 283); FR3 GIPDRFSVLGSGLNRYLTIKNIQEEDESDYHC (서열 284); GIPDRFSVLGSGLNRYLTIKNIQEEDESDYHC FR3 (SEQ ID NO: 284); 및 FR4 FgggTKLTVL (서열 285). FgggTKLTVL and FR4 (SEQ ID NO: 285).

특정 측면에서, PCSK9, 예를 들어 인간 PCSK9에 결합하는 재조합 항원 결합 단백질을 제공한다. In certain aspects, PCSK9, for example, provides a recombinant antigen binding protein that binds to human PCSK9. 본 문맥에서, "재조합 항원 결합 단백질"은 재조합 기술을 이용하여, 즉, 본원에서 설명되는 재조합 핵산의 발현을 통해 제조된 단백질이다. In the present context, "a recombinant antigen binding protein" using recombinant techniques, i.e., a protein produced through the expression of a recombinant nucleic acid described herein. 재조합 단백질의 생산을 위한 방법 및 기술은 당업계에 잘 공지되어 있다. Method for the production of recombinant proteins, and the technology is well known in the art.

용어 "항체"는 표적 항원에 대한 특이적 결합에 대해 무손상 항체와 경쟁할 수 있는 임의의 이소형의 무손상 면역글로불린, 또는 그의 단편을 나타내고, 예를 들어 키메라, 인간화, 전체 인간, 및 이중특이적 항체를 포함한다. The term "antibody" refers to an intact immunoglobulin, or a fragment of any isoform which may compete with the intact antibody for specific binding to the target antigen, for example, chimeric, humanized, fully human, and dual and a specific antibody. "항체"는 항원 결합 단백질의 종이다. "Antibody" is a species of an antigen binding protein. 무손상 항체는 일반적으로 적어도 2개의 전장 중쇄 및 2개의 전장 경쇄를 포함할 것이지만, 일부 경우에 단지 중쇄만을 포함할 수 있는 카멜리드 내에서 자연 발생하는 항체와 같이 보다 적은 사슬을 포함할 수 있다. Intact antibodies normally may include fewer chain, such as at least two full-length heavy chains and 2, but comprise a single full-length light chain, naturally occurring antibodies in the Camel leads only to contain only heavy chain in some cases. 항체는 전적으로 단일 공급원으로부터 유래할 수 있거나, "키메라"일 수 있고, 즉, 항체의 상이한 부분들은 아래에 더욱 설명한 바와 같이 2개의 상이한 항체로부터 유래할 수 있다. The antibody or may be derived entirely from a single source, may be a "chimeric", that is, different portions of antibodies can be derived from two different antibodies, as further described below. 항원 결합 단백질, 항체, 또는 결합 단편은 하이브리도마 내에서 재조합 DNA 기술에 의해, 또는 무손상 항체의 효소적 또는 화학적 절단에 의해 생산할 수 있다. Antigen-binding proteins, antibodies, or binding fragments can be produced by enzymatic or chemical cleavage of the hybridoma by recombinant DNA technology, or in an intact antibody. 달리 지시하지 않으면, 용어 "항체"는 2개의 전장 중쇄와 2개의 전장 경쇄를 포함하는 항체에 추가로, 그의 유도체, 변이체, 단편, 및 돌연변이체를 포함하고, 그 예를 아래에 설명한다. If not otherwise indicated, the term "antibody" is 2 in addition to the antibody comprising the light chain of full-length heavy chains and two full-length, including their derivatives, variants, fragments, and mutants, and will be described under the examples. 또한, 명백하게 배제하지 않으면, 항체는 각각 모노클로날 항체, 이중특이적 항체, 미니바디, 도메인 항체, 합성 항체 (때때로 본원에서 "항체 모방체"로서 칭함), 키메라 항체, 인간화 항체, 인간 항체, 항체 융합체 (때때로 본원에서 "항체 컨쥬게이트"로서 칭함), 및 그의 단편을 포함한다. Further, unless expressly excluded, the antibody is monoclonal antibody to the respective monoclonal antibodies, bispecific antibodies, mini-bodies, domain antibodies, synthetic antibodies (sometimes referred to as "Antibody mimetics" herein), chimeric antibodies, humanized antibodies, human antibodies, antibodies including fusions (sometimes referred to as "antibody conjugate" herein), and fragments thereof. 일부 실시태양에서, 상기 용어는 또한 펩티바디를 포함한다. In some embodiments, the term also includes a peptibody.

천연 발생 항체 구조 단위는 대개 사량체를 포함한다. Naturally occurring antibody structural unit is usually include a tetramer. 각각의 그러한 사량체 대개 2개의 동일한 쌍의 폴리펩티드 사슬로 이루어지고, 각각의 쌍은 하나의 전장 "경쇄" (특정 실시태양에서, 약 25 kDa) 및 하나의 전장 "중쇄" (특정 실시태양에서, 약 50-70 kDa)를 포함한다. In each such tetramer typically two comprise a polypeptide chain of the same pair, each pair has one full-length "light" (in certain embodiments, about 25 kDa) and one full-length "heavy chains" (a specific embodiment, comprises from about 50-70 kDa). 각각의 사슬의 아미노-말단 부분은 대개 항원 인식을 담당하는, 대개 약 100 내지 110개 이상의 아미노산의 가변 구역을 포함한다. Of each chain amino-terminal portion it is generally include, typically a variable region of about 100 to 110 amino acids that is responsible for antigen recognition. 각각의 사슬의 카르복시-말단 부분은 대개 효과기 기능을 담당할 수 있는 불변 구역을 규정한다. Carboxy of each chain-end part usually defines a constant section that could be responsible for effector function. 인간 경쇄는 대개 카파 및 람다 경쇄로서 분류된다. Human light chains are typically classified as kappa and lambda light chains. 중쇄는 대개 뮤, 델타, 감마, 알파, 또는 엡실론으로서 분류되고, 항체의 이소형을 각각 IgM, IgD, IgG, IgA, 및 IgE로 규정한다. Heavy chain is usually defined as the mu, delta, gamma, alpha, or epsilon, and classified as, respectively, the isotype of the antibody IgM, IgD, IgG, IgA, and IgE. IgG는 IgG1, IgG2, IgG3, 및 IgG4를 포함하고 이로 제한되지 않는 몇몇 하위종류를 갖는다. IgG has several subtypes including IgG1, IgG2, IgG3, and IgG4, and that is not limited thereto. IgM은 IgM1 및 IgM2를 포함하고 이로 제한되지 않는 몇몇 하위종류를 갖는다. IgM has several sub-types include IgM1 and IgM2 and are not limited thereto. IgA는 유사하게 IgA1 및 IgA2를 포함하고 이로 제한되지 않는 하위종류로 세분된다. IgA are further divided into non-similarly including IgA1 and IgA2, and limited to, sub-type. 전장 경쇄 및 중쇄 내에서, 대개, 가변 및 불변 구역은 약 12개 이상의 아미노산의 "J" 구역에 의해 연결되고, 여기서 중쇄는 또한 약 10개 이상의 아미노산의 "D" 구역을 포함한다 (예를 들어, 그 전문을 모든 목적으로 참조로 포함시킨 문헌 [Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, NY (1989)] 참조). 각각의 경쇄/중쇄쌍의 가변 구역은 대개 항원 결합 부위를 형성한다. Within full-length light and heavy chains, typically, the variable and constant region is connected by a "J" region of about 12 or more amino acids, wherein the heavy chain also including a "D" region of at least about 10 amino acids (e. G. , which documents are incorporated by reference in its entirety for all purposes [Fundamental Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, NY (1989)] reference) varying of each light chain / heavy chain pairs zone usually forms the antigen binding site.

가변 구역은 일반적으로 3개의 초가변 구역 (또한 상보성 결정 구역, 즉 CDR로도 불림)에 의해 연결된 비교적 보존된 프레임워크 구역 (FR)의 동일한 일반적인 구조를 보인다. Variable regions are generally three hypervariable region (also complementarity determining section, that is, referred to as CDR) show the same general structure of relatively conserved framework connected by a region (FR). 각각의 쌍의 2개의 사슬로부터의 CDR은 대개 프레임워크 구역에 의해 정렬되고, 이는 특이적 에피토프에 결합할 수 있게 할 수 있다. CDR's from the two chains of each pair typically are aligned by the framework regions, which may enable binding to a specific epitope. N-말단으로부터 C-말단으로, 경쇄 및 중쇄 가변 구역은 모두 일반적으로 도메인 FR1, CDR1, FR2, CDR2, FR3, CDR3 및 FR4를 포함한다. From N- terminal to C- terminal, both light and heavy chain variable regions are generally comprises a domain FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. 각각의 도메인에 대한 아미노산의 배정은 대개 문헌 ([Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991))], 또는 [Chothia & Lesk, J. Mol. Biol., 196:901-917 (1987)]; [Chothia et al., Nature, 342:878-883 (1989)])의 정의에 따른다. Usually the literature ([Kabat Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. (1987 and 1991))], or [Chothia & Lesk, J. Mol. Biol. Assignment of amino acids to each domain, 196: 901-917 (1987)]; [Chothia et al, Nature, 342:. to be in accordance with the definition of 878-883 (1989)).

특정 실시태양에서, 항체 중쇄는 항체 경쇄의 부재 하에 항원에 결합한다. In a specific embodiment, the antibody heavy chain binds to an antigen in the absence of an antibody light chain. 특정 실시태양에서, 항체 경쇄는 항체 중쇄의 부재 하에 항원에 결합한다. In a specific embodiment, the antibody light chain binds to an antigen in the absence of the antibody heavy chain. 특정 실시태양에서, 항체 결합 구역은 항체 경쇄의 부재 하에 항원에 결합한다. In a specific embodiment, the antibody binding zone will bind to antigen in the absence of an antibody light chain. 특정 실시태양에서, 항체 결합 구역은 항체 중쇄의 부재 하에 항원에 결합한다. In a specific embodiment, the antibody binding zone will bind to antigen in the absence of the antibody heavy chain. 특정 실시태양에서, 개별 가변 구역은 다른 가변 구역의 부재 하에 항원에 특이적으로 결합한다. In certain embodiments, the individual variable regions are specific binding to the antigen in the absence of other variable regions.

특정 실시태양에서, CDR의 명확한 서술 및 항체의 결합 부위를 포함하는 잔기의 확인은 항체의 구조를 해석함으로써 및/또는 항체-리간드 복합체의 구조를 해석함으로써 달성된다. In certain embodiments, the identification of residues comprising the binding site of an antibody and a clear description of the CDR's by analyzing the structure of the antibody and / or antibody is achieved by analyzing the structure of the ligand conjugate. 특정 실시태양에서, 이는 당업자에게 공지된 임의의 다양한 기술, 예를 들어 X-선 결정학에 의해 달성할 수 있다. In a specific embodiment, which any of the various techniques known to those skilled in the art, for example, can be achieved by the X- ray crystallography. 특정 실시태양에서, CDR 구역을 확인하거나 어림잡기 위해 다양한 분석 방법이 사용될 수 있다. In certain embodiments, a variety of analytical methods can be used to confirm or rule of thumb catching a CDR region. 그러한 방법의 예는 카바트 (Kabat) 정의, 코티아 (Chothia) 정의, AbM 정의 및 접촉 정의를 포함하고 이로 제한되지 않는다. An example of such a method comprises a Kabat (Kabat) defined, nose thiazole (Chothia) definition, AbM definition and the contact definition, and are not limited.

카바트 정의는 항체에서 잔기를 넘버링 (numbering)하기 위한 표준이고, CDR 구역을 확인하기 위해 일반적으로 사용된다 (예를 들어, [Johnson & Wu, Nucleic Acids Res., 28: 214-8 (2000)] 참조). Kabat definition is a standard for numbering (numbering) a residue in the antibody, and is generally used to determine the CDR region (e.g., [Johnson & Wu, Nucleic Acids Res, 28:. 214-8 (2000) ] Reference). 코티아 정의는 카바트 정의에 유사하지만, 코티아 정의는 특정 구조적 루프 구역의 위치를 고려한다 (예를 들어, [Chothia et al., J. Mol. Biol., 196: 901-17 (1986)]; [Chothia et al., Nature, 342: 877-83 (1989)] 참조). Thiazol-defined nose is similar to the Kabat definition, but the co-thiazol definition takes into account positions of certain structural loop region (e.g., [Chothia et al, J. Mol Biol, 196:... 901-17 (1986) ]; [Chothia et al, Nature, 342:. 877-83 (1989)] reference). AbM 정의에서는 항체 구조를 모델링하는 옥스포드 몰레큘라 그룹 (Oxford Molecular Group)에서 제조된 컴퓨터 프로그램의 통합 스위트 (integrated suite)를 사용한다 (예를 들어, [Martin et al., Proc Natl Acad Sci (USA), 86:9268-9272 (1989); "AbM™, A Computer Program for Modeling Variable Regions of Antibodies," Oxford, UK; Oxford Molecular, Ltd] 참조). The AbM definition uses an integrated suite of computer programs produced at Oxford Molecular modeling of the antibody structure group (Oxford Molecular Group) (integrated suite) (e.g., [Martin et al., Proc Natl Acad Sci (USA) , 86: 9268-9272 (1989); see Oxford Molecular, Ltd]); "abM ™, A Computer Program for Modeling Variable Regions of Antibodies," Oxford, UK. AbM 정의는 예를 들어, 문헌 [Samudrala et al., "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach," in PROTEINS, Structure, Function and Genetics Suppl., 3:194-198 (1999)]에 설명된 바와 같은 지식 데이타베이스 및 순-이론적 (ab initio) 방법의 조합을 이용하여 1차 서열로부터 항체의 3차 구조를 모델링한다. AbM definition are, for example, the literature described in [Samudrala et al, "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach," in PROTEINS, Structure, Function and Genetics Suppl, 3 194-198 (1999)..] such as knowledge data base and the order - using the theoretical (ab initio) method of combining models the tertiary structure of an antibody from primary sequence. 접촉 정의는 이용가능한 복합체 결정 구조의 분석에 기초한다 (예를 들어, 문헌 [MacCallum et al., J. Mol. Biol., 5:732-45 (1996)] 참조). Contact definition is based on an analysis of the available complex crystal structures (see, e.g., [MacCallum et al, J. Mol Biol, 5:... 732-45 (1996)] reference).

관습상, 중쇄 내의 CDR 구역은 일반적으로 H1, H2, 및 H3으로 칭하고, 아미노 말단으로부터 카르복시 말단으로의 방향으로 순차적으로 넘버링한다. Customary phase, CDR zones in the heavy chain are typically referred to as H1, H2, and H3, it is sequentially numbered in the direction from amino terminus to carboxy terminus. 경쇄 내의 CDR 구역은 일반적으로 L1, L2, 및 L3으로 칭하고, 아미노 말단으로부터 카르복시 말단으로의 방향으로 순차적으로 넘버링한다. CDR zones in the light chain are typically referred to L1, L2, and L3, it is sequentially numbered in the direction from amino terminus to carboxy terminus.

용어 "경쇄"는 결합 특이성을 부여하기 위해 충분한 가변 구역 서열을 갖는 전장 경쇄 및 그의 단편을 포함한다. The term "light chain" includes full-length light chain and fragments thereof having sufficient variable regions sequences to impart binding specificity. 전장 경쇄는 가변 구역 도메인, 즉 V L , 및 불변 구역 도메인, 즉 C L 을 포함한다. The full-length light chain includes a variable domain area, that is, V L, and constant domain area, that is L C. 경쇄의 가변 구역 도메인은 폴리펩티드의 아미노-말단에 존재한다. Variable regions of the light chain domains of the polypeptide is an amino-exist at the terminal. 경쇄는 카파 사슬 및 람다 사슬을 포함한다. The light chain comprises a kappa chain and lambda chain.

용어 "중쇄"는 결합 특이성을 부여하기 위해 충분한 가변 구역 서열을 갖는 전장 중쇄 및 그의 단편을 포함한다. The term "heavy chain" includes a full-length heavy chain and fragments thereof having sufficient variable regions sequences to impart binding specificity. 전장 중쇄는 가변 구역 도메인, 즉 V H , 및 3개의 불변 구역 도메인, 즉 C H 1, C H 2, 및 C H 3을 포함한다. The full-length heavy chain includes a variable domain area, that is, V H, and three constant domains zone, that is C H 1, C H 2, and C H 3. V H 도메인은 폴리펩티드의 아미노-말단에 존재하고, C H 도메인은 카르복실-말단에 존재하고, 여기서 C H 3이 폴리펩티드의 카르복시-말단에 가장 가깝다. V H domain of the polypeptide is the amino-terminus and in the presence, C H domains, the carboxyl-terminus in the presence, where the two C H 3 polypeptide carboxy-closest to the terminal. 중쇄는 IgG (IgG1, IgG2, IgG3 및 IgG4 아형 포함), IgA (IgA1 및 IgA2 아형 포함), IgM 및 IgE를 포함한 임의의 이소형의 것일 수 있다. Heavy chain may be of any isotype, including IgG (including IgA1 and IgA2 subtypes) (IgG1, IgG2, IgG3 and IgG4 subtypes including), IgA, IgM and IgE.

이중특이적 또는 이중기능적 항체는 일반적으로 2개의 상이한 중쇄/경쇄쌍 및 2개의 상이한 결합 부위를 갖는 인공 하이브리드 항체이다. Bispecific or dual functional antibody typically is an artificial hybrid antibody having two different heavy chain / light chain pairs and two different binding sites. 이중특이적 항체는 하이브리도마의 융합 또는 Fab' 단편의 연결을 포함하고 이로 제한되지 않는 다양한 방법에 의해 생산할 수 있다 (예를 들어, 문헌 ([Songsivilai et al., Clin. Exp. Immunol., 79:315-321 (1990)]; [Kostelny et al., J. Immunol., 148:1547-1553 (1992)]) 참조). . Bispecific antibodies may include fused or Fab 'fragments connection of the hybridoma and to produce by a variety of methods that are not limited to, (see, e.g., ([Songsivilai et al., Clin. Exp. Immunol, 79: 315-321 (1990)]; [Kostelny et al, J. Immunol, 148:.. 1547-1553, see (1992))).

일부 종의 포유동물은 또한 단일 중쇄만을 갖는 항체를 생산한다. Some species of mammals also produce antibodies having only a single heavy chain.

각각의 개별 면역글로불린 사슬은 일반적으로 각각 대략 90 내지 110개 아미노산으로 이루어지고 특징적인 폴딩 패턴을 갖는 몇몇 "면역글로불린 도메인"으로 구성된다. Each individual immunoglobulin chain is typically composed of approximately 90 to 110 amino acids, respectively are composed of several "immunoglobulin domain" having a characteristic folding pattern. 이들 도메인은 항체 폴리펩티드가 그로 구성되는 기초 단위이다. The domain is a basic unit of an antibody polypeptide is the configuration thereof. 인간에서, IgA 및 IgD 이소형은 4개의 중쇄 및 4개의 경쇄를 함유하고; In humans, IgA and IgD isotype will contain four heavy chains and four light chains; IgG 및 IgE 이소형은 2개의 중쇄 및 2개의 경쇄를 함유하고; IgG and IgE isotype will contain two heavy chains and two light chains; IgM 이소형은 5개의 중쇄 및 5개의 경쇄를 함유한다. The IgM isotype contains five heavy chains and five light chains. 중쇄 C 구역은 일반적으로 효과기 기능을 담당할 수 있는 하나 이상의 도메인을 포함한다. Heavy chain and C zones typically contain one or more domains that may be responsible for effector function. 중쇄 불변 구역 도메인의 수는 이소형에 의해 결정될 것이다. The number of heavy chain constant domain zone will be determined by the isotype. 예를 들어, IgG 중쇄는 C H 1, C H 2 및 C H 3으로 공지된 3개의 C 구역 도메인을 함유한다. For example, IgG heavy chains containing a known three zones C domain as C H 1, C H 2 and C H 3. 제공되는 항체는 임의의 이들 이소형 및 아형을 가질 수 있다. Antibody provided may be of any isotype and subtypes of these. 본 발명의 특정 실시태양에서, 항-PCSK9 항체는 IgG2 또는 IgG4 아형의 것이다. In certain embodiments of the invention, wherein the antibody is -PCSK9 of IgG2 or IgG4 subtype.

용어 "가변 구역" 또는 "가변 도메인"은 일반적으로 중쇄 내에 약 120 내지 130개 아미노 말단 아미노산 및 경쇄 내에 약 100 내지 110개 아미노 말단 아미노산을 포함하는, 항체의 경쇄 및/또는 중쇄의 일부분을 나타낸다. The term "variable regions" or "variable domain" generally indicates the about 120 to 130 amino terminal amino acid and about 100 to 110 amino terminal amino acid, the light chain and / or heavy chain portion of the antibody, including in the light chain in heavy chain. 특정 실시태양에서, 상이한 항체의 가변 구역은 동일한 종의 항체들 사이에서도 아미노산 서열이 광범하게 상이하다. In certain embodiments, variable regions of different antibodies is different to the amino acid sequence even among antibodies of the same species widespread. 항체의 가변 구역은 일반적으로 그의 표적에 대한 특정 항체의 특이성을 결정한다. Variable regions of the antibody will generally determine the specificity of a particular antibody for its target.

용어 "중화 항원 결합 단백질" 또는 "중화 항체"는 각각 리간드에 결합하여 그 리간드의 생물학적 효과를 방지하거나 감소시키는 항원 결합 단백질 또는 항체를 나타낸다. The term "neutralizing antigen binding proteins" or "neutralizing antibody" bind to each ligand represents an antigen binding protein or antibody to prevent or reduce the biological effects of the ligand. 이것은 예를 들어, 리간드 상의 결합 부위를 직접 차단함으로써 또는 리간드에 결합하여 간접 수단을 통해 결합하는 리간드의 능력을 변경시킴으로써 이루어질 수 있다 (예를 들어, 리간드의 구조적 또는 에너지 변경). This is, for example, be accomplished by a combination of the binding site on the ligand to the ligand by direct blocking or changing the ability of the ligand binding through indirect means (e.g., a structural change or energy of the ligand). 일부 실시태양에서, 상기 용어는 또한 그가 결합하는 단백질이 생물학적 기능을 수행하는 것을 방지하는 항원 결합 단백질을 나타낼 수 있다. In some embodiments, the term can also indicate the antigen binding protein to prevent the binding protein which he performs a biological function. 항원 결합 단백질, 예를 들어, 항체 또는 그의 면역학상 기능적 단편의 결합 및/또는 특이성을 평가하는데 있어서, 항체 또는 단편은 과잉의 항체가 리간드에 결합된 결합 파트너의 양을 적어도 약 1-20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-98%, 98-99% 또는 그 이상으로 (시험관 내 경쟁적 결합 분석으로 측정할 때) 감소시킬 때 그의 결합 파트너에 대한 리간드의 결합을 실질적으로 억제할 수 있다. Antigen binding protein, e.g., antibody, or for the evaluation of the binding and / or immunological specificity of the His functional fragment, antibody or fragment is at least about 1-20% to the amount of the antibody of over a binding partner bound to the ligand, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, to 97-98%, 98-99%, or more (as determined by in vitro competitive binding assay) to decrease it may substantially inhibit the binding of ligand to its binding partner. 일부 실시태양에서, PCSK9 항원 결합 단백질의 경우에, 그러한 중화 분자는 LDLR에 결합하는 PCSK9의 능력을 감소시킬 수 있다. In some embodiments, in the case of PCSK9 antigen-binding protein, such a neutralizing molecule may reduce the ability of the PCSK9 binding to LDLR. 일부 실시태양에서, 중화 능력은 경쟁 분석을 통해 특성 결정되고/되거나 설명된다. In some embodiments, the neutralizing capacity is described and determination of properties through competition analysis and / or. 일부 실시태양에서, 중화 능력은 IC 50 또는 EC 50 값의 면에서 설명된다. In some embodiments, the neutralizing capacity is described in terms of the IC 50 or EC 50 value. 일부 실시태양에서, ABP 27B2, 13H1, 13B5 및 3C4는 비-중화 ABP이고, 3B6, 9C9 및 31A4는 약한 중화제이고, 표 2 내의 나머지 ABP는 강한 중화제이다. In some embodiments, ABP 27B2, 13H1, 13B5 and 3C4 non-neutralized and ABP, 3B6, 9C9 and 31A4 is the weak neutralizing agent, and the other ABP in Table 2 is a strong neutralizer. 일부 실시태양에서, 항체 또는 항원 결합 단백질은 PCSK9에 결합하여 PCSK9가 LDLR에 결합하는 것을 방지함으로써 (또는 LDLR에 결합하는 PCSK9의 능력을 감소시킴으로써) 중화시킨다. In some embodiments, the antibody or antigen-binding proteins are neutralized by preventing binding to PCSK9 to PCSK9 binding to LDLR (or reduced by the ability of the PCSK9 binding to the LDLR). 일부 실시태양에서, 항체 또는 ABP는 PCSK9에 결합함으로써, 및 여전히 PCSK9가 LDLR에 결합하도록 하면서 LDLR의 PCSK9 매개된 분해를 방지 또는 감소시킴으로써 중화시킨다. In some embodiments, the antibody or ABP is neutralized by PCSK9 prevent or reduce the decomposition of the intermediate LDLR and by binding to PCSK9, and still the PCSK9 binding to the LDLR. 따라서, 일부 실시태양에서, 중화 ABP 또는 항체는 여전히 PCSK9/LDLR 결합을 허용할 수 있지만, LDLR의 후속적인 PCSK9 관여된 분해를 방지할 (또는 감소시킬) 것이다. Thus, in some embodiments, the ABP or neutralizing antibodies remains to allow binding PCSK9 / LDLR, but will (or decrease) to avoid subsequent degradation of the LDLR PCSK9 involved.

용어 "표적"은 항원 결합 단백질이 결합할 수 있는 분자 또는 분자의 일부를 나타낸다. The term "target" refers to a portion of a molecule or molecules capable of binding to the antigen-binding protein. 특정 실시태양에서, 표적은 하나 이상의 에피토프를 가질 수 있다. In certain embodiments, a target may have one or more epitopes. 특정 실시태양에서, 표적은 항원이다. In certain embodiments, the target is an antigen. 구문 "항원 결합 단백질"에서 "항원"의 사용은 단순히 항체가 항원을 포함하는 단백질 서열에 결합할 수 있음을 나타낸다. Use of the phrase "antigen" in the "antigen binding protein" merely indicates that the antibody is capable of binding to the protein sequence that contains the antigen. 본 문맥에서, 단백질이 외래의 것이거나 면역 반응을 유도할 수 있음을 요구하지는 않는다. In this context, it does not require that the protein is of foreign or can induce an immune response.

동일한 에피토프에 대해 경쟁하는 항원 결합 단백질 (예를 들어, 중화 항원 결합 단백질 또는 중화 항체)의 상황에서 사용될 때 용어 "경쟁하는"은 시험되는 항원 결합 단백질 (예를 들어, 항체 또는 그의 면역학상 기능적 단편)이 공통 항원 (예를 들어, PCSK9 또는 그의 단편)에 대한 참조 항원 결합 단백질 (예를 들어, 리간드, 또는 참조 항체)의 특이적 결합을 방지하거나 억제하는 (예를 들어 감소시키는) 분석에 의해 결정되는 항원 결합 단백질들 사이의 경쟁을 의미한다. Antigen binding competition for the same epitope protein "competing" term when used in the context of (e. G., Neutralizing antigen binding protein or a neutralizing antibody) is to be tested antigen binding proteins (e.g., antibodies or their immunological the functional fragment ) by a reference antigen-binding protein (e.g., a ligand, or to reduce, for (for example, to prevent or inhibit the specific binding of a reference antibody)) analysis on a common antigen (e.g., PCSK9 or a fragment thereof) It means competition between antigen binding proteins is determined. 하나의 항원 결합 단백질이 다른 것과 경쟁하는지 결정하기 위해 많은 종류의 경쟁적 결합 분석, 예를 들어 고상의 직접 또는 간접 방사성 면역분석 (RIA), 고상의 직접 또는 간접 효소 면역분석 (EIA), 샌드위치 경쟁 분석 (예를 들어, [Stahli et al., 1983, Methods in Enzymology 9:242-253] 참조); Single antigen-binding proteins are many types of competitive binding of to determine that competitive as other analysis, e.g., direct or indirect radioimmunoassay analysis of the solid phase (RIA), direct or indirect enzyme in the solid phase immunoassay (EIA), sandwich competition assays (e.g., [Stahli et al, 1983, Methods in Enzymology 9:. 242-253] reference); 고상의 직접 비오틴-아비딘 EIA (예를 들어, [Kirkland et al., 1986, J. Immunol. 137:3614-3619] 참조), 고상의 직접 표지된 분석, 고상의 직접 표지된 샌드위치 분석 (예를 들어, [Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press] 참조); Solid phase direct biotin-avidin EIA (e.g., [Kirkland et al, 1986, J. Immunol 137:.. 3614-3619] reference), direct analysis of labeled solid-phase direct labeled sandwich assay in solid phase (e. g., see [Harlow and Lane, 1988, Antibodies, A Laboratory Manual, Cold Spring Harbor Press]); I-125 표지를 사용하는 고상의 직접 표지 RIA (예를 들어, [Morel et al., 1988, Molec. Immunol. 25:7-15] 참조); I-125 labeled directly cover the solid-phase RIA for use (e.g., [Morel et al, 1988, Molec Immunol 25: 7-15...] Reference); 고상의 직접 비오틴-아비딘 EIA (예를 들어, [Cheung, et al., 1990, Virology 176:546-552] 참조); Solid phase direct biotin-avidin EIA (e.g., [Cheung, et al, 1990, Virology 176:. 546-552] reference); 및 직접 표지된 RIA (Moldenhauer et al., 1990, Scand. J. Immunol. 32:77-82)을 이용할 수 있다. And direct labeled RIA (Moldenhauer et al, 1990, Scand J. Immunol 32:... 77-82) may be used. 일반적으로, 그러한 분석은 이들 표지되지 않은 시험 항원 결합 단백질 및 표지된 참조 항원 결합 단백질 중 어느 하나를 보유하는 고체 표면 또는 세포에 결합된 정제된 항원의 사용을 포함한다. In general, such an assay involves the use of purified antigen bound to a solid surface or cells for holding any one of these unlabeled test antigen-binding protein and a labeled reference antigen-binding protein. 경쟁적 억제는 시험 항원 결합 단백질의 존재 하에 고체 표면 또는 세포에 결합된 표지의 양을 결정함으로써 측정한다. Competitive inhibition is measured by determining the amount of labeled binding in the presence of a test antigen binding protein to the solid surface or cells. 대체로, 시험 항원 결합 단백질은 과량으로 존재한다. In general, the test antigen binding protein is present in excess. 경쟁 분석에 의해 확인된 항원 결합 단백질 (경쟁 항원 결합 단백질)은 참조 항원 결합 단백질과 동일한 에피토프에 결합하는 항원 결합 단백질, 및 입체 장애가 일어나도록 참조 항원 결합 단백질이 결합하는 에피토프에 충분히 가까운 인접한 에피토프에 결합하는 항원 결합 단백질을 포함한다. The antigen-binding protein (competing antigen binding protein), identified by competition assay coupled to sufficiently close to adjacent epitopes on an epitope that reference antigen binding protein is coupled to antigen-binding protein, and steric hindrance up binding to the same epitope and a reference antigen-binding protein which comprises an antigen-binding protein. 경쟁적 결합을 결정하기 위한 방법에 관한 추가의 상세내역을 본원의 실시예에 제공한다. It provides additional details of a method for determining competitive binding to an embodiment of the present application. 대체로, 경쟁 항원 결합 단백질은 과량으로 존재할 때, 공통 항원에 대한 참조 항원 결합 단백질의 특이적 결합을 적어도 40-45%, 45-50%, 50-55%, 55-60%, 60-65%, 65-70%, 70-75% 또는 75% 또는 그 이상 억제할 (예를 들어, 감소시킬) 것이다. In general, the competitive antigen-binding proteins, when present in excess, at least 40-45% of specific binding of a reference antigen-binding protein to a common antigen, 45-50%, 50-55%, 55-60%, 60-65% , 65-70%, (e.g., reduced) to inhibit 70-75% or 75% or more will. 일부 경우에, 결합은 적어도 80-85%, 85-90%, 90-95%, 95-97%, 또는 97% 또는 그 이상 억제된다. In some cases, the binding is inhibitory at least 80-85%, 85-90%, 90-95%, 95-97%, or 97% or more.

용어 "항원"은 선택적인 결합제, 예를 들어 항원 결합 단백질 (예를 들어, 항체 또는 그의 면역학상 기능적 단편 포함)이 결합할 수 있는 분자 또는 분자의 일부를 나타낸다. The term "antigen" is a selective binding agent, such as antigen-binding protein (e.g., comprising an antibody or a functional fragment Immunology phase) shows a portion of a molecule or molecules which can be combined. 일부 실시태양에서, 항원은 그 항원에 결합할 수 있는 항체를 생산하도록 동물 내에서 사용될 수 있다. In some embodiments, the antigen may be used in an animal to produce antibody capable of binding to the antigen. 항원은 상이한 항원 결합 단백질, 예를 들어, 항체와 상호작용할 수 있는 하나 이상의 에피토프를 가질 수 있다. Antigen is different from the antigen-binding protein, for example, may have one or more epitopes that can act as an antibody cross.

용어 "에피토프"는 항원 결합 단백질, 예를 들어 항체 또는 T-세포 수용체가 결합할 수 있는 임의의 결정자를 포함한다. The term "epitope" includes any of the crystallite in the antigen binding protein, e.g., antibody or T- cell receptor can bind. 에피토프는 항원을 표적으로 하는 항원 결합 단백질이 결합하는 항원의 구역이고, 항원이 단백질인 경우에, 항원 결합 단백질에 직접 접촉하는 특이적 아미노산을 포함한다. Epitope is a region of the antigen to the antigen binding protein to the antigen binding to the target, includes a specific amino acid that contacts antigen directly in the case of protein, the antigen binding protein. 가장 종종, 에피토프는 단백질 상에 존재하지만, 일부 경우에 다른 종류의 분자, 예를 들어 핵산 상에 존재할 수 있다. Most often, the epitope may be present on a nucleic acid for the presence in the protein, but other kinds of molecules, in some cases, for example. 에피토프 결정자는 아미노산, 당 측쇄, 포스포릴 또는 술포닐기와 같은 분자의 화학적 활성 표면 그룹 (grouping)을 포함할 수 있고, 특이적인 3차원 구조 특징 및/또는 특이적인 전하 특징을 가질 수 있다. Epitope-maker may include a chemically active surface groups (grouping) of the molecules such as amino acids, sugar side chains, phosphoryl, or sulfonyl group, and can have specific three-dimensional structural features and / or specific charge characteristics. 일반적으로, 특정 표적 항원에 특이적인 항체는 단백질 및/또는 거대분자의 복합 혼합물 내의 표적 항원 상의 에피토프를 우선적으로 인식할 것이다. In general, antibodies specific for a particular target antigen will preferentially recognize epitopes on the target antigen in a complex mixture of proteins and / or macromolecules.

본원에서 사용될 때 "실질적으로 순수한"은 기술된 종의 분자가 존재하는 우세한 종임을, 즉, 몰 기준으로 동일한 혼합물 내에 임의의 다른 개별 종보다 더욱 풍부함을 의미한다. As used herein "substantially pure" it refers to a more abundant than any other individual species in the same mixture as that prevailing species, i.e., on a molar basis to that of the described molecule species present. 특정 실시태양에서, 실질적으로 순수한 분자는 대상 종이 존재하는 모든 거대분자 종의 적어도 50% (몰 기준)를 차지하는 조성물이다. In certain embodiments, a substantially pure molecule is a composition, which accounts for at least 50% (molar basis) of all macromolecular species present paper target. 다른 실시태양에서, 실질적으로 순수한 조성물은 조성물 내에 존재하는 모든 거대분자 종의 적어도 80%, 85%, 90%, 95%, 또는 99%를 차지할 것이다. In another embodiment, a substantially pure composition will account for at least 80%, 85% of all macromolecular species present in the composition, 90%, 95%, or 99%. 다른 실시태양에서, 대상 종은 오염 종이 통상적인 검출 방법에 의해 조성물 내에서 검출될 수 없고, 따라서, 조성물이 단일 검출가능한 거대분자 종으로 이루어지는 본질적인 균일성으로 정제된다. In another embodiment, the target species is not contaminated by the detection method of a conventional paper can be detected in the composition, therefore, is purified to essential homogeneity comprising a macromolecular species compositions detected two days.

용어 "물질"은 본원에서 화학적 화합물, 화학적 화합물들의 혼합물, 생물학적 거대분자, 또는 생물학적 물질로부터 제조된 추출물을 나타내도록 사용된다. The term "material" is used to indicate that the extracts prepared from the mixture, a biological macromolecule, or a biological material of a chemical compound, a chemical compound herein.

본원에서 사용될 때, 용어 "표지" 또는 "표지된"은 예를 들어, 방사성표지된 아미노산의 포함, 또는 표식된 아비딘 (예를 들어, 광학 또는 비색 방법에 의해 검출할 수 있는 형광 마커 또는 효소적 활성을 함유하는 스트렙타비딘)에 의해 검출할 수 있는 비오틴 모이어티의 폴리펩티드에의 부착에 의한 검출가능한 마커의 포함을 나타낸다. As used herein, the term "labeled" or "labeled", for example, radioactive the included amino acid, or a marker labeled avidin (e. G., A fluorescent marker that can be detected by optical or colorimetric methods or enzymatic It indicates the inclusion of a detectable marker by the attachment of the polypeptide of biotin moieties that can be detected by streptavidin) containing the active. 특정 실시태양에서, 표지 또는 마커는 또한 치료적일 수 있다. In certain embodiments, the label or marker can also jeokil treatment. 폴리펩티드 및 당단백질을 표지하는 다양한 방법이 당업계에 공지되어 있고 사용될 수 있다. Various methods of labeling polypeptides and glycoproteins are known in the art and may be used. 폴리펩티드에 대한 표지의 예는 다음의 것을 포함하고 이로 제한되지 않는다: 방사선 동위원소 또는 방사선 핵종 (예를 들어, 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), 형광 표지 (예를 들어, FITC, 로다민, 란타나이드 인광체), 효소적 표지 (예를 들어, 양고추냉이 퍼옥시다제, β-갈락토시다제, 루시퍼라제, 알칼리성 포스파타제), 화학발광물질, 비오티닐기, 2차 리포터에 의해 인식되는 소정의 폴리펩티드 에피토프 (예를 들어, 류신 지퍼 쌍 서열, 2차 항체에 대한 결합 부위, 금속 결합 도메인, 에피토프 태그). Examples of labels for polypeptides include the following and are not limited to: radioisotopes or radionuclides (e.g., 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I), fluorescent labels (e.g., FITC, rhodamine, lanthanide phosphors), enzymatic labels (e.g., horseradish peroxidase, β- galactosidase, luciferase, alkaline phosphatase ), a chemiluminescent substance, biotinylated groups, the second predetermined polypeptide epitopes recognized by a reporter (e.g., leucine zipper pair sequences, the second binding site, the metal binding domains, epitope tags for the antibody). 특정 실시태양에서, 표지는 잠재적인 입체 장애를 감소시키기 위해 다양한 길이의 스페이서 아암 (arm)에 의해 부착된다. In a particular embodiment, the cover is attached by a spacer arm (arm) of various lengths to reduce potential steric hindrance.

본원에서 사용될 때, 용어 "생물학적 샘플"은 생명체 또는 이전에 생명체로부터의 임의의 양의 물질을 포함하고 이로 제한되지 않는다. As used herein, the term "biological sample" does not include any quantity of a substance from a living organism or to the previously limited. 상기 생명체는 인간, 마우스, 원숭이, 래트, 토끼, 및 다른 동물을 포함하고 이로 제한되지 않는다. The organisms including humans, mice, monkeys, rats, rabbits, and other animals and is not limited thereto. 상기 물질은 혈액, 혈청, 소변, 세포, 장기, 조직, 뼈, 골수, 림프절, 및 피부를 포함하고 이로 제한되지 않는다. Such materials include blood, serum, urine, cells, organs, tissues, bone, bone marrow, lymph nodes, and skin and without limitation.

본원에서 사용되는 용어 "제약 물질 조성물" (또는 물질 또는 약물)은 환자에게 적절하게 투여될 때 목적하는 치료 효과를 유도할 수 있는 화학적 화합물, 조성물, 물질 또는 약물을 나타낸다. As used herein, the term "pharmaceutical composition material" (or substance or drug) shows the chemical compound, composition, substance or drug capable of inducing a desired therapeutic effect when properly administered to a patient. 반드시 한 종류를 초과하는 성분을 필요로 하지는 않는다. It does not necessarily require more than one type of component.

용어 "치료 유효량"은 포유동물에서 치료 반응을 생성하는 것으로 결정된 PCSK9 항원 결합 단백질의 양을 나타낸다. The term "therapeutically effective amount" denotes the amount of PCSK9 antigen binding protein determined to produce a therapeutic response in a mammal. 그러한 치료 유효량은 당업자에 의해 쉽게 확인된다. Such a therapeutically effective amount is readily confirmed by those of ordinary skill in the art.

본원에서 사용될 때, 용어 "조정물질"은 분자의 활성 또는 기능을 변화 또는 변경시키는 화합물이다. As used herein, the terms "adjusting substance" is a compound that changes or changing the activity or function of the molecule. 예를 들어, 조정물질은 조정물질의 부재 하에 관찰된 활성 또는 기능의 세기에 비해 분자의 특정 활성 또는 기능의 세기를 증가 또는 감소시킬 수 있다. For example, the material may be adjusted to increase or decrease the intensity of a specific activity or function of the molecule compared to the intensity of the activity or function observed in the absence of the adjusted material. 특정 실시태양에서, 조정물질은 억제제이고, 이는 분자의 적어도 하나의 활성 또는 기능의 세기를 감소시킨다. In certain embodiments, the materials are adjusted inhibitor, which reduces at least one of the intensity of the activity or function of the molecule. 분자의 특정 예시적인 활성 및 기능은 결합 친화도, 효소적 활성, 및 신호 전달을 포함하고 이로 제한되지 않는다. Specific exemplary active and function of the molecule includes a road, enzymatic activity, and signal transduction binding affinity and are not limited. 특정 예시적인 억제제는 단백질, 펩티드, 항체, 펩티바디, 탄수화물 또는 작은 유기 분자를 포함하고 이로 제한되지 않는다. Specific exemplary inhibitors include proteins, peptides, antibodies, peptibodies, carbohydrates or small organic molecules, and are not limited. 펩티바디는 예를 들어, 미국 특허 6,660,843 (PCT 출원 WO 01/83525에 대응함)에 기재되어 있다. Peptibodies, for example, is described in U.S. Patent 6,660,843 (corresponding to PCT application WO 01/83525).

용어 "환자" 및 "대상"은 교환가능하게 사용되고, 인간 및 비-인간 동물 대상뿐만 아니라 이전에 진단된 질환을 갖는 대상, 이전에 인식된 질환이 없는 대상, 의사의 치료를 받는 대상, 질환을 발병할 위험이 있는 대상 등을 포함한다. The term "patient" and "subject" are used interchangeably, human and non-human animal subject, as well as target with a previously diagnosed disease, there is no previously recognized diseases on the target, the target receives medical treatment, the disease and the like are at risk of developing target.

용어 "처치하다" 및 "처치"는 치료적 처치, 예방적 처치, 및 대상이 질환을 발병할 위험 또는 다른 위험 인자를 감소시키는 용도를 포함한다. The term "treatment" and "treatment" includes the use for reducing the risk or other risk factors to develop a therapeutic treatment, prophylactic treatment, and the disease target. 처치는 질환의 완전한 치유를 요구하지 않고, 증상 또는 근원적인 위험 인자를 감소시키는 실시태양을 포함한다. Aid includes embodiments that do not require a complete cure of the disease, reduce the symptoms or underlying risk factors.

용어 "예방하다"는 사건의 가능성의 100% 제거를 요구하지는 않는다. The term "to prevent" does not require the removal of a 100% probability of the event. 오히려, 상기 용어는 사건의 발생 가능성이 화합물 또는 방법의 존재 하에 감소된 것을 나타낸다. Rather, the term indicates that the possibility of occurrence of events decreased in the presence of a compound or method.

재조합 DNA, 올리고뉴클레오티드 합성, 및 조직 배양 및 형질전환 (예를 들어, 전기천공, 리포펙션 (lipofection))을 위해 표준 기술이 사용될 수 있다. Recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipoic peksyeon (lipofection)) is the standard technique may be used for. 효소적 반응 및 정제 기술은 제조사의 지시에 따라 또는 당업계에서 일반적으로 달성되거나 본원에서 설명되는 바와 같이 수행할 수 있다. Enzymatic reactions and purification techniques may be achieved, or in general in the art or according to the manufacturer's instructions to perform as described herein. 상기한 기술 및 절차는 일반적으로 당업계에 잘 공지된 통상적인 방법에 따라, 및 본 명세서 전체에서 인용되고 논의하는 각종 일반적인 및 보다 구체적인 참조문 (예를 들어, 임의의 목적으로 본원에 참조로 포함시킨 문헌 [Sambrook et al., Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1989))] 참조)에 설명된 바와 같이 수행할 수 있다. The above techniques and procedures generally in accordance with the well of the known conventional methods in the art, and herein, various general and see more specific cited throughout discussed door (e. G., Incorporated herein by reference for any purpose which literature [Sambrook et al, Molecular Cloning:. a Laboratory Manual (. 2d ed, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1989))] reference) may be carried out as described in. 구체적인 정의를 제공하지 않으면, 본원에 설명된 분석 화학, 합성 유기 화학, 및 의학 및 제약 화학과 연관하여 사용되는 명명법과 그의 실험실 절차 및 기술은 당업계에 잘 공지되고 일반적으로 사용되는 것이다. If it does not provide any specific definition, the chemical analysis described herein, synthetic organic chemistry, and medical and pharmaceutical chemistry and nomenclature and his laboratory procedures and techniques used in connection will be well known in the art and commonly used. 표준 기술이 화학적 합성, 화학적 분석, 제약 제제, 제형, 및 전달, 및 환자의 처치를 위해 사용될 수 있다. Standard techniques may be used for chemical syntheses, chemical analyzes, pharmaceutical preparation, formulation, and delivery, and treatment of patients.

PCSK9에 대한 항원 결합 단백질 The antigen binding protein to PCSK9

전구단백질 전환효소 섭틸리신 켁신 타입 9 (PCSK9)는 저밀도 지단백질 수용체 (LDLR) 단백질의 수준을 조절하는데 관여하는 세린 프로테아제이다 ([Horton et al., 2007]; [Seidah and Prat, 2007]). Precursor protein-converting enzyme perturbation Tilly new keksin type 9 (PCSK9) is a serine protease which is involved in controlling the levels of low-density lipoprotein receptor (LDLR) protein ([Horton et al, 2007.]; [Seidah and Prat, 2007]). PCSK9는 세린 프로테아제의 섭틸리신 (S8) 패밀리 내의 프로호르몬-전구단백질 전환효소이다 (Seidah et al., 2003). PCSK9 is in the pro hormone interference Tilly new (S8) family of serine proteases-a precursor protein-converting enzyme (Seidah et al, 2003.). 예시적인 인간 PCSK9 아미노산 서열을 도 1a (단백질의 "프로" 도메인은 밑줄로 표시한다) 및 도 1b-1e (신호 서열을 굵게 도시하고, 프로-도메인을 밑줄친다)에서 서열 1 및 3으로서 제시한다. Figure 1a an exemplary human PCSK9 amino acid sequence ( "pro" domain of the protein is displayed and underlined) and 1b-1e - presented as SEQ ID NO 1 and 3 In (shown in bold for the signal sequence and the pro beats underscore the domain) . 예시적인 인간 PCSK9 코딩 서열은 서열 2로서 제시된다 (도 1b-1e). Exemplary human PCSK9 coding sequence is presented as SEQ ID NO: 2 (Fig. 1b-1e). 본원에서 설명되는 바와 같이, PCSK9 단백질은 또한 전장 PCSK9 단백질의 단편을 포함할 수 있다. As described herein, PCSK9 protein may also comprise a fragment of full-length PCSK9 protein. PCSK9 단백질의 구조는 최근에 2군의 집단에 의해 규명되었다 (그 전문을 본원에 참조로 포함시킨 문헌 [Cunningham et al., Nature Structural & Molecular Biology, 2007], 및 [Piper et al., Structure, 15:1-8, 2007]). The structure of PCSK9 protein was recently identified by the group of the second group in (which literature including its entirety herein by reference [Cunningham et al., Nature Structural & Molecular Biology, 2007], and [Piper et al., Structure, 15: 1-8, 2007). PCSK9는 신호 서열, N-말단 프로도메인, 섭틸리신-유사 촉매 도메인 및 C-말단 도메인을 포함한다. PCSK9 is a signal sequence, N- terminal pro domain, Sup Shin Tilly - comprises similar catalytic domain and the C- terminal domain.

PCSK9, 예를 들어 인간 PCSK9에 결합하는 항원 결합 단백질 (ABP)를 제공한다. PCSK9, for example, provides an antigen-binding proteins (ABP) that bind to human PCSK9. 일부 실시태양에서, 제공되는 항원 결합 단백질은 본원에서 설명되는 하나 이상의 상보성 결정 구역 (CDR)을 포함하는 폴리펩티드이다. In some embodiments, the antigen binding proteins provided are polypeptides comprising one or more complementarity determining section (CDR) described herein. 일부 항원 결합 단백질에서, CDR은 "프레임워크" 구역 내로 파묻히고, 이는 CDR(들)의 적합한 항원 결합 특성이 달성되도록 CDR(들)을 배향시킨다. In some antigen binding proteins, CDR is embedded in into the "framework" zone, which in turn align the CDR (s) to achieve the proper antigen binding properties of the CDR (s). 일부 실시태양에서, 본원에서 제공되는 항원 결합 단백질은 PCSK9와 LDLR 사이의 상호작용을 저해하거나, 차단하거나, 감소시키거나, 조정할 수 있다. In some embodiments, the antigen binding proteins provided herein can inhibit the interaction between PCSK9 and LDLR, or block or reduce or, can be adjusted. 그러한 항원 결합 단백질은 "중화"로서 표시한다. Such antigen-binding proteins are expressed as "neutralizing". 일부 실시태양에서, 항원 결합 단백질이 중화성이고 PCSK9에 결합되더라도, PCSK9와 LDLR 사이의 결합은 여전히 일어날 수 있다. In some embodiments, the antigen binding protein is a neutralizing and even when coupled to PCSK9, the bond between PCSK9 and LDLR can still take place. 예를 들어, 일부 실시태양에서, ABP는 PCSK9 상의 LDLR 결합 부위를 차단하지 않으면서 LDLR에 대한 PCSK9의 불리한 영향을 방지하거나 감소시킨다. For example, in some embodiments, the ABP prevents an adverse effect of PCSK9 on standing LDLR, without blocking the LDLR binding site on PCSK9 or decreased. 따라서, 일부 실시태양에서, ABP는 PCSK9와 LDLR 사이의 결합 상호작용을 방지하지 않으면서 LDLR의 분해를 일으키도록 PCSK9의 능력을 조정하거나 변경시킨다. Thus, in some embodiments, the ABP thereby adjust the ability of the PCSK9 to cause mutual coupling, without preventing the action of the LDLR degradation between PCSK9 and LDLR or change. 그러한 ABP는 구체적으로 "비-경쟁적으로 중화" ABP로서 설명할 수 있다. Such ABP specifically - can be described as "non-neutralizing competitively" ABP. 일부 실시태양에서, 중화 ABP는 PCSK9가 LDLR에 결합하는 것을 방지하는 위치에서 및/또는 방식으로 PCSK9에 결합한다. In some embodiments, the neutralizing ABP bind to PCSK9 at the position and / or a method for preventing PCSK9 binding to LDLR. 그러한 ABP는 구체적으로 "경쟁적으로 중화" ABP로서 설명할 수 있다. Such ABP may be specifically described as a "competitive neutralized with" ABP. 상기 두 중화제는 모두 대상 내에 존재하는 유리 LDLR의 양을 보다 많도록 할 수 있고, 이는 보다 많은 LDLR을 LDL에 결합시킨다 (그에 의해 대상에서 LDL 양을 감소시킨다). The two neutralizing agents may all be so greater than the amount of glass present in the target LDLR, which combines more LDLR for LDL (thereby reducing the amount of LDL in the subject by him). 다시, 이는 대상 내에 존재하는 혈청 콜레스테롤의 양을 감소시킨다. Again, this reduces the amount of serum cholesterol present in the subject.

일부 실시태양에서, 본원에서 제공되는 항원 결합 단백질은 PCSK9-매개 활성 (결합 포함)을 억제할 수 있다. In some embodiments, the antigen binding proteins provided herein can be suppressed PCSK9- mediated activity (including binding). 일부 실시태양에서, 이들 에피토프에 결합하는 항원 결합 단백질은 특히 PCSK9와 LDLR 사이의 상호작용 및 PCSK9에 의해 매개되는 다른 생리학적 효과를 억제한다. In some embodiments, the antigen binding proteins that bind to these epitopes inhibit other physiological effects mediated by the interaction between PCSK9 and in particular PCSK9 and LDLR. 일부 실시태양에서, 항원 결합 단백질은 PCSK9에 대한 인간, 예를 들어 완전 인간 항체이다. In some embodiments, the antigen binding protein is a fully human antibody containing the human, for example for PCSK9.

일부 실시태양에서, ABP는 PCSK9의 촉매 도메인에 결합한다. In some embodiments, ABP binds to the catalytic domain of PCSK9. 일부 실시태양에서, ABP는 성숙형의 PCSK9에 결합한다. In some embodiments, the ABP binds PCSK9 of mature. 일부 실시태양에서 ABP는 PCSK9의 프로도메인 내에 결합한다. In some embodiments ABP is incorporated in the pro domain of PCSK9. 일부 실시태양에서, ABP는 성숙형의 PCSK9에 선택적으로 결합한다. In some embodiments, ABP is selectively coupled to the mature PCSK9. 일부 실시태양에서, ABP는 PCSK9가 LDLR에 결합하거나 효율적으로 결합할 수 없는 방식으로 촉매 도메인에 결합한다. In some embodiments, the ABP binds PCSK9 catalytic domain in a way that can not bond to the LDLR or effectively coupled. 일부 실시태양에서, 항원 결합 단백질은 촉매 도메인의 c-말단에 결합하지 않는다. In some embodiments, the antigen binding protein does not bind to the c- terminus of the catalytic domain. 일부 실시태양에서, 항원 결합 단백질은 촉매 도메인의 n-말단에 결합하지 않는다. In some embodiments, the antigen binding protein does not bind to the n- terminus of the catalytic domain. 일부 실시태양에서, ABP는 PCSK9 단백질의 n- 또는 c-말단에 결합하지 않는다. In some embodiments, the ABP is not coupled to the n- or the c- terminus of the PCSK9 protein. 일부 실시태양에서, ABP는 본원에 논의된 항체가 결합하는 임의의 하나의 에피토프에 결합한다. In some embodiments, ABP is bonded to any one of the epitopes that bind the antibodies discussed herein. 일부 실시태양에서, 이는 본원에 개시된 항체와 다른 항체들 사이의 경쟁 분석에 의해 결정할 수 있다. In some embodiments, which can be determined by competition assays between the antibody and other antibodies disclosed herein. 일부 실시태양에서, ABP는 표 2에 기재된 항체 중 하나가 결합하는 에피토프에 결합한다. In some embodiments, ABP binds to an epitope that binds one of the antibodies listed in Table 2. 일부 실시태양에서, 항원 결합 단백질은 PCSK9가 LDLR과 상호작용하는 것을 방지하도록 특이적 입체형태적 상태의 PCSK9에 결합한다. In some embodiments, the antigen binding protein binds to a specific three-dimensional conformational state of PCSK9 to prevent PCSK9 interacts with LDLR. 일부 실시태양에서, ABP는 PCSK9의 V 도메인에 결합한다. In some embodiments, ABP is coupled to the V domain of PCSK9. 일부 실시태양에서, ABP는 PCSK9의 V 도메인에 결합하고, PCSK9가 LDLR에 결합하는 것을 방지한다 (또는 감소시킨다). In some embodiments, the ABP (thereby or decreasing) binding to the V domain of PCSK9 and prevents PCSK9 binding to LDLR. 일부 실시태양에서, ABP는 PCSK9의 V 도메인에 결합하고, LDLR에 대한 PCSK9의 결합을 방지하지 (또는 감소시키지) 않으면서, ABP는 LDLR에 대해 PCSK9를 통해 매개된 불리한 활성을 방지하거나 감소시킨다. In some embodiments, ABP couples to the V domain of PCSK9 and not prevent the binding of PCSK9 on LDLR without (or not reduced), ABP will prevent the adverse activity mediated through PCSK9 for the LDLR or decrease.

본원에서 개시되는 항원 결합 단백질은 다양한 유용성을 갖는다. Antigen-binding proteins that are disclosed herein have a wide range of usefulness. 예를 들어, 일부의 항원 결합 단백질은 특이적인 결합 분석, PCSK9, 특히 인간 PCSK9 또는 그의 리간드의 친화도 정제, 및 PCSK9 활성의 다른 길항제를 확인하기 위한 스크리닝 분석에서 유용하다. For example, in some antigen binding proteins are useful in specific binding assays, PCSK9, in particular human PCSK9 or affinity purification of its ligands, and PCSK9 screening assays for identifying antagonists of the other active. 일부의 항원 결합 단백질은 LDLR에 대한 PCSK9의 결합을 억제하기 위해, 또는 PCSK9-매개 활성을 억제하기 위해 유용하다. Some antigen binding proteins are useful to suppress, or PCSK9- mediated activity to inhibit the binding of PCSK9 on LDLR.

항원 결합 단백질은 본원에 설명된 바와 같이 다양한 치료 용도에서 사용될 수 있다. Antigen-binding proteins can be used in a variety of therapeutic applications, as described herein. 예를 들어, 일부 실시태양에서, PCSK9 항원 결합 단백질은 본원에 추가로 설명되는 바와 같은 PCSK9와 연관된 병태, 예를 들어 콜레스테롤 관련 질환 (또는 "혈청 콜레스테롤 관련 질환"), 예를 들어 고콜레스테롤혈증을 치료하기 위해 유용하다. For example, in some embodiments, PCSK9 antigen binding proteins PCSK9 and associated conditions, e.g., cholesterol-related disease (or "serum cholesterol-related diseases"), for example, hypercholesterolemia, as described further herein it is useful for therapy. 항원 결합 단백질의 다른 용도는 예를 들어, PCSK9-연관 질병 또는 병태의 진단, 및 PCSK9의 존재 또는 부재를 결정하기 위한 스크리닝 분석을 포함한다. Other uses of the antigen binding proteins include, for example, screening assays for determining a PCSK9- associated disease or medical condition, and the presence or absence of PCSK9. 본원에서 설명되는 일부의 항원 결합 단백질은 PCSK9 활성과 연관된 예후, 증상, 및/또는 건강 이상의 치료에 유용하다. Some antigen binding proteins described herein are useful for the treatment prognosis, symptoms, and / or health or more associated with PCSK9 activity.

일부 실시태양에서, 제공되는 항원 결합 단백질은 하나 이상의 CDR (예를 들어, 1, 2, 3, 4, 5 또는 6개의 CDR)을 포함한다. In some embodiments, it provided the antigen binding protein comprises at least one CDR (e.g., one, two, three, four, five, or six CDR). 일부 실시태양에서, 항원 결합 단백질은 (a) 폴리펩티드 구조, 및 폴리펩티드 구조 내로 삽입되고/되거나 연결되는 (b) 하나 이상의 CDR을 포함한다. In some embodiments, the antigen binding protein comprises (a) includes (b) at least one CDR to be inserted into a polypeptide structure, and polypeptide structure and / or connection. 폴리펩티드 구조는 다양한 상이한 형태를 취할 수 있다. Polypeptide structure can take a variety of different forms. 예를 들어, 상기 구조는 천연 발생 항체, 또는 그의 단편 또는 변이체의 프레임워크이거나 그를 포함할 수 있거나, 자연에서 완전히 합성될 수 있다. For example, the structure may comprise him or framework of a naturally occurring antibody, or a fragment or variant thereof, may be completely synthetic in nature. 다양한 폴리펩티드 구조의 예를 아래에서 추가로 설명한다. It will be described further examples of various polypeptide structures below.

특정 실시태양에서, 항원 결합 단백질의 폴리펩티드 구조는 각각 모노클로날 항체, 이중특이적 항체, 미니바디, 도메인 항체, 합성 항체 (때때로 본원에서 "항체 모방체"로서 칭함), 키메라 항체, 인간화 항체, 항체 융합체 (때때로 본원에서 "항체 컨쥬게이트"로서 칭함), 및 그의 일부 또는 단편을 포함하고 이로 제한되지 않는 항체이거나 항체로부터 유래한다. In certain embodiments, the polypeptide structure of the antigen binding protein is monoclonal antibody to the respective monoclonal antibodies, bispecific antibodies, mini-bodies, domain antibodies, synthetic antibodies (sometimes as "Antibody mimetics" herein referred to), chimeric antibodies, humanized antibodies, antibody fusions (sometimes referred to as "antibody conjugate" herein), and either the antibody or fragment including a portion thereof and are not limited to, stems from the antibody. 일부 경우에, 항원 결합 단백질은 항체의 면역학적 단편 (예를 들어, Fab, Fab', F(ab') 2 , 또는 scFv)이다. Is, in some cases, the antigen binding protein is an immunological fragment of an antibody (e.g., Fab, Fab ', F (ab') 2, or scFv). 다양한 구조는 본원에서 추가로 설명하고 규정한다. Various structures are defined and described further herein.

본원에서 제공되는 특정 항원 결합 단백질은 인간 PCSK9에 특이적으로 및/또는 선택적으로 결합한다. Specific antigen binding protein provided herein is coupled to, and in / or alternatively specific for human PCSK9. 일부 실시태양에서, 항원 결합 단백질은 서열 3의 잔기 153-692를 갖고/갖거나 그로 이루어지는 인간 PCSK9 단백질에 특이적으로 및/또는 선택적으로 결합한다. In some embodiments, the antigen binding protein has residues 153-692 of SEQ ID NO: 3 / have or specific for human PCSK9 protein consisting thereof coupled to and / or alternatively. 일부 실시태양에서, ABP는 서열 3의 잔기 31-152를 갖고/갖거나 그로 이루어지는 인간 PCSK9에 특이적으로 및/또는 선택적으로 결합한다. In some embodiments, the ABP is having residues 31-152 of SEQ ID NO: 3 / have or specific for human PCSK9 formed thereby coupled to and / or alternatively. 일부 실시태양에서, ABP는 도 1a에 도시된 인간 PCSK9 단백질 (서열 1)에 선택적으로 결합한다. In some embodiments, ABP is selectively coupled to the human PCSK9 protein (SEQ ID NO: 1) shown in Figure 1a. 일부 실시태양에서, 항원 결합 단백질은 적어도 PCSK9 단백질의 단편 및/또는 신호 서열이 존재하거나 존재하지 않는 전장 PCSK9 단백질에 특이적으로 결합한다. In some embodiments, the antigen binding protein is coupled to at least specific for full-length PCSK9 protein fragments and / or signal sequence of the PCSK9 protein is absent or present.

항원 결합 단백질이 치료 용도로 사용되는 실시태양에서, 항원 결합 단백질은 PCSK9의 하나 이상의 생물학적 활성을 억제하거나, 저해하거나, 조정할 수 있다. In an embodiment the antigen binding protein is used in the therapeutic applications, an antigen binding protein inhibits one or more biological activities of PCSK9 or inhibited or can be adjusted. 한 실시태양에서, 항원 결합 단백질은 인간 PCSK9에 특이적으로 결합하고/하거나 LDLR에 대한 인간 PCSK9의 결합을 적어도 약 20%-40%, 40-60%, 60-80%, 80-85% 이상 (예를 들어, 시험관 내 경쟁적 결합 분석으로 결합을 측정함으로써)으로 실질적으로 억제한다. In one embodiment, the antigen binding protein specifically binds to human PCSK9 and / or at least about 20% -40% of the binding of human PCSK9 on LDLR, 40-60%, 60-80%, 80-85% or more and to substantially inhibit (e. g., by measuring binding in a competitive binding assay in vitro). 본원에서 제공되는 일부의 항원 결합 단백질은 항체이다. Some antigen binding proteins provided herein is an antibody. 일부 실시태양에서, ABP는 K d 가 10 -7 , 10 -8 , 10 -9 , 10 -10 , 10 -11 , 10 -12 , 10 -13 M 미만이다 (보다 강하게 결합한다). In some embodiments, ABP is a K d of 10 -7, 10 -8, 10 -9, 10 -10, 10 -11, 10 -12, less than 10 -13 M (binds more strongly). 일부 실시태양에서, ABP는 PCSK9에 대한 LDLR의 결합을 차단하는데 대한 IC 50 (D374Y, 고 친화도 변이체)이 1 μM 미만, 1000 nM 내지 100 nM, 100 nM 내지 10 nM, 10 nM 내지 1 nM, 1000 pM 내지 500 pM, 500 pM 내지 200 pM, 200 pM 미만, 200 pM 내지 150 pM, 200 pM 내지 100 pM, 100 pM 내지 10 pM, 10 pM 내지 1 pM이다. In some embodiments, ABP has IC 50 for at blocking the binding of LDLR for PCSK9 (D374Y, high affinity variants) of less than 1 μM, 1000 nM to 100 nM, 100 nM to 10 nM, 10 nM to about 1 nM, a 1000 pM to about 500 pM, 500 pM to 200 pM, less than 200 pM, 200 pM to 150 pM, 200 pM to 100 pM, 100 pM to 10 pM, 10 pM to 1 pM.

본 발명의 항-PCSK9 항체의 IgG2 중쇄 불변 도메인의 일례는 서열 154, 도 3kk에 제시된 아미노산 서열을 갖는다. Wherein an example of the IgG2 heavy chain constant domain of the antibodies of the invention -PCSK9 sequence 154, also has the amino acid sequence set forth in 3kk.

본 발명의 항-PCSK9 항체의 IgG4 중쇄 불변 도메인의 일례는 서열 155, 도 3kk에 제시된 아미노산 서열을 갖는다. Wherein an example of the IgG4 heavy chain constant domain of the antibodies of the invention -PCSK9 sequence 155, also has the amino acid sequence set forth in 3kk.

본 발명의 항-PCSK9 항체의 카파 경쇄 불변 도메인의 일례는 서열 157, 도 3kk에 제시된 아미노산 서열을 갖는다. Wherein an example of the light chain kappa constant domain of an antibody of the invention comprises the sequence -PCSK9 157, also has the amino acid sequence set forth in 3kk.

본 발명의 항-PCSK9 항체의 람다 경쇄 불변 도메인의 일례는 서열 156, 도 3kk에 제시된 아미노산 서열을 갖는다. Wherein the lambda light chain constant domain of -PCSK9 example of an antibody of the invention is SEQ ID NO: 156, also has the amino acid sequence set forth in 3kk.

면역글로불린 사슬의 가변 구역은 일반적으로 가변 구역은 일반적으로 3개의 초가변 구역 (보다 종종 "상보성 결정 구역", 즉 CDR로 불림)에 의해 연결된 비교적 보존된 프레임워크 구역 (FR)을 포함하는 동일한 전체 구조를 보인다. Variable regions of an immunoglobulin chain is the same overall general, variable regions typically contains a relatively conserved framework regions (FR) connected by a (sometimes called the "complementarity determining section", i.e., CDR than) three hypervariable areas it seems the structure. 상기 언급된 각각의 중쇄/경쇄쌍의 2개의 사슬로부터의 CDR은 대개 프레임워크 구역에 의해 정렬되어, 표적 단백질 (예를 들어, PCSK9) 상의 특이적 에피토프와 특이적으로 결합하는 구조를 형성한다. CDR's from the two chains of the above-mentioned each heavy chain / light chain pair typically are aligned by the framework regions, form the specific epitope and a specific structure for coupling on the target protein (e.g., PCSK9). N-말단으로부터 C-말단으로, 천연 발생 경쇄 및 중쇄 가변 구역은 모두 일반적으로 다음 순서의 이들 요소와 일치한다: FR1, CDR1, FR2, CDR2, FR3, CDR3 및 FR4. From N- terminus to C- terminus, consistent with naturally-occurring light and heavy chain variable regions of these elements in the following order are both generally: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. 각각의 이들 도메인 내의 위치를 점령하는 아미노산에 숫자를 배정하기 위한 넘버링 시스템이 고안되었다. The numbering system for assigning numbers to amino acids that occupy positions in each of these domains was invented. 상기 넘버링 시스템은 문헌 ([Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD)], 또는 [Chothia & Lesk, 1987, J. Mol. Biol. 196:901-917]; [Chothia et al., 1989, Nature 342:878-883])에 정의되어 있다. The numbering system are described ([Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD)], or [Chothia & Lesk, 1987, J. Mol Biol 196:.. 901-917]; [Chothia et al, 1989, Nature 342:. defined in 878-883).

다양한 중쇄 및 경쇄 가변 구역이 본원에서 제공되고, 도 2a-3jj 및 3ll-3bbb에 도시되어 있다. A variety of heavy and light chain variable regions provided herein, is shown in Figure 2a-3jj and 3ll-3bbb. 일부 실시태양에서, 각각의 이들 가변 구역은 상기 중쇄 및 경쇄 불변 구역에 부착되어 각각 완전한 항체 중쇄 및 경쇄를 형성할 수 있다. In some embodiments, each of these variable regions are attached to the heavy chain and light chain constant section can form a complete antibody heavy and light chain, respectively. 또한, 각각의 이렇게 생성된 중쇄 및 경쇄 서열은 조합되어 완전한 항체 구조를 형성할 수 있다. In addition, each of the so generated heavy and light chain sequences may be combined to form a complete antibody structure.

제공되는 항체의 경쇄 및 중쇄의 가변 구역, 및 그들의 대응하는 아미노산 서열의 일부의 구체적인 예를 표 2에 요약한다. The light and heavy chain variable regions of an antibody is provided, and some specific examples of their corresponding amino acid sequences are summarized in Table 2 below.

Figure pat00002

다시, 표 2에 나열된 각각의 예시적인 가변 중쇄는 표 2에 제시된 임의의 예시적인 가변 경쇄와 조합하여 항체를 형성할 수 있다. Again, each of the exemplary variable heavy chain listed in Table 2 may form an antibody in combination with any of the exemplary variable light chain set forth in Table 2 below. 표 2는 본원에 개시된 항체의 몇몇에서 발견되는 예시적인 경쇄 및 중쇄 쌍형성을 보여준다. Table 2 shows an exemplary light and heavy chain pair form is found in several of the antibodies disclosed herein. 일부 경우에, 항체는 표 2에 나열된 것으로부터 적어도 하나의 가변 중쇄 및 하나의 가변 경쇄를 포함한다. In some cases, the antibody includes at least one variable heavy chain and a variable light chain from those listed in Table 2. 다른 경우에, 항체는 2개의 동일한 경쇄 및 2개의 동일한 중쇄를 함유한다. In other cases, the antibodies contain two identical light chains and two identical heavy chains. 일례로서, 항체 또는 항원 결합 단백질은 중쇄와 경쇄, 2개의 중쇄, 또는 2개의 경쇄를 포함할 수 있다. As an example, an antibody or antigen binding protein may comprise the heavy and light chains and two heavy chains, or two light chains. 일부 실시태양에서, 항원 결합 단백질은 표 2에 나열된 적어도 하나의 서열로부터 1, 2, 및/또는 3개의 중쇄 및/또는 경쇄 CDR을 포함한다 (및/또는 그로 이루어진다) (서열에 대한 CDR은 도 2a-3d에 개략하고, 다른 실시태양은 도 3ccc-3jjj 및 15a-15d에 개략한다). In some embodiments, the antigen binding protein comprises at least one from of SEQ ID NO: 1, 2, and / or three heavy chain and / or light chain CDR listed in Table 2 (and / or consists thereof) (CDR's of the sequence is also exemplary 2a-3d schematically, and in another aspect is outlined in Fig. 3ccc-3jjj and 15a-15d). 일부 실시태양에서, 6개의 모든 CDR (경쇄로부터의 CDR1-3 (CDRL1, CDRL2, CDRL3) 및 중쇄로부터의 CDR1-3 (CDRH1, CDRH2, 및 CDRH3))은 ABP의 일부이다. In some embodiments, (CDR1-3 (CDRL1, CDRL2, CDRL3) and CDR1-3 (CDRH1, CDRH2, and CDRH3), from a heavy chain of light chain from) all six CDR is a part of ABP. 일부 실시태양에서, 1, 2, 3, 4, 5개 이상의 CDR이 ABP 내에 포함된다. In some embodiments, the one, two, three, four or more, five CDR are included in the ABP. 일부 실시태양에서, 표 2 내의 서열 내의 CDR로부터의 하나의 중쇄 및 하나의 경쇄 CDR이 ABP 내에 포함된다 (표 2 내의 서열에 대한 CDR은 도 2a-3d에 개략한다). In some embodiments, one heavy and one light chain CDR from the CDR in the sequence in Table 2 are included in the ABP (CDR's of the sequences in Table 2 and schematically in Figure 2a-3d). 일부 실시태양에서, 추가의 선택 (예를 들어, 도 2a-2d, 3a-3d에 제시된 것, 및 3ccc-3jjj 및 15a-15d에 제시된 다른 실시태양)이 또한 ABP 내에 포함된다. In some embodiments, an additional choice of a (for instance, shown in Figure 2a-2d, 3a-3d, and 3ccc-3jjj and another embodiment shown in 15a-15d) is also within the ABP. 표 2에 제시된 중쇄 및 경쇄에 대한 CDR 및 FR의 예를 도 2a-3d에 개략한다 (다른 실시태양은 도 3ccc-3jjj 및 15a-15d에 개략한다). An example of the CDR and the FR of the heavy and light chains set forth in Table 2 and schematically in Figure 2a-3d (and other embodiments are outlined in Fig. 3ccc-3jjj and 15a-15d). 선택적인 경쇄 가변 서열 (CDR1, CDR2, CDR3, FR1, FR2, FR3, 및 FR4 포함)은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46 중에서 선택될 수 있다. Selective light chain variable sequences (CDR1, CDR2, CDR3, FR1, FR2, FR3, and comprising FR4) is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, and can be selected from 44, and 46. 선택적인 중쇄 가변 서열 (CDR1, CDR2, CDR3, FR1, FR2, FR3, 및 FR4 포함)은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60 중에서 선택될 수 있다. The optional heavy chain variable sequence (comprising CDR1, CDR2, CDR3, FR1, FR2, FR3, and FR4) is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 may be selected from. 도 2A-3D 내의 일부 엔트리 (entry)에서, CDR 및 FR의 서열 또는 대체 경계의 변이가 확인된다. Figure 2A-3D in some entry (entry) in a, a sequence or a mutation of replacing the boundary of the CDR and FR are identified. 이들 대체물은 ABP 명칭 다음에 "v1"으로 확인된다. These alternatives are identified with "v1" in the name of ABP below. 대부분의 이들 대체물은 자연에서 소수이므로, 차이를 갖는 섹션만을 표에 표시한다. Most of these alternatives is because minority in nature, and displays only the section with the differences in the table. 경쇄 또는 중쇄의 나머지 섹션은 다른 패널 내의 염기 ABP에 대해 도시된 것과 동일한 것으로 이해된다. The remaining sections of the light or heavy chain is understood to be the same as those illustrated for the base in the other panel ABP. 따라서, 예를 들어, 도 2C에서 19H9v1은 도 2A의 19H9와 동일한 FR1, CDR1, 및 FR2를 갖고, 차이만을 도 2C에 표시한다. Thus, for example, in Figure 2C 19H9v1 has the same FR1, CDR1, FR2, and and 19H9 in Fig 2A, and shows only the differences in Fig. 2C. 3개의 핵산 서열 (ABP 26E10, 30B9, 및 31B12)에 대해, 추가의 대체 핵산 서열을 도면에 제시한다. For three nucleic acid sequence (ABP 26E10, 30B9, and 31B12), presents a further alternative nucleic acid sequence of the drawings. 당업자가 알 수 있는 바와 같이, 하나 이하의 그러한 서열이 항체 또는 ABP의 생성에서 실제로 사용될 필요가 있다. As will be appreciated by one skilled in the art, it is necessary that such sequence of no more than one is actually used in the production of antibodies or ABP. 실제로, 일부 실시태양에서, 특이적 중쇄 또는 경쇄 핵산 중 하나만 존재하거나 존재할 필요가 없다. In fact, in some embodiments, it is not present, only one of the light chain or heavy chain-specific nucleic acids or to exist.

일부 실시태양에서, ABP는 표 2 내의 임의의 단백질 서열을 코딩할 수 있는 핵산 서열에 의해 코딩된다. In some embodiments, ABP is coded by a nucleic acid sequence capable of encoding any of the protein sequences in Table 2.

일부 실시태양에서, ABP는 LDLR에 결합하는 형태의 PCSK9 (예를 들어, 자가촉매된 형태의 분자)에 선택적으로 결합한다. In some embodiments, ABP is selectively coupled to a aspect of the PCSK9 binding to LDLR (e.g., self-molecules of the catalytic type). 일부 실시태양에서, 항원 결합 단백질은 촉매 도메인의 c-말단에 결합하지 않는다 (예를 들어, c-말단 내의 5, 5-10, 10-15, 15-20, 20-25, 25-30, 30-40개의 대부분의 아미노산). In some embodiments, the antigen binding protein does not bind to the c- terminus of the catalytic domain (e. G., 5, 5-10, 10-15, 15-20, 20-25, 25-30 in the c- terminus, most of the 30 to 40 amino acids). 일부 실시태양에서, 항원 결합 단백질은 촉매 도메인의 n-말단에 결합하지 않는다 (예를 들어, n-말단 내의 5, 5-10, 10-15, 15-20, 20-25, 25-30, 30-40개의 대부분의 아미노산). In some embodiments, the antigen binding protein does not bind to the n- terminus of the catalytic domain (e. G., 5, 5-10, 10-15, 15-20, 20-25, 25-30 in the n- terminus, most of the 30 to 40 amino acids). 일부 실시태양에서, ABP는 성숙형의 PCSK9의 아미노산 1-100 내의 아미노산에 결합한다. In some embodiments, the ABP is coupled amino acid in the amino acid 1-100 of the mature PCSK9. 일부 실시태양에서, ABP는 아미노산 31-100, 100-200, 31-152, 153-692, 200-300, 300-400, 452-683, 400-500, 500-600, 31-692, 31-449, 및/또는 600-692 내의 아미노산 (및/또는 그로 이루어지는 아미노산 서열)에 결합한다. In some embodiments, the ABP amino acids 31-100, 100-200, 31-152, 153-692, 200-300, 300-400, 452-683, 400-500, 500-600, 31-692, 31- 449 is coupled to, and / or amino acids (and / or amino acid sequences formed thereby) in the 600-692. 일부 실시태양에서, ABP는 촉매 도메인에 결합한다. In some embodiments, ABP binds to the catalytic domain. 일부 실시태양에서, 중화 및/또는 비-중화 ABP는 프로-도메인에 결합한다. In some embodiments, the neutralizing and / or non-neutralizing ABP is pro- join the domain. 일부 실시태양에서, ABP는 촉매 도메인 및 프로-도메인 모두에 결합한다. In some embodiments, ABP is the catalytic domain and the pro-domain binds to both. 일부 실시태양에서, ABP는 프로-도메인과 상호작용하는 촉매 도메인 상의 영역을 차단하도록 촉매 도메인에 결합한다. In some embodiments, the ABP Pro-bind to the catalytic domain to block the cross-domain area on the catalytic domain to act. 일부 실시태양에서, ABP는 그 전문을 본원에 참조로 포함시킨 문헌 [Piper et al. In some embodiments, the ABP literature which is incorporated by reference its entirety herein, [Piper et al. (Structure 15:1-8 (2007)] (그의 구조 표현 포함)에 개략된 바와 같이 프로-도메인이 상호작용하는 위치 또는 표면에서 촉매 도메인에 결합한다. 일부 실시태양에서, ABP는 촉매 도메인에 결합하고, 프로도메인의 이동성을 제한한다. 일부 실시태양에서, ABP는 프로-도메인에 결합하지 않으면서 촉매 도메인에 결합한다. 일부 실시태양에서, ABP는 프로-도메인이 PCSK9가 LDLR에 결합하도록 재배향하는 것을 방지하면서, 프로-도메인에 결합하지 않으면서 촉매 도메인에 결합한다. 일부 실시태양에서, ABP는 문헌 [Piper et al.]의 프로-도메인의 주위 잔기 149-152와 동일한 에피토프에 결합한다. 일부 실시태양에서, ABP는 V 도메인 상의 그루브 (groove) (문헌 [Piper et al.]에 개략된 바와 같은)에 결합한다. 일부 실시태양에서, ABP는 V 도메인 상의 그루브에 근접한 히스티딘-풍부 (Structure 15:. 1-8 (2007)] (as shown schematically in the representation including its structure) pro-domains and are coupled to each other in the catalytic domain location or surface acting in some embodiments, ABP is coupled to the catalytic domain ., and limits the mobility of the pro domain in some embodiments, ABP is pro- destined grown domain PCSK9 is to couple the LDLR -. engage the standing catalytic domain do not bind to domain in some embodiments, ABP is Pro , Pro while preventing - binds to the catalytic domain standing unless coupled to a domain in some embodiments, the ABP is a professional literature [Piper et al.] - binds to the same epitope as around residues 149-152 of domain part carried out in the sun, ABP is coupled to the V domains on the groove (groove) (literature [Piper et al.] as described in the schematic), in some embodiments, the ABP is a histidine adjacent groove on the V domain-rich 치에 결합한다. 일부 실시태양에서, 그러한 항체 (V 도메인에 결합하는)는 중화성이 아니다. 일부 실시태양에서, V 도메인에 결합하는 항체는 중화성이다. 일부 실시태양에서, 중화 ABP는 LDLR에 대한 PCSK9의 결합을 방지한다. 일부 실시태양에서, 중화 ABP는 LDLR의 PCSK9 분해를 방지하지만, LDLR에 대한 PCSK9의 결합을 방지하지 않는다 (예를 들어 ABP 31A4). 일부 실시태양에서, ABP는 문헌 [Piper et al. 논문]의 도 4에 도시된 적어도 하나의 히스티딘에 결합하거나 차단한다. 일부 실시태양에서, ABP는 PCSK9 내의 촉매 트리아드 (triad)를 차단한다. It binds to the device. In some embodiments, it is not such an antibody is neutralizing (binding to the V domain). In some embodiments, an antibody that binds to the V domain is neutralizing. In some embodiments, the neutralizing ABP is LDLR the binding of PCSK9 and prevents for. in some embodiments, the neutralizing ABP prevents PCSK9 degradation of the LDLR, but does not prevent the binding of PCSK9 on LDLR (e.g. ABP 31A4). in some embodiments, the ABP is Document [Piper et al. This paper is also at least four binding or blocking the one shown in histidine. in some embodiments, the ABP blocks the catalytic triad (triad) in the PCSK9.

일부 실시태양에서, 항체는 야생형 PCSK9에 비해 변이체 PCSK9 단백질, 예를 들어, D374Y에 선택적으로 결합한다. In some embodiments, antibody variants include, for PCSK9 protein, for example, compared to the wild-type PCSK9, and selectively coupled to D374Y. 일부 실시태양에서, 이들 항체는 야생형보다 적어도 2배 더 강하게 변이체에, 바람직하게는 야생형보다 2-5, 5-10, 10-100, 100-1000, 1000-10,000배 이상으로 돌연변이체에 결합한다 (K d 를 통해 측정할 때). In some embodiments, these antibodies are to at least 2 times stronger than the wild type variant, preferably 2-5, 5-10, 10-100, 100-1000, 1000-10000 times more than wild-type binds to the mutant (as measured by the K d). 일부 실시태양에서, 항체는 LDLR과 상호작용하는 야생형 PCSK9의 능력에 비해 변이체 D374Y PCSK9가 LDLR과 상호작용하는 것을 선택적으로 억제한다. In some embodiments, the antibody selectively inhibits that the D374Y mutant PCSK9 interactions and LDLR as compared to the wild-type PCSK9 ability to interact with LDLR. 일부 실시태양에서, 이들 항체는 야생형의 능력보다 더 강하게 LDLR에 결합하는 변이체의 능력을 차단하고, 예를 들어, 야생형보다 적어도 2배 강하게, 바람직하게는 야생형보다 돌연변이체를 2-5, 5-10, 10-100, 100-1000배 더 강하게 차단한다 (IC 50 을 통해 측정할 때). In some embodiments, these antibodies more strongly than the wild-type ability to block the ability of the variant to bind to LDLR and, for example, at least 2 times stronger than the wild type, and preferably 2-5, the mutant than the wild type, 5- 10, blocks 10 to 100, 100-1000 times more strongly (as measured by the IC 50). 일부 실시태양에서, 항체는 야생형 PCSK9 및 변이체 형태의 PCSK9, 예를 들어 D374Y 모두에 유사한 수준으로 결합하여 중화시킨다. In some embodiments, the antibodies include, for PCSK9, examples of the wild-type and mutant PCSK9 form is neutralized by combining the similar level in all D374Y. 일부 실시태양에서, 항체는 LDLR의 변이체가 PCSK9에 결합하는 것을 방지하도록 PCSK9에 결합한다. In some embodiments, the antibody binds to a PCSK9 variants of LDLR to prevent binding to PCSK9. 일부 실시태양에서, LDLR의 변이체는 인간 LDLR과 적어도 50% 동일하다. In some embodiments, the variant of the LDLR is equal to at least 50% identical to the human LDLR. LDLR의 변이체는 당업자에게 공지되어 있음이 언급된다 (예를 들어, [Brown MS et al., "Calcium cages, acid baths and recycling receptors" Nature 388: 629-630, 1997]). Variants of the LDLR is referred to this also known to those skilled in the art (e.g., [Brown MS et al, "Calcium cages, acid baths and recycling receptors" Nature 388:. 629-630, 1997]). 일부 실시태양에서, ABP는 이형접합체 가족성 고콜레스테롤혈증 (LDLR의 기능 손실 변이체가 존재함)에서 효과적인 LDLR의 수준을 상승시킬 수 있다. In some embodiments, ABP may raise the level of effective LDLR in heterozygous familial hypercholesterolemia (LDLR that the loss of function variants of the present).

일부 실시태양에서, ABP는 도 1a 및/또는 도 1b-1e에 도시된 PCSK9의 형태에 적어도 50%, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99% 또는 그 이상 동일성인 PCSK9의 변이체에 결합한다 (그러나 차단하지 않는다). In some embodiments, ABP was at least 50% in the form of a PCSK9 shown in Figure 1a and / or Figure 1b-1e, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99 It binds to% or more variants of the identity of PCSK9 (but not blocked). 일부 실시태양에서, ABP는 도 1a 및/또는 도 1b-1e에 도시된 PCSK9의 성숙형에 적어도 50%, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99% 또는 그 이상 동일성인 PCSK9의 변이체에 결합한다 (그러나 차단하지 않는다). In some embodiments, the ABP comprises at least 50% of the mature PCSK9 shown in Figure 1a and / or Figure 1b-1e, 50-60, 60-70, 70-80, 80-90, 90-95, 95- It binds to 99% or more variants of the identity of PCSK9 (but not blocked). 일부 실시태양에서, ABP는 도 1a 및/또는 도 1b-1e에 도시된 PCSK9의 형태에 적어도 50%, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99% 또는 그 이상의 동일성인 PCSK9의 변이체에 결합하여 LDLR과 상호작용하는 것을 방지한다. In some embodiments, ABP was at least 50% in the form of a PCSK9 shown in Figure 1a and / or Figure 1b-1e, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99 by binding to% or more variants of the identity of PCSK9 is prevented from interacting with LDLR. 일부 실시태양에서, ABP는 도 1b-1e에 도시된 PCSK9의 성숙형에 적어도 50, 50-60, 60- 70, 70-80, 80-90, 90-95, 95-99% 또는 그 이상 동일성인 PCSK9의 변이체에 결합하여 LDLR과 상호작용하는 것을 방지한다. In some embodiments, sun, ABP is a 1b-1e, at least 50, 50-60, 60-70, 70-80, 80-90, 90-95, 95-99% or more identity to the mature form of the illustrated in the PCSK9 by binding to a variant of PCSK9 it is prevented from interacting with LDLR. 일부 실시태양에서, PCSK9의 변이체는 인간 변이체, 예를 들어 위치 474에서 변이체, E620G, 및/또는 E670G이다. In some embodiments, the variants of PCSK9 is a human variants, for example variants in position 474, E620G, and / or E670G. 일부 실시태양에서, 위치 474에서 아미노산은 발린 (다른 인간에서와 같이) 또는 트레오닌 (사이노 및 마우스에서와 같이)이다. In some embodiments, the amino acid at position 474 is valine (as in other human) or threonine (such as between the furnace and mouse). 본원에 제시된 교차-반응성 데이타가 주어지면, 본 발명의 항체는 상기 변이체에 쉽게 결합할 것으로 생각된다. Cross presented herein - given the reactivity data, the antibodies of the invention are thought to be easily coupled to the variant.

일부 실시태양에서, ABP는 표 2에 기재된 항체 중 하나가 결합하는 에피토프에 결합한다. In some embodiments, ABP binds to an epitope that binds one of the antibodies listed in Table 2. 일부 실시태양에서, 항원 결합 단백질은 PCSK9가 LDLR과 상호작용하는 것을 방지하도록 PCSK9의 특이적 입체형태 상태에 결합한다. In some embodiments, the antigen binding protein binds to a specific conformational states of PCSK9 to prevent PCSK9 interacts with LDLR.

인간화 항원 결합 단백질 (예를 들어, 항체) The humanized antigen binding proteins (e.g., antibodies)

본원에서 설명되는 바와 같이, PCSK9에 대한 항원 결합 단백질은 인간화 항체 및/또는 그의 일부를 포함할 수 있다. As will be described herein, the antigen binding protein to PCSK9 may include a humanized antibody and / or a portion thereof. 그러한 전략의 중요한 실용적인 용도는 마우스 체액성 면역계의 "인간화"이다. Important practical applications of such a strategy is the "humanization" of the mouse humoral immune system.

특정 실시태양에서, 인간화 항체는 인간에서 실질적으로 비-면역원성이다. In certain embodiments, the humanized antibody is substantially non-human in-the immunogenicity. 특정 실시태양에서, 인간화 항체는, 그로부터 인간화 항체가 유도되는 다른 종으로부터의 항체와 실질적으로 동일한 표적에 대한 친화도를 갖는다. In certain embodiments, the humanized antibody, has an affinity for the antibody is substantially equal to the target from a different species from which the humanized antibody is derived. 예를 들어, 미국 특허 5,530,101, 미국 특허 5,693,761; For example, U.S. Patent 5,530,101, U.S. Patent 5,693,761; 미국 특허 5,693,762; US Patent 5,693,762; 미국 특허 5,585,089를 참조한다. See US Patent 5,585,089.

특정 실시태양에서, 그의 면역원성을 감소시키면서 항원 결합 도메인의 천연 친화도는 감소시키지 않으면서 변형될 수 있는 항체 가변 도메인의 아미노산이 확인된다. In a particular embodiment, while reducing its immunogenicity are identified amino acids of an antibody variable domain which may be modified without reducing the antigen-binding domain is a natural affinity. 예를 들어, 미국 특허 5,766,886 및 5,869,619를 참조한다. For example, reference is made to U.S. Patent 5,766,886 and 5,869,619.

특정 실시태양에서, 당업계에 공지되어 있는 방법에 의한 항체의 변형은 일반적으로 표적에 대한 결합 친화도 증가 및/또는 수여자에서 항체의 면역원성 감소를 달성하도록 설계된다. Is designed to achieve in a particular embodiment, the deformation of the antibody by methods known in the art and are generally increased binding affinity for the target and / or reduce immunogenicity of the antibody in women. 특정 실시태양에서, 인간화 항체는 그의 동족 항원 (cognate antigen)에 대한 항체의 친화도를 증가시키기 위해 글리코실화 부위를 제거하도록 변형된다 (예를 들어, 문헌 [Co et al., Mol. Immunol. 30:1361-1367(1993)] 참조]. 특정 실시태양에서, "재형성 (reshaping)", "과키메라화 (hyperchimerization)" 또는 "베니어링 (veneering)/재표면화 (resurfacing)"와 같은 기술이 인간화 항체 생산을 위해 사용된다 (예를 들어, 문헌 [Vaswami et al., Annals of Allergy, Asthma, & Immunol. 81:105 (1998)]; [Roguska et al., Prot. Engineer., 9:895-904 (1996)]; 및 미국 특허 6,072,035 참조). 특정한 그러한 실시태양에서, 상기 기술은 대개 외래 잔기의 수를 감소시킴으로써 항체 면역원성을 감소시키지만, 항체의 반복 투여 이후의 항-개별특이형 및 항-동종이인자형 반응을 방지하지 않는다. 면역원성을 감소시키는 특정한 다른 방 In certain embodiments, humanized antibodies are modified to eliminate glycosylation sites in order to increase the affinity of the antibody for its cognate antigen (cognate antigen) (see, e.g., [Co et al., Mol. Immunol. 30 the 1361-1367 (1993); see] in certain embodiments, the "remodeling (reshaping)", "the chimeric (hyperchimerization)" or "chopping engineering (veneering) / surfacing material (resurfacing)" technology, such as: It is used for humanized antibody production (see, e.g., [Vaswami et al, Annals of Allergy, Asthma, & Immunol 81:.. 105 (1998)]; [Roguska et al, Prot Engineer, 9:... 895 . -904 (1996); and US Patent 6,072,035) in certain such embodiments, the technique typically reduces the antibody immunogenicity by reducing the number of foreign residues, after repeated administration of the antibody-type and individual specificity wherein - is not a homogeneous prevent genotype specific reaction different rooms to reduce immunogenicity 은 예를 들어 문헌 [Gilliland et al., J. Immunol., 62(6): 3663-71 (1999)]에 기재되어 있다. For example, literature [Gilliland et al, J. Immunol, 62 (6):.. 3663-71 (1999)] have been described in.

특정 예에서, 인간화 항체는 항원 결합 능력이 손실된다. In a particular example, the humanized antibody is lost antigen binding capability. 특정 실시태양에서, 인간화 항체는 "역 돌연변이 (back mutation)"된다. In certain embodiments, the humanized antibody is "reverse mutation (back mutation)". 특정한 그러한 실시태양에서, 인간화 항체는 공여 항체에서 발견되는 하나 이상의 아미노산 잔기를 포함하도록 돌연변이된다. In certain such embodiments, the humanized antibody is mutated to include one or more amino acid residues found in the donor antibody. 예를 들어, 문헌 [Saldanha et al., Mol Immunol 36:709-19 (1999)]을 참조한다. For example, the literature: see [Saldanha et al, Mol Immunol 36. 709-19 (1999)].

특정 실시태양에서, PCSK9에 대한 항체의 경쇄 및 중쇄 가변 구역의 상보성 결정 구역 (CDR)은 동일한 종 또는 다른 종으로부터의 프레임워크 구역 (FR)에 그라프팅될 수 있다. In certain embodiments, the complementarity determining section (CDR) of the light chain and heavy chain variable regions of an antibody to PCSK9 can be grafted to the boot framework regions (FR) from the same species or another species. 특정 실시태양에서, PCSK9에 대한 항체의 경쇄 및 중쇄 가변 구역의 CDR은 컨센서스 인간 FR에 그라프팅될 수 있다. In certain embodiments, the light chain and the CDR of the heavy chain variable regions of an antibody to PCSK9 may be grafted to consensus human FR Ting. 컨센서스 인간 FR을 생성시키기 위해서, 특정 실시태양에서, 몇몇 인간 중쇄 또는 경쇄 아미노산 서열로부터의 FR을 컨센서스 아미노산 서열을 확인하기 위해 정렬시킨다. In order to generate the consensus human FR, In certain embodiments, the alignment of the FR from several human heavy chain or light chain amino acid sequences to determine the consensus amino acid sequence. 특정 실시태양에서, PCSK9 중쇄 또는 경쇄에 대한 항체의 FR을 상이한 중쇄 또는 경쇄로부터의 FR로 교체한다. In certain embodiments, the replacement of FR of the antibody to the heavy or light chain to PCSK9 FR from a different heavy chain or light chain. 특정 실시태양에서, PCSK9에 대한 항체의 중쇄 및 경쇄의 FR 내의 희귀한 아미노산은 교체되지 않지만, 나머지 FR 아미노산은 교체된다. In certain embodiments, rare amino acids in the FR of the heavy and light chains of the antibody to PCSK9 is not replaced, the other FR amino acids are replaced. 희귀한 아미노산은 FR에서 보통 발견되지 않는 위치에 존재하는 특이적 아미노산이다. Rare amino acids are specific amino acids that are not found in the normal position on the FR. 특정 실시태양에서, PCSK9에 대한 항체로부터의 그라프팅된 가변 구역은 PCSK9에 대한 항체의 불변 구역과 상이한 불변 구역과 함께 사용될 수 있다. In certain embodiments, the grafted variable regions from an antibody to PCSK9 can be used with a constant section with a different constant region of the antibody to PCSK9. 특정 실시태양에서, 그라프팅된 가변 구역은 단일쇄 Fv 항체의 일부이다. In certain embodiments, the grafted variable regions are part of a single chain Fv antibody. CDR 그라프팅은 예를 들어 임의의 목적으로 본원에 참조로 포함시킨 미국 특허 6,180,370, 6,054,297, 5,693,762, 5,859,205, 5,693,761, 5,565,332, 5,585,089, 및 5,530,101과 문헌 ([Jones et al., Nature, 321:522-525 (1986)]; [Riechmann et al., Nature, 332:323-327 (1988)]; [Verhoeyen et al., Science, 239:1534-1536 (1988)] 및 [Winter, FEBS Letts., 430:92-94 (1998)]에 기재되어 있다. CDR grafting, for example, that the US patent incorporated by reference herein for any purpose 6.18037 million, 6,054,297, 5,693,762, 5,859,205, 5,693,761, 5,565,332, 5,585,089, and 5,530,101 and the literature ([Jones et al, Nature, 321:. 522- 525 (1986)]; [Riechmann et al, Nature, 332:. 323-327 (1988)]; [Verhoeyen et al, Science, 239:.. 1534-1536 (1988)] and [Winter, FEBS Letts, 430 : 92-94 is described in (1998).

인간 항원 결합 단백질 (예를 들어, 항체) Human antigen-binding proteins (e.g., antibodies)

본원에서 설명된 바와 같이, PCSK9에 결합하는 항원 결합 단백질은 인간 (즉, 완전 인간) 항체 및/또는 그의 일부를 포함할 수 있다. As described herein, the antigen binding proteins that bind to PCSK9 may comprise an antibody and / or a part of a human (i. E., Fully human). 특정 실시태양에서, 중쇄 및 경쇄 면역글로불린 분자를 포함하는 아미노산 서열, 특히 가변 구역에 대응하는 서열을 코딩하는 뉴클레오티드 서열 및 상기 아미노산 서열을 제공한다. In certain embodiments, there is provided an amino acid sequence, in particular the nucleotide sequence and the amino acid sequence encoding a sequence corresponding to the variable regions comprising the heavy and light chain immunoglobulin molecules. 특정 실시태양에서, 상보성 결정 구역 (CDR), 구체적으로 CDR1 내지 CDR3에 대응하는 서열을 제공된다. In certain embodiments, the complementarity determining section (CDR), is provided with a sequence corresponding to a specific CDR1 to CDR3. 특정 실시태양에 따라, 그러한 면역글로불린 분자를 발현하는 하이브리도마 세포주를 제공한다. Depending on the specific embodiment, there is provided a hybridoma cell line expressing such an immunoglobulin molecule. 특정 실시태양에 따라, 그러한 모노클로날 항체를 발현하는 하이브리도마 세포주를 제공한다. Depending on the specific embodiment, there is provided a hybridoma cell line expressing such a monoclonal antibody to the monoclonal antibody. 특정 실시태양에서, 하이브리도마 세포주는 표 2에 기재된 세포주, 예를 들어, 21B12, 16F12 및 31H4 중 적어도 하나로부터 선택된다. In certain embodiments, a hybridoma cell line is the cell line described in Table 2, for example, it is selected from at least one of 21B12, 31H4, and 16F12. 특정 실시태양에서, 인간 PCSK9에 대한 정제된 인간 모노클로날 항체를 제공한다. In certain embodiments, there is provided a monoclonal antibody to a purified human monoclonal antibody to human PCSK9.

조작된 마우스는 마우스 항체의 부재 하에 인간 항체를 생산할 것으로 예상하면서, 마우스 항체 생산이 결여된 마우스 주를 인간 Ig 로커스의 큰 단편으로 조작할 수 있다. The mouse operation may be operated while the expected to produce human antibodies in the absence of mouse antibodies, the mouse antibody production with large fragments of the human primary mouse lacking Ig locus. 큰 인간 Ig 단편은 큰 가변 유전자 다양성뿐만 아니라, 항체 생산 및 발현의 적합한 조절을 보존할 수 있다. Large human Ig fragments may be not only a large variable gene diversity, preserving suitable regulation of antibody production and expression. 항체 다양화 및 선택에 대한 마우스 기구 (machinery), 및 인간 단백질에 대한 면역 관용의 결핍을 활용함으로써, 이들 마우스 주 내의 재생된 인간 항체 레퍼토리는 인간 항원을 포함한 관심있는 임의의 항원에 대한 고 친화도의 완전 인간 항체를 생성시킬 수 있다. Mouse mechanism for antibody diversification and selection (machinery), and by taking advantage of the lack of immune tolerance to human proteins, a high affinity for any antigen of interest the reproduced human antibody repertoire in these mouse weeks, including a human antigen is also of the complete human antibody it can be produced. 하이브리도마 기술을 사용하여, 목적하는 특이성을 갖는 항원-특이적 인간 MAb를 생산하고 선택할 수 있다. Using the hybridoma technology, antigen of interest having specificity for - is a human-specific MAb can be selected and produced. 예시적인 특정 방법은 WO 98/24893, 미국 특허 5,545,807, EP 546073, 및 EP 546073에 기재되어 있다. An exemplary specific method is described in WO 98/24893, U.S. Patent 5,545,807, EP 546073, and EP 546073.

특정 실시태양에서, 인간 가변 구역(들)과 함께 인간 이외의 다른 종으로부터의 불변 구역을 사용할 수 있다. In a specific embodiment, with the human variable region (s) may be the constant region of a different species from the non-human.

효모 인공 염색체 (YAC) 내에서 메가염기 크기의 인간 로커스를 클로닝하고 재구성하고, 이들을 마우스 생식계열 (germline) 내로 도입하는 능력은 매우 크거나 조잡하게 매핑된 로커스의 기능성 성분을 설명하기 위한 및 인간 질병의 유용한 모델을 생성하기 위한 방법을 제공한다. Yeast artificial chromosome (YAC) cloning of the human locus of mega bases in size in the reconstruction and and human disease to explain them to the mouse germline functional components of the locus capacity is very large or crudely mapped to introduce into (germline) for there is provided a method for producing a useful model. 또한, 마우스 로커스를 그의 인간 동등물로 치환하기 위한 그러한 기술의 이용은 발달 동안 인간 유전자 생성물의 발현 및 조절, 그들의 다른 시스템과의 소통, 및 질병 유도 및 진행에서 그들의 관여에 대한 통찰을 제공할 수 있다. In addition, the use of such technology for substitution of mouse loci with their human equivalents could provide insights into communication, and disease induction, and their involvement in the development of the expression and regulation, their different systems of human gene products during development have.

인간 항체는 쥐 또는 래트 가변 및/또는 불변 구역을 갖는 항체와 연관된 문제의 일부를 회피한다. Human antibodies avoid some of the problems associated with antibodies with mouse or rat variable and / or constant region. 그러한 쥐 또는 래트 유래된 단백질의 존재는 항체의 신속한 청소를 일으킬 수 있거나, 환자에 의한 항체에 대한 면역 반응을 생성시킬 수 있다. Such mouse or rat derived proteins is the presence of either can cause a rapid clearing of the antibody, it is possible to generate an immune response against the antibody by a patient. 쥐 또는 래트 유래된 항체의 이용을 피하기 위해, 설치류, 다른 포유동물 또는 동물이 완전 인간 항체를 생산하도록 설치류, 다른 포유동물 또는 동물 내로 기능적 인간 항체 로커스의 도입을 통해 완전 인간 항체를 생성할 수 있다. In order to avoid the use of a mouse or rat-derived antibody, a rodent, other mammal or animal can produce fully human antibodies through the introduction of functional human antibody loci into a rodent, other mammal or animal so as to produce fully human antibodies .

인간화 항체는 인간이 아닌 항체 아미노산 서열을 함유하여 초기에 시작하지만, 이들 비-인간 항체 아미노산 서열의 적어도 일부가 인간 항체 서열로 교체된 항체이다. Humanized antibody started initially contain the antibody amino acid sequence of a non-human, however, these non-human antibody amino acid sequence at least a portion of the antibody replaced by human antibody sequences. 이것은 항체가 인간이 갖는 유전자에 의해 코딩되는 (또는 코딩될 수 있는) 인간 항체와는 반대된다. This antibody is the opposite of a human antibody (or which may be coded) encoded by the gene having a human.

항원 결합 단백질 변이체 Antigen-binding protein variants

제공되는 다른 항체는 표 2에 제시된 가변 중쇄 및 가변 경쇄의 조합물 또는 하위부분에 의해 형성된 상기 나열된 ABP의 변이체이고, 각각 표 2의 서열 (전체 서열 또는 서열의 하위부분, 예를 들어, 하나 이상의 CDR)의 아미노산 서열에 적어도 50%, 50-60%, 60-70%, 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-99%, 또는 99% 초과의 동일성을 갖는 가변 경쇄 및/또는 가변 중쇄를 포함한다. Other antibodies and ABP variant of the listed formed by the variable heavy chain and the combination or sub-portions of the variable light chain set forth in Table 2, the sequences of Table 2 is provided (all sequence or of the sequence sub-portions, e.g., one or more at least 50% to the amino acid sequence of a CDR), 50-60%, 60-70%, 70-80%, 80-85%, 85-90%, 90-95%, 95-97%, 97-99%, or having an identity of 99% comprises a variable light chain and / or variable heavy chain. 일부 경우에, 그러한 항체는 적어도 하나의 중쇄 및 하나의 경쇄를 포함하는 반면, 다른 경우에 변이체 형태는 2개의 동일한 경쇄 및 2개의 동일한 중쇄 (또는 그의 하위부분)를 함유한다. In some cases, such antibody, while at least comprising one of the heavy chain and one light chain, mutant forms in other cases, contain two identical light chains and two identical heavy chain (or a lower portion). 일부 실시태양에서, 도 2a-3d (및 도 13a-13j과 15a-15d의 다른 실시태양)의 서열 비교는 결합에 영향을 미치는 변이 및 결합에 영향을 미치는 것으로 보이지 않는 변이를 관찰함으로써 변형될 수 있는 항체의 섹션을 확인하기 위해 사용될 수 있다. In some embodiments, FIG. 2a-3d sequence comparison (and other embodiments of Figure 13a-13j and 15a-15d) may be modified by monitoring the variation does not appear to affect the mutation and the combined affects bond which it can be used to identify the section of the antibodies. 예를 들어, 유사한 서열을 비교함으로써, 변형될 수 있는 섹션 (예를 들어, 특정 아미노산), 및 이들이 ABP의 기능성을 여전히 보유하면서 (또는 개선하면서) 변형될 수 있는 방식을 확인할 수 있다. For example, by comparing the similar sequences, that can be deformed section can be checked (for example, certain amino acids), and a way that they can be modified (with or improvement) while still retaining the functionality of the ABP. 일부 실시태양에서, ABP의 변이체는 도 13a, 13c, 13f, 13g, 13h, 13i 및/또는 13j에 제시된 컨센서스 군 및 서열을 포함하고, 도면에서 가변으로 확인되는 서열에서 변이가 허용된다. In some embodiments, the ABP variant the variation is allowed by the sequence including the consensus group and the sequence shown in Figure 13a, 13c, 13f, 13g, 13h, 13i and / or 13j, and identified in the figure as a variable. 도 13a, 13c, 13f, 및 13g에 제시된 CDR은 코티아 방법 (구조적 루프 구역의 위치에 기초함, 예를 들어, 문헌 ["Standard conformations for the canonical structures of immunoglobulins," Bissan Al-Lazikani, Arthur M. Lesk and Cyrus Chothia, Journal of Molecular Biology, 273(4): 927-948, 7 November (1997)] 참조) 및 카바트 방법 (서열 가변성에 기초함, 예를 들어, 문헌 [Sequences of Proteins of Immunological Interest, Fifth Edition. NIH Publication No. 91-3242, Kabat et al., (1991)] 참조)의 하이브리드 조합에 기초하여 규명되었다. FIG. 13a, 13c, 13f, and the CDR set forth in 13g are co-thiazol method (based on the location of the structural loop areas, see, for example, [ "Standard conformations for the canonical structures of immunoglobulins," Bissan Al-Lazikani, Arthur M . Cyrus Chothia and Lesk, Journal of Molecular Biology, 273 (4): 927-948, November 7, see (1997)) and the Kabat method (based on sequence variability, see, e.g., [sequences of Proteins of Immunological Interest, Fifth Edition. NIH Publication No. 91-3242, Kabat et al., have been identified on the basis of a hybrid combination of a (1991) refer). 두 방법 중 하나에 의해 결정된 각각의 잔기는 CDR 잔기의 최종 목록에 포함되었다 (도 13a, 13c, 13f, 및 13g에 제시한다). Each residue determined by one of two methods was included in the final list of CDR residue (presented in Fig. 13a, 13c, 13f, and 13g). 도 13h, 13i, 및 13j의 CDR은 카바트 방법만으로 얻었다. FIG CDR of 13h, 13i, and 13j is obtained only by Kabat method. 달리 명시하지 않으면, 도 13h-13j의 규정된 컨센서스 서열, CDR, 및 FR은 도 13에서 참조된 ABP에 대한 표시된 CDR 및 FR을 규정하고 제어할 것이다. Unless otherwise indicated, also defined consensus sequence of 13h-13j, CDR, FR, and is to specify and control the CDR and FR displayed on the ABP referenced in Fig.

특정 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 90% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 중쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, the amino acid sequence selected from 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 at least one of a sequence of comprises a heavy chain comprising a variable region including an amino acid sequence at least 90% do. 특정 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 95% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 중쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, the amino acid sequence selected from 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 at least one of a sequence of comprises a heavy chain comprising a variable region including an amino acid sequence at least 95% do. 특정 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 99% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 중쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, the amino acid sequence selected from 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60 at least one of a sequence of comprises a heavy chain comprising a variable region including an amino acid sequence at least 99% do.

일부 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60의 서열 중 적어도 하나 내의 CDR로부터의 하나 이상의 CDR에 적어도 90%, 90-95%, 및/또는 95-99% 동일한 서열을 포함한다. In some embodiments, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and at least 90% in at least one CDR from at least one of the CDR in the sequence of 60, 90-95%, and / or 95-99 % comprises the same sequence. 일부 실시태양에서, 1, 2, 3, 4, 5 또는 6개의 CDR (각각 상기 서열에 적어도 90%, 90-95%, 및/또는 95-99% 동일함)이 존재한다. In some embodiments, the 1, 2, 3, 4, (equivalent to at least 90% in each of the sequences, 90-95%, and / or 95-99%), five or six CDR exists.

일부 실시태양에서, 항원 결합 단백질은 서열 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, 및 60의 서열 중 적어도 하나 내의 FR로부터의 하나 이상의 FR에 적어도 90%, 90-95%, 및/또는 95-99% 동일한 서열을 포함한다. In some embodiments, the antigen binding protein is SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and at least 90% in at least one FR, at least from the one in the FR of SEQ ID NO: 60, 90-95%, and / or 95-99 % comprises the same sequence. 일부 실시태양에서, 1, 2, 3, 또는 4개의 FR (각각 상기 서열에 적어도 90%, 90-95%, 및/또는 95-99% 동일함)이 존재한다. In some embodiments, there are one, two, three, or four FR (equals at least 90%, 90-95%, and / or 95-99% in each of the sequence).

특정 실시태양에서, 항원 결합 단백질은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 90% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 경쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, the amino acid sequence selected from 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 at least one of a sequence of comprises a light chain comprising a variable region including an amino acid sequence at least 90% do. 특정 실시태양에서, 항원 결합 단백질은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 95% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 경쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, the amino acid sequence selected from 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 at least one of a sequence of comprises a light chain comprising a variable region including an amino acid sequence at least 95% do. 특정 실시태양에서, 항원 결합 단백질은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46의 서열 중 적어도 하나로부터 선택되는 아미노산 서열에 적어도 99% 동일한 아미노산 서열을 포함하는 가변 구역을 포함하는 경쇄를 포함한다. In a specific embodiment, the antigen binding protein is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, the amino acid sequence selected from 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46 at least one of a sequence of comprises a light chain comprising a variable region including an amino acid sequence at least 99% do.

일부 실시태양에서, 항원 결합 단백질은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46의 서열 중 적어도 하나 내의 CDR로부터의 하나 이상의 CDR에 적어도 90%, 90-95%, 및/또는 95-99% 동일한 서열을 포함한다. In some embodiments, the antigen binding protein is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and at least 90% in at least one CDR from at least one of the CDR in the sequence of 46, 90-95%, and / or 95-99 % comprises the same sequence. 일부 실시태양에서, 1, 2, 3, 4, 5, 또는 6개의 CDR (각각 상기 서열에 적어도 90%, 90-95%, 및/또는 95-99% 동일함)이 존재한다. In some embodiments, one, two, three, four, five, or six CDR (also respectively equal to at least 90% to said sequence, 90-95%, and / or 95-99%) are present.

일부 실시태양에서, 항원 결합 단백질은 서열 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 및 46의 서열 중 적어도 하나 내의 FR로부터의 하나 이상의 FR에 적어도 90%, 90-95%, 및/또는 95-99% 동일한 서열을 포함한다. In some embodiments, the antigen binding protein is SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and at least 90% in at least one FR, at least from the one in the FR of SEQ ID NO: 46, 90-95%, and / or 95-99 % comprises the same sequence. 일부 실시태양에서, 1, 2, 3, 또는 4개의 FR (각각 상기 서열에 적어도 90%, 90-95%, 및/또는 95-99% 동일함)이 존재한다. In some embodiments, there are one, two, three, or four FR (equals at least 90%, 90-95%, and / or 95-99% in each of the sequence).

본 명세서에 비추어, 당업자는 잘 공지된 기술을 이용하여 본원에 기재된 바와 같이 ABP의 적합한 변이체를 결정할 수 있을 것이다. In view of this specification, those skilled in the art will be able to use a well-known technique determining the appropriate variant of ABP as described herein. 특정 실시태양에서, 당업자는 활성에 중요한 것으로 생각되지 않는 구역을 표적화함으로써 활성을 파괴하지 않으면서 변화될 수 있는 분자의 적합한 영역을 확인할 수 있다. In certain embodiments, the skilled artisan can identify suitable areas of the molecule that may be changed without destroying activity by targeting an area that does not seem to be important for activity. 특정 실시태양에서, 유사한 폴리펩티드들 사이에 보존되는 분자의 잔기 및 부분을 확인할 수 있다. In certain embodiments, it can be seen and the residue of the molecule is preserved among similar polypeptides. 특정 실시태양에서, 심지어 생물학적 활성 또는 구조에 중요할 수 있는 영역이 생물학적 활성을 파괴하지 않으면서 또는 폴리펩티드 구조에 불리한 영향을 미치지 않으면서 보존적 아미노산 치환될 수 있다. In certain embodiments, even areas that may be important for biological activity or structure may be substituted with a conservative amino acid stand unless adversely affect the standing or polypeptide structure without destroying biological activity.

추가로, 당업자는 활성 또는 구조에 중요한 유사한 폴리펩티드 내의 잔기를 확인하는 구조-기능 연구를 검토할 수 있다. In addition, those skilled in the art to determine the residue in the structure similar to the polypeptide important for activity or structure-function studies can review. 상기 비교를 고려하여, 유사한 단백질에서 활성 또는 구조에 중요한 아미노산 잔기에 대응하는 단백질 내의 아미노산 잔기의 중요성을 예측할 수 있다. In consideration of the above comparison, it is possible to predict the importance of amino acid residues in a protein corresponding to the relevant amino acid residues in the protein similar to the activity or structure. 당업자는 상기 예측된 중요한 아미노산 잔기에 대해 화학적으로 유사한 아미노산 치환을 선택할 수 있다. Those skilled in the art may select the amino acid substitution is chemically similar to the relevant amino acid residues of the predictions.

당업자는 또한 유사한 ABP 내의 해당 구조와 관련하여 3차원 구조 및 아미노산 서열을 분석할 수 있다. Those skilled in the art will also in relation to that structure in similar ABP to analyze the three-dimensional structure and amino acid sequence. 그러한 정보를 고려하여, 당업자는 그의 3차원 구조에 관하여 항체의 아미노산 잔기의 정렬을 예측할 수 있다. Considering that information, one skilled in the art may predict the alignment of amino acid residues of an antibody with respect to its three dimensional structure. 특정 실시태양에서, 당업자는 단백질의 표면 상에 있는 것으로 예측된 아미노산 잔기로의 라디칼 변화를 일으키지 않도록 선택할 수 있고, 그 이유는 그러한 잔기가 다른 분자와의 중요한 상호작용에 관여할 수 있기 때문이다. In certain embodiments, one of ordinary skill in the art may choose not to cause a radical change to the predicted amino acid residues to be on the surface of the protein, because such residues may be involved in important interactions with other molecules. 또한, 당업자는 각각의 목적하는 아미노산 잔기에서 단일 아미노산 치환을 함유하는 시험 변이체를 생성시킬 수 있다. In addition, those skilled in the art may generate test variants containing a single amino acid substitution at amino acid residue to each objective of. 이어서, 변이체는 당업자에게 공지된 활성 분석을 이용하여 스크리닝될 수 있다. Subsequently, the variants may be screened using activity assays known to those skilled in the art. 그러한 변이체는 적합한 변이체에 대한 정보를 모으기 위해 사용될 수 있다. Such variants can be used to gather information about suitable variants. 예를 들어, 특정 아미노산 잔기로의 변화가 활성을 파괴하거나, 바람직하지 않게 감소시키거나, 부적합하게 하는 것으로 밝혀지면, 그러한 변화를 갖는 변이체는 피할 수 있다. For example, if found to be a change to a particular amino acid residue to reduce not destroy activity or not desirable, or suitable, variants with such a change may be avoided. 즉, 그러한 일상적인 실험으로부터 모은 정보에 기초하여, 당업자는 단독으로 또는 다른 돌연변이와 조합으로 추가의 치환을 피해야 하는 아미노산을 쉽게 결정할 수 있다. In other words, based on information gathered from such routine experiments, one skilled in the art can readily determine the amino acids alone or in combination with other mutations to avoid additional substitutions.

많은 학술 문헌에서 2차 구조의 예측이 집중적으로 보고되었다 ([Moult J., Curr. Op. in Biotech., 7(4):422-427 (1996)], [Chou et al., Biochemistry, 13(2):222-245 (1974)]; [Chou et al., Biochemistry, 113(2):211-222 (1974)]; [Chou et al., Adv. Enzymol. Relat. Areas Mol. Biol., 47:45-148 (1978)]; [Chou et al., Ann. Rev. Biochem., 47:251-276] 및 [Chou et al., Biophys. J., 26:367-384 (1979)] 참조). The predicted secondary structure has been reported in many intensive academic literature ([Moult J., Curr Op in Biotech, 7 (4):... 422-427 (1996)]., [Chou et al, Biochemistry, 13 (2): 222-245 (1974)]; [Chou et al, Biochemistry, 113 (2):.. 211-222 (1974)]; [Chou et al, Biol Adv Enzymol Relat Areas Mol..... , 47: 45-148 (1978)]; [Chou et al, Ann Rev. Biochem, 47:..... 251-276] and [Chou et al, Biophys J., 26: 367-384 (1979) ] Reference). 또한, 2차 구조 예측을 돕기 위한 컴퓨터 프로그램이 현재 이용가능하다. Further, a computer program to assist the secondary structure predictions are now available. 2차 구조 예측을 위한 한 방법은 상동성 모델링에 기초한다. A method for predicting secondary structure is based upon homology modeling. 예를 들어, 서열 동일성이 30%를 초과하거나, 유사성이 40%를 초과하는 2개의 폴리펩티드 또는 단백질은 종종 유사한 구조적 토폴로지 (topology)를 갖는다. For example, two polypeptides or proteins which have sequence identity greater than 30%, or similarity greater than 40% often have similar structural topologies (topology). 단백질 구조 데이타베이스 (PDB)의 최근의 성장은 폴리펩티드 또는 단백질 구조 내의 폴드 (fold)의 잠재적인 수를 포함하여 2차 구조의 향상된 예측가능성을 제공하였다. Recent growth of the protein structural data base (PDB), including the potential number of folds in (fold) in the polypeptide or protein structure and provided enhanced predictability of secondary structure. 예를 들어, 문헌 [Holm et al., Nucl. See, e.g., [Holm et al., Nucl. Acid. Acid. Res., 27(1):244-247 (1999)]을 참조한다. Res, 27 (1):. See 244-247 (1999). 제시된 폴리펩티드 또는 단백질 내에 제한된 수의 폴드가 존재하고, 중요한 수의 구조가 밝혀진 후에 구조 예측이 보다 더 정확해질 것으로 제안되었다 (Brenner et al., Curr. Op. Struct. Biol., 7(3):369-376 (1997)). The number of folds limited present in the given polypeptide or protein, has been proposed to be structural predictions are more accurate than after the structure of the relevant number of turns (Brenner et al, Curr Op Struct Biol, 7 (3).....: 369-376 (1997)).

2차 구조를 예측하는 추가의 방법은 "쓰레딩 (threading)" ([Jones, D., Curr. Opin. Struct. Biol., 7(3):377-87 (1997)]; [Sippl et al., Structure, 4(1):15-19 (1996)]), "프로필 분석" ([Bowie et al., Science, 253:164-170 (1991)]; [Gribskov et al., Meth. Enzym., 183:146-159 (1990)]; [Gribskov et al., Proc. Nat. Acad. Sci. USA, 84(13):4355-4358 (1987)]), 및 "진화적 연결" ([Holm, 상기 문헌 (1999)] 및 [Brenner, 상기 문헌 (1997)] 참조)을 포함한다. Additional methods of predicting secondary structure is "threading (threading)" ([Jones, D., Curr Opin Struct Biol, 7 (3):.... 377-87 (1997)]; [Sippl et al. , Structure, 4 (1): 15-19 (1996)]), "profile analysis" ([Bowie et al, Science, 253:. 164-170 (1991)..]; [Gribskov et al, Meth Enzym. , 183: 146-159 (1990)]; [Gribskov et al, Proc Nat Acad Sci USA, 84 (13):..... 4355-4358 (1987)]), and "evolutionary connection" ([Holm , it includes supra (1999)] and [Brenner, supra (1997) refer).

특정 실시태양에서, 항원 결합 단백질 변이체는 모 폴리펩티드의 아미노산 서열에 비해 글리코실화 부위의 수 및/또는 종류가 변경된 글리코실화 변이체를 포함한다. In certain embodiments, the antigen binding protein variants include glycosylation variants the number and / or type of glycosylation site has changed compared to the amino acid sequence of the parent polypeptide. 특정 실시태양에서, 단백질 변이체는 천연 단백질보다 더 많거나 더 적은 수의 N-연결된 글리코실화 부위를 포함한다. In certain embodiments, the protein variants comprises a more or fewer of the N- linked glycosylation sites than the native protein. N-연결된 글리코실화 부위는 서열: Asn-X-Ser 또는 Asn-X-Thr을 특징으로 하고, 여기서, X로 지정된 아미노산 잔기는 프롤린을 제외한 임의의 아미노산 잔기일 수 있다. N- linked glycosylation site comprises the sequence: wherein the Asn-X-Ser or Asn-X-Thr, where the amino acid residue designated as X may be an any amino acid except proline glass. 상기 서열을 생성하기 위한 아미노산 잔기의 치환은 N-연결된 탄수화물 사슬의 부가를 위한 잠재적인 새로운 부위를 제공한다. Substitution of amino acid residues to produce the sequence provides a potential new site for the addition of carbohydrate chains linked N-. 별법으로, 상기 서열을 제거하는 치환은 존재하는 N-연결된 탄수화물 사슬을 제거할 것이다. Substituted to Alternatively, the removal of the sequence will remove an existing carbohydrate chains linked to N-. 또한, 하나 이상의 N-연결된 글리코실화 부위 (전형적으로 천연 발생하는 부위)가 제거되고 하나 이상의 새로운 N-연결된 부위가 생성된 N-연결된 탄수화물 사슬의 재배열을 제공한다. Also provides at least one N- linked glycosylation site rearrangements of the carbohydrate chain (typically a naturally occurring part of) the associated cost is removed, and the one or more new N- linked sites generated N-. 추가의 바람직한 항체 변이체는 하나 이상의 시스테인 잔기가 모 아미노산 서열에 비해 결실되거나 또다른 아미노산 (예를 들어, 세린)으로 치환된 시스테인 변이체를 포함한다. Additional preferred antibody variants, one or more cysteine ​​residues deleted as compared to the parent amino acid sequence or another amino acid comprises a cysteine ​​mutant substituted with (e.g., serine). 시스테인 변이체는 항체가 불용성 봉입체의 단리 후에서와 같이 생물학적 활성 입체형태로 재폴딩되어야 할 때 유용할 수 있다. Cysteine ​​variants may be useful when antibodies are to be re-folded into a biologically active conformation such as after isolation of insoluble inclusion bodies. 시스테인 변이체는 일반적으로 천연 단백질보다 더 적은 시스테인 잔기를 갖고, 대개 비페어링된 시스테인으로 인한 상호작용을 최소화하기 위해 짝수의 시스테인을 갖는다. Cysteine ​​variants generally have fewer cysteine ​​residues than the native protein, has an even number of cysteines to minimize interactions usually due to the non-paired cysteine.

특정 실시태양에 따라, 아미노산 치환은 (1) 단백질 분해에 대한 감수성을 감소시키고/시키거나, (2) 산화에 대한 감수성을 감소시키고/시키거나, (3) 단백질 복합체를 형성하기 위한 결합 친화도를 변경시키고/시키거나, (4) 결합 친화도를 변경시키고/시키거나, (5) 상기 폴리펩티드에 대한 다른 물리화학적 또는 기능적 특성을 부여하거나 변경하는 것이다. According to certain embodiments, amino acid substitutions to (1) reduce susceptibility to proteolysis and / or, (2) reduce susceptibility to oxidation and / or, (3) a binding affinity for forming protein complexes the change and / or, (4) changing the binding affinity and / or, (5) to give the other physicochemical or functional properties of the polypeptide or changing. 특정 실시태양에 따라, 단일 또는 다수의 아미노산 치환 (특정 실시태양에서, 보존적 아미노산 치환)이 천연 발생 서열에서 (특정 실시태양에서, 분자간 접촉을 형성하는 도메인(들) 외부의 폴리펩티드의 부분에서) 이루어질 수 있다. Depending on the particular embodiment, the (in portions of the outer In certain embodiments, the domain forming intermolecular contacts (s), polypeptide) single or multiple amino acid substitution in the (specific exemplary aspect, conservative amino acid substitutions) is a naturally occurring sequence It can be achieved. 특정 실시태양에서, 보존적 아미노산 치환은 전형적으로 모 서열의 구조적 특징을 실질적으로 변화시키지 않을 수 있다 (예를 들어, 교체 아미노산은 모 서열에서 발생하는 나선을 파괴하는 경향을 갖지 않거나, 모 서열의 특징을 이루는 다른 종류의 2차 구조를 파괴하지 않아야 한다). In certain embodiments, conservative amino acid substitution typically may not substantially change the structural characteristics of the parent sequence (e.g., a replacement amino acids, or have a tendency to destroy the helix that occurs in the parent sequence, the parent sequence forming a feature should not destroy the secondary structure of other type). 당업계에서 인정되는 폴리펩티드 2차 및 3차 구조의 예는 각각 본원에 참조로 포함시킨 문헌 ([Proteins, Structures and Molecular Principles (Creighton, Ed., WH Freeman and Company, New York (1984)]; [Introduction to Protein Structure (C. Branden & J. Tooze, eds., Garland Publishing, New York, NY (1991))]; 및 [Thornton et al., Nature, 354:105 (1991)])에 기재되어 있다. Polypeptide secondary and tertiary example of a structure that is recognized in the art each in which the literature ([Proteins, Structures and Molecular Principles (Creighton, Ed, WH Freeman and Company, New York (1984).], Incorporated by reference herein; [ Introduction to Protein Structure (. C. Branden & J. Tooze, eds, Garland Publishing, New York, NY (1991))]; and [Thornton et al, Nature, 354:. is described in 105 (1991)) .

일부 실시태양에서, 변이체는 본원에서 개시되는 ABP의 핵산 서열의 변이체이다. In some embodiments, the variant is a variant of the nucleic acid sequence of ABP that are disclosed herein. 당업자는 상기 논의가 ABP 단백질 변이체의 확인, 평가 및/또는 생성을 위해 및 또한 이들 단백질 변이체를 코딩할 수 있는 핵산 서열을 위해 사용될 수 있음을 이해할 것이다. Those skilled in the art will appreciate that the discussion is ABP confirmation of the protein variant, evaluation and / or for the generation and also be used for nucleic acid sequence capable of coding for these protein variants. 따라서, 단백질 변이체를 코딩하는 핵산 서열 (및 표 2의 ABP를 코딩하지만, 본원에 명백하게 개시된 것과 상이한 핵산 서열)이 고려된다. Thus, the nucleic acid sequence encoding the protein variants are considered (the coding and ABP in Table 2, however, different from those nucleic acid sequences explicitly disclosed herein). 예를 들어, ABP 변이체는 서열 152, 153, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151에 제시된 적어도 하나의 핵산 서열, 또는 서열 152, 153, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 및 151 내의 핵산 서열에 의해 코딩되는 적어도 1 내지 6개 (및 그의 다양한 조합)의 CDR(들)에 적어도 80, 80-85, 85-90, 90-95, 95-97, 97-99% 또는 그 이상의 동일성을 가질 수 있다. For example, ABP variant sequences 152, 153, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, shown in 151, at least one nucleic acid sequence, or SEQ ID NO: 152, 153, 92, 93, 94 , 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119 , 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144 , 145, 146, 147, 148, 149, 150, and at least 80, 80-85, 85-90 in the CDR (s) of at least 1 to 6 (and their various combinations thereof) encoded by the nucleic acid sequence in the 151, 90-95, may have 95-97, 97-99% or more identity.

일부 실시태양에서, 항체 (또는 이를 코딩하는 핵산 서열)는, 특정 ABP를 코딩하는 핵산 서열 (또는 핵산 서열 자체)이 엄격한 조건 하에 표 2 내의 단백질을 코딩하는 임의의 핵산 서열 (예를 들어, 비제한적으로 서열 152, 153, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 및 151)에 선택적으로 혼성화할 수 있다면 변이체이다. In some embodiments, the antibody (or a nucleic acid sequence encoding it), the nucleic acid encoding the particular ABP sequence (or the nucleic acid sequence itself), for any of the nucleic acid sequence (e.g., encoding a protein in Table 2 under stringent conditions, the ratio limited to, SEQ ID NO: 152, 153, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113 , 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138 , 139, there is a variant capable of selectively hybridizing with the 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, and 151). 한 실시태양에서, 적합한 중등 엄격도 조건은 5XSSC; In one embodiment, a suitable secondary stringency conditions 5XSSC; 0.5% SDS, 1.0 mM EDTA (pH 8.0)의 용액 내에서 예비세척; 0.5% SDS, 1.0 mM EDTA pre-wash in a solution of (pH 8.0); 50℃-65℃에서 5xSSC를 사용한 철야 혼성화 또는 종-교차 상동성의 경우에 45℃에서 0.5xSSC를 사용한 혼성화; Overnight hybridization using 5xSSC at 50 ℃ -65 ℃ or species-hybridization with 0.5xSSC at 45 ℃ if cross-homology; 이어서, 20분 동안 65℃에서 각각 0.1% SDS를 함유하는 2x, 0.5x 및 0.2xSSC를 사용한 2회 세척을 포함한다. Then, it includes washed twice with 2x, 0.5x and 0.2xSSC containing 0.1% SDS each for 20 min at 65 ℃. 그러한 혼성화 DNA 서열은 또한 본 발명의 범위 내에 포함되고, 코드 축퇴성으로 인해, 혼성화 DNA 서열에 의해 코딩되는 항체 폴리펩티드를 코딩하는 뉴클레오티드 서열 및 이들 핵산 서열에 의해 코딩되는 아미노산 서열도 포함된다. Such hybridizing DNA sequences are also contained within the scope of the present invention, due to code degeneracy, also includes nucleotide sequences and amino acid sequences encoded by these nucleic acid sequences encoding the antibody polypeptide encoded by a hybridizing DNA sequence. 일부 실시태양에서, CDR의 변이체는 상기한 서열 내의 하나 이상의 CDR에 혼성화하는 핵산 서열 및 이들 서열에 의해 코딩되는 아미노산 서열을 포함한다 (개별 CDR은 도 2a-3d에 비추어, 다른 실시태양은 도 3ccc-3jjj 및 15a-15d에 따라 쉽게 결정될 수 있다). In some embodiments, the CDR variant comprises an amino acid sequence encoded by the nucleic acid sequences and those sequences which hybridize to one or more CDR sequences in the above sequence (individual CDR is the sun is a 3ccc another embodiment, in the light of Fig. 2a-3d easily it can be determined) in accordance with -3jjj and 15a-15d. 본 문맥에서 언급되는 구문 "선택적으로 혼성화하다"는 검출가능하게 및 선택적으로 결합함을 의미한다. Syntax referred to in this context, "to selectively hybridize to," are detectably and optionally also means a bond. 본 발명에 따른 폴리뉴클레오티드, 올리고뉴클레오티드 및 그의 단편은 비특이적 핵산에 대한 검출가능한 결합의 감지가능한 양을 최소화시키는 혼성화 및 세척 조건 하에 핵산 가닥에 선택적으로 혼성화한다. The invention polynucleotides, oligonucleotides according to the nucleotide and fragments thereof selectively hybridize to nucleic acid strands under hybridization and wash conditions that minimize the detected amounts of detectable binding to nonspecific nucleic acids. 당업계에 공지되고 본원에서 논의되는 선택적 혼성화 조건을 달성하기 위해 고 엄격성 조건이 사용될 수 있다. Are known in the art, high stringency conditions can be used to achieve selective hybridization conditions as discussed herein. 일반적으로, 본 발명의 폴리뉴클레오티드, 올리고뉴클레오티드, 및 단편과 관심있는 핵산 서열 사이의 핵산 서열 상동성은 적어도 80%, 보다 일반적으로 바람직하게는 적어도 85%, 90%, 95%, 99%, 및 100%일 것이다. In general, the oligonucleotide polynucleotide, of the invention a nucleotide, and fragments and last nucleic acid sequence homology between the interested nucleic acid sequence at least 80%, more typically and preferably at least 85%, 90%, 95%, 99%, and 100 %would. 2개의 아미노산 서열은 그들의 서열 사이에 부분적이거나 완전한 동일성이 존재할 경우에 상동성이다. Two amino acid sequences are homologous if there is a partial or complete identity between their sequences. 예를 들어, 85% 상동성은 2개의 서열이 최대 매칭을 위해 정렬될 때 85%의 아미노산이 동일함을 의미한다. For example, 85% homology means that the two sequences are 85% identical amino acids when aligned for maximum matching. 갭 (매치시키는 2개의 서열 중의 어느 하나 내의)은 매칭을 최대화하는데 허용되고; The gap (either one of the two sequences that in the match) is permitted to maximize matching; 5 이하의 갭 길이가 바람직하고, 2 이하가 보다 바람직하다. The gap lengths of 5 or less are preferred, more preferably 2 or lower. 별법으로 및 바람직하게는, 2개의 단백질 서열 (또는 길이가 적어도 30개의 아미노산인 단백질로부터 유도된 폴리펩티드 서열)은 돌연변이 데이타 매트릭스 및 6 초과의 갭 페널티 (gap penalty)를 이용하는 프로그램 ALIGN을 사용할 때 5 이상의 정렬 스코어 (표준 편차 단위에서)를 갖는 경우에 본원에서 사용되는 의미의 상동성이다. Alternatively and preferably, two protein sequences (or the length of the polypeptide sequences derived from at least 30 amino acids, a protein) is 5 or more when using the program ALIGN using a gap penalty (gap penalty) of the mutation data matrix and 6 exceeds a homology means as used herein, when having an alignment score (in standard deviation units). 문헌 [Dayhoff, MO, in Atlas of Protein Sequence and Structure, pp. Document [Dayhoff, MO, in Atlas of Protein Sequence and Structure, pp. 101-110 (Volume 5, National Biomedical Research Foundation (1972)] 및 이에 대한 [Supplement 2, pp. 1-10]을 참조한다. 2개의 서열 또는 그의 일부는 보다 바람직하게는 그들의 아미노산이 ALIGN 프로그램을 사용하여 최적으로 정렬될 때 50% 이상 동일할 경우에 상동성이다. 용어 "에 대응하다"는 폴리뉴클레오티드 서열이 참조 폴리뉴클레오티드 서열의 전부 또는 일부에 상동성이거나 (즉, 동일하지만 엄밀히 말하면 진화상 관련되지 않거나), 폴리펩티드 서열이 참조 폴리펩티드 서열과 동일함을 의미하도록 본원에서 사용된다. 이와 대조적으로, 용어 "에 상보성인"은 상보성 서열이 참조 폴리뉴클레오티드 서열의 전부 또는 일부에 대해 상동성임을 의미하도록 본원에서 사용된다. 예를 들어, 뉴클레오티드 서열 "TATAC"는 참조 서열 "TATAC"에 대응하고, 참조 서열 "GTATA"에 상보성 101-110 (Volume 5, National Biomedical Research Foundation (1972)] and thus to see [Supplement 2, pp. 1-10]. 2 of the sequence, or a portion thereof is used more preferably the amino acids of their program ALIGN when to be aligned optimally is homologous if the same 50% or more "is corresponding to" the term polynucleotide sequence is referenced poly all or homologous to part of the nucleotide sequence, or (that is, the same, but strictly speaking, evolution PURPOSES not or), is used herein are polypeptide sequences to mean the same as the reference polypeptide sequence. in contrast, to "the complementarity of" terminology, the complementary sequence means a homology ordination for all or a portion of a reference polynucleotide sequence It is used herein, for example, the nucleotide sequence "TATAC" corresponds to, and complementary to a reference sequence "GTATA" reference sequence "TATAC" 다. The.

항원 결합 단백질 (예를 들어 항체)의 제조 Preparation of the antigen-binding protein (e.g. antibody)

특정 실시태양에서, 항원 결합 단백질 (예를 들어, 항체)은 항원 (예를 들어, PCSK9)을 사용한 면역화에 의해 생산된다. In a specific embodiment, the antigen binding proteins (e.g., antibodies) are produced by immunization with an antigen (e.g., PCSK9). 특정 실시태양에서, 항체는 전장 PCSK9, PCSK9의 가용성 형태, 촉매 도메인 단독, 도 1a에 도시된 PCSK9의 성숙형, PCSK9의 스플라이스 변이체 형태, 또는 그의 단편을 사용한 면역화에 의해 생산할 수 있다. In certain embodiments, the antibodies may be produced by immunization with full-length PCSK9, a soluble form of PCSK9, the catalytic domain alone, the mature, splice variants of PCSK9 form of PCSK9, or fragments thereof, shown in Figure 1a. 특정 실시태양에서, 본 발명의 항체는 폴리클로날 또는 모노클로날일 수 있고/있거나 재조합 항체일 수 있다. In certain embodiments, the antibodies of the invention can be a polyclonal or monoclonal nalil / or may be recombinant antibodies. 특정 실시태양에서, 본 발명의 항체는 예를 들어, 인간 항체를 생산할 수 있는 트랜스제닉 (transgenic) 동물의 면역화에 의해 제조된 인간 항체이다 (예를 들어 PCT 특허 출원 공개 WO 93/12227 참조). In certain embodiments, the antibodies of the invention include, for example, is a human antibody prepared by immunization of transgenic (transgenic) animal to produce human antibodies (see, for example, PCT Patent Application Publication WO 93/12227).

특정 실시태양에서, 항체의 고유한 특성, 예를 들어 그의 표적에 대한 항체의 친화도를 조작하기 위해 특정 전략이 사용될 수 있다. In certain embodiments, a particular strategy can be used for the unique characteristics of the antibody, for example, to manipulate the affinity of the antibody for its target. 그러한 전략은 항체 변이체를 생성하도록 항체를 코딩하는 폴리뉴클레오티드 분자의 부위-특이적 또는 무작위 돌연변이 유발의 사용을 포함하고 이로 제한되지 않는다. Such strategies are part of the polynucleotide molecule encoding the antibody to generate antibody variants - involves the use of specific or random mutagenesis, and without limitation. 특정 실시태양에서, 그러한 생성 후에, 목적하는 변화, 예를 들어 증가된 또는 감소된 친화도를 보이는 항체 변이체의 스크리닝을 수행한다. In a specific embodiment, screening is performed after such a generation, it is an object changes, for showing an increased or a decreased affinity of the antibody variant example.

특정 실시태양에서, 돌연변이 유발 전략에서 표적화되는 아미노산 잔기는 CDR 내의 잔기이다. In certain embodiments, the amino acid residues targeted in mutagenic strategies are residues in the CDR. 특정 실시태양에서, 가변 도메인의 프레임워크 구역 내의 아미노산이 표적화된다. In certain embodiments, targeting is the amino acid in the framework regions of the variable domain. 특정 실시태양에서, 상기 프레임워크 구역은 특정 항체의 표적 결합 특성에 기여하는 것으로 나타났다. In a specific embodiment, the framework regions have been shown to contribute to the target binding properties of certain antibodies. 예를 들어, 문헌 [Hudson, Curr. See, e.g., [Hudson, Curr. Opin. Opin. Biotech., 9:395-402 (1999)] 및 여기에 언급된 참고문헌을 참고한다. Biotech, 9:. 395-402 (1999)], and refer to the references mentioned herein.

특정 실시태양에서, 덜 효과적으로 및 더 효과적으로 스크리닝된 항체 변이체의 라이브러리는 무작위 또는 부위 지정 돌연변이 유발을, 체세포 친화도 성숙 과정 중에 돌연변이되기 쉬운 영역에 대응하는 부위인 CDR 내의 과다돌연변이 부위로 제한함으로써 생산된다. In certain embodiments, a library of antibody variants screened less efficiently and more effectively is produced by limiting to excessive mutation site in the region of CDR corresponding to the random or site directed mutagenesis, to susceptible to mutation region in the maturation process of somatic affinity . 예를 들어, 문헌 [Chowdhury & Pastan, Nature Biotech., 17: 568-572 (1999)] 및 여기에 언급된 참고문헌을 참고한다. See, e.g., [Chowdhury & Pastan, Nature Biotech, 17:. 568-572 (1999)], and refer to the references mentioned herein. 특정 실시태양에서, 특정한 직접 및 역위 반복서열, 특정 컨센서스 서열, 특정 2차 구조 및 특정 팔린드롬 (palindrome)을 포함하고 이로 제한되지 않는 특정 종류의 DNA 요소를 사용하여 과다돌연변이 부위를 확인할 수 있다. In a specific embodiment, using a particular direct and inverted repeat sequences, certain consensus sequences, certain secondary structures, and certain types are not included certain sold drop (palindrome) and limited to the DNA element may determine the over-mutation sites. 예를 들어, 과다돌연변이 부위를 확인하기 위해 사용할 수 있는 그러한 DNA 요소는 퓨린 (A 또는 G), 이어서 구아닌 (G), 이어서 피리미딘 (C 또는 T), 이어서 아데노신 또는 티미딘 (A 또는 T) (즉, A/GGC/TA/T)를 포함하는 4염기 서열을 포함하고 이로 제한되지 않는다. For example, such DNA elements that may be used to check for over-mutation sites is the purine (A or G), followed by a guanine (G), followed by pyrimidine (C or T), followed by adenosine or thymine (A or T) (i.e., a / GGC / TA / T) comprises a four base sequence comprising and not limited thereto. 과다돌연변이 부위를 확인하기 위해 사용할 수 있는 DNA 요소의 다른 예는 세린 코돈 AGC/T이다. Another example of a DNA element that can be used to check for over-mutation sites is the serine codon AGC / T.

완전 인간 ABP (예를 들어, 항체)의 제조 Full production of human ABP (e.g., antibodies)

특정 실시태양에서, 파지 디스플레이 기술을 사용하여 모노클로날 항체를 생성시킨다. In a specific embodiment, by using phage display technology to produce monoclonal antibodies. 특정 실시태양에서, 그러한 기술은 완전 인간 모노클로날 항체를 생산한다. In certain embodiments, such techniques produce fully human monoclonal antibodies to a monoclonal antibody. 특정 실시태양에서, 단일 Fab 또는 Fv 항체 단편을 코딩하는 폴리뉴클레오티드가 파지 입자의 표면 상에 발현된다 (예를 들어, [Hoogenboom et al., J. Mol. Biol., 227: 381 (1991)]; [Marks et al., J Mol Biol 222: 581 (1991)]; 미국 특허 5,885,793 참조). In certain embodiments, a polynucleotide encoding a single Fab or Fv antibody fragment is expressed on the surface of phage particles (e.g., [Hoogenboom et al, J. Mol Biol, 227:... 381 (1991)] ; [Marks et al, J Mol Biol 222:. 581 (1991)]; see U.S. Patent 5,885,793). 특정 실시태양에서, 파지는 표적에 대해 친화도를 갖는 항체 단편을 확인하기 위해 "스크리닝"된다. In certain embodiments, the phage are "screened" to identify the antibody fragment having an affinity for a target. 따라서, 그러한 특정 과정은 섬유상 박테리오파지의 표면 상의 항체 단편 레퍼토리의 디스플레이를 통한 면역 선택, 및 그의 표적에 대한 결합에 의한 파지의 후속적인 선택과 흡사하다. Therefore, that particular process is similar to the subsequent selection of phage by binding to the immune selection, and its target through the display of antibody fragment repertoires on the surface of the fibrous bacteriophage. 그러한 특정 절차에서, 고 친화도의 기능성 중화 항체 단편이 단리된다. In such a particular procedure, the neutralizing antibody functional fragments of a high-affinity is isolated. 그러한 특정 실시태양에서 (아래에 보다 상세히 논의된), 인간 항체 유전자의 완전한 레퍼토리는 말초 혈액 림프구로부터 자연적으로 재배열된 인간 V 유전자를 클로닝함으로써 생성된다. Full repertoire in such a particular embodiment (as discussed in more detail below), the human antibody genes is created by cloning naturally rearranged human V genes from peripheral blood lymphocytes. 예를 들어, 문헌 [Mullinax et al., Proc Natl Acad Sci (USA), 87: 8095-8099 (1990)]을 참조한다. For example, the literature: see [Mullinax et al, Proc Natl Acad Sci (USA), 87 8095-8099 (1990).].

특정 실시태양에 따라, 본 발명의 항체는 인간 항체 생산 게놈의 실질적인 부분이 삽입되지만 내인성 쥐 항체의 생산을 결핍시킨 트랜스제닉 마우스를 이용하여 제조된다. Depending on certain embodiments, the antibodies of the invention are inserted a substantial portion of the human antibody producing genome, but is produced using a transgenic mouse having deficiency in the production of endogenous mouse antibodies. 이어서, 그러한 마우스는 인간 면역글로불린 분자 및 항체를 생산할 수 있고, 쥐 면역글로불린 분자 및 항체의 생산은 결핍된다. Then, such a mouse can produce human immunoglobulin molecules and antibodies, the production of mouse immunoglobulin molecules and antibodies are deficient. 상기 결과를 달성하기 위해 사용되는 기술은 본원 명세서에 개시된 특허, 출원 및 참고문헌에 개시되어 있다. Technique used to achieve the results are disclosed in patents, applications and references disclosed in the specification of the present application. 특정 실시태양에서, 임의의 목적으로 본원에 참조로 포함시킨 PCT 특허 출원 공개 WO 98/24893 또는 문헌 [Mendez et al., Nature Genetics, 15:146-156 (1997)]에 개시된 것과 같은 방법을 사용할 수 있다. In certain embodiments, that PCT patent application publication incorporated herein by reference for any purpose WO 98/24893 or the literature, use the same method as disclosed in [Mendez et al, Nature Genetics, 15. 146-156 (1997)] can.

일반적으로, PCSK9에 특이적인 완전 인간 모노클로날 ABP (예를 들어, 항체)는 다음과 같이 생산할 수 있다. In general, a day-specific fully human monoclonal antibodies to PCSK9 ABP (e.g., antibodies) can be produced as follows. 인간 면역글로불린 유전자를 함유하는 트랜스제닉 마우스를 관심있는 항원, 예를 들어 PCSK9로 면역화시키고, 항체를 발현하는 마우스로부터 림프 세포 (예를 들어 B-세포)를 얻는다. Human immunoglobulin antigen of interest transgenic mice containing the gene, for instance immunized with PCSK9 and, to obtain the lymphocytes (for example, B- cells) from the mice that express antibodies. 상기 회수된 세포를 골수-형 세포주와 융합시켜 불멸성 하이브리도마 세포주를 제조하고, 상기 하이브리도마 세포주를 관심있는 항원에 대해 특이적인 항체를 생산하는 하이브리도마 세포주를 확인하기 위해 스크리닝하고 선택한다. Wherein the recovered cells, bone marrow-fused with type cell line immortality of hybridoma producing a cell line, and screening to identify hybridoma cell lines that produce antibodies specific for the antigen of interest the hybridoma cell line and selecting do. 특정 실시태양에서, PCSK9에 특이적인 항체를 생산하는 하이브리도마 세포주의 생산을 제공한다. In certain embodiments, there is provided the production of hybridoma cell lines that produce antibodies specific to PCSK9.

특정 실시태양에서, 완전 인간 항체는 인간 비장세포 (B 또는 T 세포)를 시험관 내에서 항원에 노출시킨 후, 노출된 세포를 면역손상시킨 마우스, 예를 들어 SCID 또는 nod/SCID 내에서 재구성함으로써 생산한다 (예를 들어, [Brams et al., J. Immunol. 160: 2051-2058 (1998)]; [Carballido et al., Nat. Med., 6: 103-106 (2000)] 참조). In certain embodiments, fully human antibodies are human splenocytes (B or T cells) to produce, by example, reconstructed in SCID or nod / SCID and then exposed to the antigen in vitro, in which immune damage to the exposed cells, a mouse, for example, (e. g., [Brams et al, J. Immunol 160: 2051-2058 (1998)..]; [Carballido et al, Nat Med, 6:... 103-106 (2000)] reference). 특정한 그러한 방법에서, SCID 마우스 (SCID-hu) 내로 인간 태아 조직을 이식하면 장기간 조혈반응 및 인간 T-세포 발달을 일으킨다 (예를 들어, [McCune et al., Science, 241:1532-1639 (1988)]; [Ifversen et al., Sem. Immunol., 8:243-248 (1996)] 참조). In certain such methods, when transplanted human fetal tissue into SCID mice (SCID-hu) resulting in long-term hematopoiesis reaction and Human T- cell development (e.g., [McCune et al, Science, 241:. 1532-1639 (1988 )]; [Ifversen et al, Sem Immunol, 8:... 243-248 (1996)] reference). 특정 예에서, 상기 키메라 마우스에서 체액성 면역 반응은 동물 내에서 인간 T-세포의 동시-발달에 의해 좌우된다 (예를 들어, [Martensson et al., Immunol., 83:1271-179 (1994)] 참조). In certain instances, humoral immune response in the chimeric mouse are simultaneously human T- cells in animals - is influenced by the development (e. G., [Martensson et al, Immunol, 83: 1271-179 (1994).. ] Reference). 특정 방법에서, 인간 말초 혈액 림프구를 SCID 마우스 내로 이식한다 (예를 들어, [Mosier et al., Nature, 335:256-259 (1988)] 참조. 특정 그러한 실시태양에서, 상기 이식된 세포를 프라이밍제 (priming agent), 예를 들어 포도구균 내독소 A (SEA)로, 또는 항-인간 CD40 모노클로날 항체로 처리할 때, 보다 높은 수준의 B 세포 생산이 검출된다 (예를 들어, [Martensson et al., Immunol., 84:224-230 (1995)]; [Murphy et al., Blood, 86:1946-1953 (1995)] 참조). In a particular method, and human peripheral blood lymphocytes transplanted into SCID mice (e. G.,. [Mosier et al, Nature, 335:. 256-259 (1988)] referred to in certain such embodiments, the priming for the implanted cells first (priming agent), for example, Staphylococcus aureus within a toxin a (SEA), or anti-when treated with human CD40 monoclonal antibody, and the higher levels of B cell production is detected (e.g., [Martensson et al, Immunol, 84:.. 224-230 (1995)]; [Murphy et al, Blood, 86:. 1946-1953, see (1995)).

따라서, 특정 실시태양에서, 완전 인간 항체는 숙주 세포 내에서 재조합 DNA의 발현, 또는 하이브리도마 세포 내에서 발현에 의해 생산할 수 있다. Thus, in certain embodiments, fully human antibodies may be produced by expression in the expression, or hybridoma cells of the recombinant DNA in a host cell. 다른 실시태양에서, 항체는 본원에서 설명되는 파지 디스플레이 기술을 사용하여 생산할 수 있다. In another embodiment, the antibody may be produced using the phage display techniques described herein.

본원에 기재된 항체는 본원에서 설명되는 바와 같은 XenoMouse® 기술을 이용하여 제조하였다. Antibodies described herein were prepared using XenoMouse® technology as described herein. 이어서, 그러한 마우스는 인간 면역글로불린 분자 및 항체를 생산할 수 있고, 쥐 면역글로불린 분자 및 항체의 생산은 결핍된다. Then, such a mouse can produce human immunoglobulin molecules and antibodies, the production of mouse immunoglobulin molecules and antibodies are deficient. 이를 달성하기 위해 사용되는 기술은 본원의 배경 섹션에서 개시된 특허, 출원, 및 참고문헌에 개시되어 있다. Technology used to achieve this are disclosed in the patents, applications, and references disclosed in the background section of the present application. 그러나, 특히, 마우스의 트랜스제닉 생산 및 그로부터 항체의 바람직한 실시태양은 그 개시내용을 본원에 참조로 포함시킨 미국 특허 출원 08/759,620 (1996년 12월 3일 출원) 및 국제 특허 출원 WO 98/24893 (1998년 6월 11일 공개), 및 WO 00/76310 (2000년 12월 21일 공개)에 개시되어 있다. However, in particular, transgenic production of mice and antibodies therefrom a preferred embodiment of the aspect in which United States Patent Application 08/759 620 (filed December 3, 1996), including its disclosure herein by reference, and International Patent Application WO 98/24893 It is disclosed in (June 1998 11th public), and WO 00/76310 (published December 21, 2000). 또한 그 개시내용을 본원에 참조로 포함시킨 문헌 [Mendez et al., Nature Genetics, 15:146-156 (1997)]을 참조한다. Refers to: [146-156 (1997) Mendez et al, Nature Genetics, 15.] In addition, that reference is incorporated by reference for the disclosure of the present application.

상기 기술을 사용하여, 다양한 항원에 대한 완전 인간 모노클로날 항체를 생산하였다. Using this technique, and produce monoclonal antibodies fully human monoclonal antibodies to various antigens. 본질적으로, XenoMouse® 주의 마우스를 관심있는 항원 (예를 들어 PCSK9)으로 면역화시키고, 과면역처리된 마우스로부터 림프 세포 (예를 들어 B-세포)를 회수하고, 회수된 림프구를 골수-형 세포주와 융합시켜 불멸의 하이브리도마 세포주를 제조한다. In essence, XenoMouse® note of interest mouse antigen recover lymphatic cells (such as B- cells g) from (e.g., PCSK9) in immunized and, and immune treated mice, and the recovered lymphocytes, bone marrow-type cell line and fusion was to produce an immortal hybridoma cell line. 이들 하이브리도마 세포주는 관심있는 항원에 특이적인 항체를 생산한 하이브리도마 세포주를 확인하기 위해 스크리닝 및 선택된다. These hybridoma cell lines are screened and selected to identify hybridoma cell lines which produce antibodies specific to the antigen of interest. PCSK9에 특이적인 항체를 생산하는 다수 하이브리도마 세포주의 생산을 위한 방법을 본원에서 제공한다. A method for the production of multiple hybridoma cell lines that produce antibodies specific to PCSK9 is provided herein. 또한, 상기 항체의 중쇄 및 경쇄의 뉴클레오티드 및 아미노산 서열 분석을 포함한, 상기 세포주에 의해 생산된 항체의 특성 결정을 본원에서 제공한다. In addition, the service, including the heavy chain and light chain nucleotide and amino acid sequence analysis of the antibody, the properties of the antibodies produced by the cell line determined herein.

마우스의 XenoMouse® 주의 생산은 미국 특허 출원 07/466,008 (1990년 1월 12일 출원), 07/610,515 (1990년 11월 8일 출원), 07/919,297 (1992년 7월 24일 출원), 07/922,649 (1992년 7월 30일 출원), 08/031,801 (1993년 3월 15일 출원), 08/112,848 (1993년 8월 27일 출원), 08/234,145 (1994년 4월 28일 출원), 08/376,279 (1995년 1월 20일 출원), 08/430,938 (1995년 4월 27일 출원), 08/464,584 (1995년 6월 5일 출원), 08/464,582 (1995년 6월 5일 출원), 08/463,191 (1995년 6월 5일 출원), 08/462,837 (1995년 6월 5일 출원), 08/486,853 (1995년 6월 5일 출원), 08/486,857 (1995년 6월 5일 출원), 08/486,859 (1995년 6월 5일 출원), 08/462,513 (1995년 6월 5일 출원), 08/724,752 (1996년 10월 2일 출원), 08/759,620 (1996년 12월 3일 출원), 미국 특허 공개 2003/0093820 (2001년 11월 30일 출원)과 미국 특허 6,162,963, 6,150,584, 6,114,598, 6,075,181 및 5,939,598과 일본 특허 3 068 180 B2, 3 068 506 B2 및 Mouse XenoMouse® careful production is US Patent Application 07 / 466,008 (filed 12 January 1990), 07 / 610,515 (filed November 08, 1990), 07 / 919,297 (filed July 24, 1992), 07 / 922649 (7 filed May 30, 1992), 08 / 031,801 (filed March 15, 1993), 08 / 112,848 (August 1993 27 days pending), 08 / 234,145 (filed April 28, 1994) 08 / 376,279 (January 1995, 20 days pending), 08 / 430,938 (April 1995 May 27, pending), 08 / 464,584 (June 1995 5 days pending), 08 / 464,582 (June 05, 1995 pending), 08 / 463,191 (June 1995 5 days pending), 08 / 462,837 (June 1995 5 days pending), 08 / 486,853 (June 1995 5 days pending), 08 / 486,857 (June 1995 5 days pending), 08 / 486,859 (June 1995 5 days pending), 08 / 462,513 (June 1995 5 days pending), 08 / 724,752 (10, 1996 May 2, pending), 08 / 759,620 (1996 12 3 filed May), United States Patent Application Publication 2003/0093820 (filed 30 November 2001) and US Patent 6,162,963, 6,150,584, 6,114,598, 6,075,181 and 5,939,598 and JP 3 068 180 B2, 3 068 506 B2, and 3 068 507 B2에 추가로 논의되고 서술된다. 3068 is discussed and described in addition to the 507 B2. 또한, 유럽 특허 EP 0 463 151 B1 (1996년 6월 12일 등록), 국제 특허 출원 공개 WO 94/02602 (1994년 2월 3일 공개), 국제 특허 출원 공개 WO 96/34096 (1996년 10월 31일 공개), WO 98/24893 (1998년 6월 11일 공개), WO 00/76310 (2000년 12월 21일 공개)을 참조한다. Further, European Patent EP 0 463 151 B1 (May 12, June 1996 release), International Patent Application Publication WO 94/02602 (published February 1994 3 days), International Patent Application Publication WO 96/34096 (October 1996 see Publication 31 days), WO 98/24893 (June 1998 released on the 11th), WO 00/76310 (released December 21, 2000). 상기 인용된 특허, 출원, 및 참고문헌의 각각의 개시내용은 그 전문을 본원에 참조로 포함시킨다. Each of the disclosures of the above-cited patents, applications, and references are thereby incorporated by reference in its entirety herein.

대안으로, 젠팜 인터내셔널, 인크. Alternatively, jenpam International, Inc. (GenPharm International, Inc.)를 포함한 다른 이들은 "미니로커스 (minilocus)" 방법을 이용하였다. They are different, including (GenPharm International, Inc.) was used as a "mini-locus (minilocus)" method. 미니로커스 방법에서, 외인성 Ig 로커스는 Ig 로커스로부터의 조각 (개별 유전자)의 포함에 의해 모방된다. In the mini-locus method, an exogenous Ig locus is imitated by the inclusion of pieces (individual genes) from the Ig locus. 따라서, 하나 이상의 V H 유전자, 하나 이상의 D H 유전자, 하나 이상의 J H 유전자, mu 불변 구역, 및 대체로 제2 불변 구역 (바람직하게는 감마 불변 구역)은 동물 내로 삽입하기 위한 구성체로 형성된다. Thus, one or more V H genes, one or more D H genes, one or more J H genes, mu constant section, and a generally second constant region (preferably a gamma constant section) is formed of a structure body for insertion into the animal. 상기 방법은 그 개시내용을 본원에 참조로 포함시킨 미국 특허 5,545,807 (Surani et al) 및 미국 특허 5,545,806, 5,625,825, 5,625,126, 5,633,425, 5,661,016, 5,770,429, 5,789,650, 5,814,318, 5,877,397, 5,874,299, 및 6,255,458 (각각 Lonberg & Kay), 미국 특허 5,591,669 및 6,023,010 (Krimpenfort & Berns), 미국 특허 5,612,205, 5,721,367, 및 5,789,215 (Berns et al), 및 미국 특허 5,643,763 (Choi & Dunn, 및 젠팜 인터내셔널), 미국 특허 출원 07/574,748 (1990년 8월 29일 출원), 07/575,962 (1990년 8월 31일 출원), 07/810,279 (1991년 12월 17일 출원), 07/853,408 (1992년 3월 18일 출원), 07/904,068 (1992년 6월 23일 출원), 07/990,860 (1992년 12월 16일 출원), 08/053,131 (1993년 4월 26일 출원), 08/096,762 (1993년 7월 22일 출원), 08/155,301 (1993년 11월 18일 출원), 08/161,739 (1993년 12월 3일 출원), 08/165,699 (1993년 12월 10일 출원), 08/209,741 (1994년 3월 9일 출원)에 기재되어 있다. The method that the United States Patent 5,545,807 (Surani et al) including the disclosure herein by reference, and U.S. Patent 5,545,806, 5,625,825, 5,625,126, 5,633,425, 5,661,016, 5,770,429, 5.78965 million, 5,814,318, 5,877,397, 5,874,299, and 6,255,458 (each Lonberg & Kay), U.S. Patent 5,591,669 and 6,023,010 (Krimpenfort & Berns), U.S. patents 5,612,205, 5,721,367, and 5,789,215 (Berns et al), and U.S. Patent 5,643,763 (Choi & Dunn, and jenpam International), U.S. Patent Application 07/574 748 (1990 in August 29 pending), 07 / 575,962 (August 1990 January 31, pending), 07 / 810,279 (December 17, filed 1991), 07 / 853,408 (filed March 18, 1992), 07 / 904,068 (June 1992, filed May 23), 07/990 860 (December 16 filed 1992), 08/053 131 (April 1993 26th pending), 08/096 762 (filed on July 22, 1993), 08 / 155301 (November 11, 1993 May 18, pending), 08 / 161,739 (filed December 3, 1993), 08 / 165,699 (December 10, filed 1993), 08 / 209,741 (filed March 9, 1994) It is described in. 또한, 그 개시내용을 전문을 본원에 참조로 포함시킨 유럽 특허 0 546 073 B1, 국제 특허 출원 WO 92/03918, WO 92/22645, WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, WO 94/25585, WO 96/14436, WO 97/13852, 및 WO 98/24884와 미국 특허 5,981,175를 참조한다. Also, the disclosures of which European Patent including professional herein by reference 0 546 073 B1, International Patent Applications WO 92/03918, WO 92/22645, WO 92/22647, WO 92/22670, WO 93/12227, WO 94/00569, reference is made to WO 94/25585, WO 96/14436, WO 97/13852, and WO 98/24884 and U.S. Patent 5,981,175. 추가로 그 개시내용을 전문을 본원에 참조로 포함시킨 문헌 ([Taylor et al., 1992], [Chen et al., 1993], [Tuaillon et al., 1993], [Choi et al., 1993], [Lonberg et al., (1994)], [Taylor et al., (1994)], [Tuaillon et al., (1995)], 및 [Fishwild et al., (1996)])을 참조한다. Which literature include additional specialized in the disclosure as herein by reference ([Taylor et al., 1992], [Chen et al., 1993], [Tuaillon et al., 1993], [Choi et al., 1993 ], [Lonberg et al., (1994)], [Taylor et al., (1994)], [Tuaillon et al., (1995)], and [Fishwild et al., refers to the (1996)) .

키린 (Kirin)은 또한 미세세포 융합을 통해, 큰 조각의 염색체 또는 전체 염색체가 도입된 마우스로부터 인간 항체의 생성을 입증하였다. Kirin (Kirin) also through the fine-cell fusion, demonstrated the generation of human antibodies from which the large piece of chromosomes, or entire chromosomes introduced mouse. 그 개시내용을 본원에 참조로 포함시킨 유럽 특허 출원 773 288 및 843 961을 참조한다. It refers to that European Patent Application 773 288 and 961 843, including the disclosures herein by reference. 추가로, KM™ 마우스 (키린의 Tc 마우스를 메다렉스 (Medarex)의 미니로커스 (Humab) 마우스와 교잡시킨 결과임)가 생성되었다. Was generated in addition, KM mouse ™ (mini-locus (Humab) mice as a result of hybridization of the Tc of the Kirin mice Alameda Rex (Medarex) Im). 이들 마우스는 키린 마우스의 인간 IgH 트랜스염색체 (transchromosome) 및 젠팜 마우스의 카파 사슬 도입 유전자 (transgene)를 보유한다 (Ishida et al., Cloning Stem Cells, (2002) 4:91-102). These mice possess the kappa chain transgene of the Kirin mice human IgH transchromosomic (transchromosome) and jenpam mouse (transgene) (Ishida et al, Cloning Stem Cells, (2002) 4:. 91-102).

인간 항체는 또한 시험관 내 방법에 의해 유도될 수 있다. Human antibodies can also be derived by the method in vitro. 적합한 예는 파지 디스플레이 (CAT, Morphosys, Dyax, Biosite/Medarex, Xoma, Symphogen, Alexion (이전에 Proliferon), Affimed) 리보좀 디스플레이 (CAT), 효모 디스플레이 등을 포함하고 이로 제한되지 않는다. Suitable examples include phage display (CAT, Morphosys, Dyax, Biosite / Medarex, Xoma, Symphogen, Alexion (formerly Proliferon), Affimed) ribosome display (CAT), yeast display, and the like without limitation.

일부 실시태양에서, 본원에 기재된 항체는 인간 IgG4 중쇄뿐만 아니라 IgG2 중쇄를 갖는다. In some embodiments, the antibodies described herein have a heavy chain IgG2 as well as the human IgG4 heavy chain. 항체는 또한 IgG1을 포함한 다른 인간 이소형의 것일 수 있다. Antibodies can also be of other human isotype, including IgG1. 항체는 높은 친화도를 갖고, 다양한 기술에 의해 측정할 때 일반적으로 Kd가 약 10 -6 내지 약 10 -13 M 이하이다. The antibody has a high affinity, Kd is generally from about 10 -6 to about 10 -13 M or less as measured by various techniques.

이해될 바와 같이, 항체는 하이브리도마 세포주 이외의 다른 세포주에서 발현될 수 있다. As will be appreciated, antibodies can be expressed in cell lines other than hybridoma cell lines. 특정 항체를 코딩하는 서열은 적합한 포유동물 숙주 세포의 형질전환을 위해 사용될 수 있다. Sequence encoding a specific antibody can be used for transformation of a suitable mammalian host cell. 형질전환은 예를 들어 바이러스 내에 (또는 바이러스 벡터 내로) 폴리뉴클레오티드의 패키징 (packaging) 및 바이러스 (또는 벡터)를 사용한 숙주 세포의 형질도입을 포함한, 숙주 세포 내로 폴리뉴클레오티드의 도입을 위한 임의의 공지된 방법에 의해, 또는 본원에 참조로 포함시킨 미국 특허 4,399,216, 4,912,040, 4,740,461 및 4,959,455에 예시된 바와 같이 당업계에 공지된 형질감염 절차에 의해 수행할 수 있다. Transformants, for example viruses in the original (or viral vector into a) a polynucleotide of the packaging (packaging) and the virus (or vector) of the used host cell transformed any known for, the introduction of the polynucleotide into a host cell, including introduction of the by the method, or may be performed by the transfection procedures known in the art. as illustrated in U.S. Patent 4,399,216 which, 4.91204 million, 4,740,461 and 4,959,455 incorporated herein by reference. 사용되는 형질전환 절차는 형질전환시킬 숙주에 따라 결정된다. Transfection procedure used is determined according to the transformed host. 이종성 폴리뉴클레오티드를 포유동물 세포 내로 도입하기 위한 방법은 당업계에 잘 공지되어 있고, 덱스트란-매개 형질감염, 인산칼슘 침전, 폴리브렌 매개 형질감염, 원형질체 융합, 전기천공, 폴리뉴클레오티드(들)의 리포좀 내 봉입, 및 핵 내로 DNA의 직접 미세주사를 포함한다. Mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, polynucleotide (s) - heterologous poly A method for introducing a nucleotide mammal into mammalian cells are well known in the art, and dextran and a direct microinjection of the encapsulated within, and nuclear DNA into liposomes.

발현을 위한 숙주로서 이용가능한 포유동물 세포주는 당업계에 잘 공지되어 있고, 차이니즈 햄스터 난소 (CHO) 세포, HeLa 세포, 베이비 햄스터 신장 (BHK) 세포, 원숭이 신장 세포 (COS), 인간 간세포 암종 세포 (예를 들어, Hep G2), 인간 상피 신장 293 세포, 및 많은 다른 세포주를 포함하고 이로 제한되지 않는 아메리칸 타입 컬쳐 컬렉션 (American Type Culture Collection; ATCC)으로부터 이용가능한 많은 불멸화 세포주를 포함하고 이로 제한되지 않는다. Mammalian cell lines available as hosts for expression are well known in the art, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells ( for example, Hep G2), comprising a human epithelial kidney 293 cells, and a number of other cell lines is not limited to the American type Culture collection (American type Culture collection which; include many immortalized cell lines available from the ATCC) and are not limited to . 특히 바람직한 세포주는 어떠한 세포주가 높은 발현 수준을 갖고 구성적 PCSK9 결합 특성을 갖는 항체를 생산하는지 결정하여 선택된다. A particularly preferred cell line is selected to determine whether any cell line producing the antibody has a high level of expression with a constitutive PCSK9 binding properties.

특정 실시태양에서, 항체 및/또는 ABP는 다음의 하이브리도마 중 적어도 하나에 의해 생산된다: 21B12, 31H4, 16F12, 표 2에 나열되거나 실시예에 개시된 임의의 다른 하이브리도마. In certain embodiments, the antibodies and / or ABP is produced by at least one of the following hybridomas of: any other hybridomas disclosed 21B12, 31H4, 16F12, listed in Table 2 below or in the Examples. 특정 실시태양에서, 항원 결합 단백질은 약 1 nM 미만, 예를 들어, 1000 pM 내지 100 pM, 100 pM 내지 10 pM, 10 pM 내지 1 pM, 및/또는 1 pM 내지 0.1 pM 이하의 해리 상수 (K D )로 PCSK9에 결합한다. In a specific embodiment, the antigen binding protein is less than about 1 nM, for example, 1000 pM to about 100 pM, 100 pM to 10 pM, 10 pM to about 1 pM, and / or 1 pM to below 0.1 pM of the dissociation constant (K bind to PCSK9 with D).

특정 실시태양에서, 항원 결합 단백질은 IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD 및 IgM 이소형 중 적어도 하나의 면역글로불린 분자를 포함한다. In certain embodiments, the antigen binding protein comprises at least one immunoglobulin molecules of IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD, and IgM isotype. 특정 실시태양에서, 항원 결합 단백질은 인간 카파 경쇄 및/또는 인간 중쇄를 포함한다. In certain embodiments, the antigen binding protein comprises a human kappa light chain and / or a human heavy chain. 특정 실시태양에서, 중쇄는 IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD, 또는 IgM 이소형의 것이다. In certain embodiments, the heavy chain is of the IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD, or IgM isotype. 특정 실시태양에서, 항원 결합 단백질은 포유동물 세포 내에서 발현을 위해 클로닝되었다. In a specific embodiment, the antigen binding protein has been cloned for expression in mammalian cells. 특정 실시태양에서, 항원 결합 단백질은 IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD 및 IgM 이소형의 임의의 불변 구역 이외의 불변 구역을 포함한다. In a specific embodiment, the antigen binding protein comprises the constant region of the non-IgG1, IgG2, IgG3, IgG4, IgE, IgA, IgD and any constant region of the IgM isotype.

특정 실시태양에서, 항원 결합 단백질은 인간 람다 경쇄 및 인간 IgG2 중쇄를 포함한다. In a specific embodiment, the antigen binding protein comprises a human lambda light chain and a human IgG2 heavy chain. 특정 실시태양에서, 항원 결합 단백질은 인간 람다 경쇄 및 인간 IgG4 중쇄를 포함한다. In a specific embodiment, the antigen binding protein comprises a human lambda light chain and the human IgG4 heavy chain. 특정 실시태양에서, 항원 결합 단백질은 인간 람다 경쇄 및 인간 IgG1, IgG3, IgE, IgA, IgD 또는 IgM 중쇄를 포함한다. In a specific embodiment, the antigen binding protein comprises a human lambda light chain and human IgG1, IgG3, IgE, IgA, IgD or IgM heavy chain. 다른 실시태양에서, 항원 결합 단백질은 인간 카파 경쇄 및 인간 IgG2 중쇄를 포함한다. In another embodiment, the antigen binding protein comprises a human kappa light chain and a human IgG2 heavy chain. 특정 실시태양에서, 항원 결합 단백질은 인간 카파 경쇄 및 인간 IgG4 중쇄를 포함한다. In certain embodiments, the antigen binding protein comprises a human kappa light chain and the human IgG4 heavy chain. 특정 실시태양에서, 항원 결합 단백질은 인간 카파 경쇄 및 인간 IgG1, IgG3, IgE, IgA, IgD 또는 IgM 중쇄를 포함한다. In a specific embodiment, the antigen binding protein comprises a human kappa light chain and human IgG1, IgG3, IgE, IgA, IgD or IgM heavy chain. 특정 실시태양에서, 항원 결합 단백질은 IgG2 이소형에 대한 불변 구역도 아니고 IgG4 이소형에 대한 불변 구역도 아닌 불변 구역에 라이게이팅된 항체의 가변 구역을 포함한다. In certain embodiments, the antigen binding protein comprises a variable region of an antibody to the constant Lai gated area not a constant section for the IgG2 isotype, not even the constant section of the IgG4 isotype. 특정 실시태양에서, 항원 결합 단백질은 포유동물 세포 내에서 발현을 위해 클로닝되었다. In a specific embodiment, the antigen binding protein has been cloned for expression in mammalian cells.

특정 실시태양에서, 하이브리도마주 21B12, 31H4 및 16F12 중 적어도 하나로부터의 항체의 중쇄 및 경쇄에 대한 보존적 변형 (및 코딩 뉴클레오티드에 대한 대응하는 변형)은 하이브리도마주 21B12, 31H4 및 16F12로부터의 항체와 유사한 기능적 및/또는 화학적 특징을 갖는 PCSK9에 대한 항체를 생산할 것이다. In certain embodiments, the hive Lido facing antibody from the 21B12, 31H4, and (the corresponding strain on and coding nucleotides) conservative modifications to the heavy and light chains of antibodies from at least one of 16F12 was hive Lido facing 21B12, 31H4, and 16F12 and it will produce an antibody to PCSK9 with similar functional and / or chemical properties. 이와 대조적으로, 특정 실시태양에서, PCSK9에 대한 항체의 기능적 및/또는 화학적 특징에서 실질적인 변형은 (a) 치환의 영역에서 분자 백본의 구조, 예를 들어, 시트 또는 나선 입체형태, (b) 표적 부위에서 분자의 전하 또는 소수성, 또는 (c) 측쇄의 벌크 (bulk)를 유지하는데 대한 그들의 효과가 유의하게 상이한 중쇄 및 경쇄의 아미노산 서열의 치환을 선택함으로써 달성할 수 있다. In contrast, in certain embodiments, substantial modifications in the functional and / or chemical characteristics of antibodies to PCSK9 is (a) contains a structure, such as the molecular backbone in the area of ​​the substitution, sheet or helical conformation, (b) the target It may in part be achieved by the charge or hydrophobicity of the molecule, or (c) select a different heavy chain, and substitution of amino acid sequence of the light chain significantly their effect on maintaining the bulk (bulk) of the side chain.

예를 들어, "보존적 아미노산 치환"은 그 위치의 아미노산 잔기의 극성 또는 전하에 영향이 거의 또는 전혀 없도록 비천연 잔기로 천연 아미노산 잔기의 치환을 포함할 수 있다. For example, a "conservative amino acid substitution" may comprise a substitution of natural amino acid residues with non-natural moieties so that little or no effect on the polarity or charge of the amino acid residues of that position. 또한, 폴리펩티드 내의 임의의 천연 잔기는 또한 "알라닌 스캐닝 돌연변이 유발"에 대해 이전에 설명된 바와 같이 알라닌으로 치환될 수 있다. Furthermore, any native residue in the polypeptide may also be substituted with alanine, as described previously for "alanine scanning mutagenesis."

요망하는 아미노산 치환 (보존적이든 비-보존적이든)은 그러한 치환이 요망되는 시점에 당업자가 결정할 수 있다. Desired amino acid substitutions to (conservative or non-conservative or) may be any person skilled in the art to determine the point at which such a substitution is desired. 특정 실시태양에서, 아미노산 치환은 PCSK9에 대한 항체의 중요한 잔기를 확인하기 위해, 또는 본원에서 설명되는 바와 같이 PCSK9에 대한 항체의 친화도를 증가 또는 감소시키기 위해 사용될 수 있다. In certain embodiments, amino acid substitutions can be used to increase or decrease the affinity of the antibody for PCSK9, as described, herein, or to determine the important residues of antibodies to PCSK9.

특정 실시태양에서, 본 발명의 항체는 하이브리도마 세포주 이외의 세포주에서 발현될 수 있다. In certain embodiments, the antibodies of the invention can be expressed in cell lines other than hybridoma cell lines. 특정 실시태양에서, 특정 항체를 코딩하는 서열은 적합한 포유동물 숙주 세포의 형질전환을 위해 사용될 수 있다. In certain embodiments, sequences encoding particular antibodies can be used for transformation of a suitable mammalian host cell. 특정 실시태양에 따라, 형질전환은 예를 들어 바이러스 내에 (또는 바이러스 벡터 내로) 폴리뉴클레오티드의 패키징, 및 바이러스 (또는 벡터)를 사용한 숙주 세포의 형질도입을 포함하는, 숙주 세포 내로의 폴리뉴클레오티드의 도입을 위한 임의의 공지된 방법에 의해, 또는 임의의 목적으로 본원에 참조로 포함시킨 미국 특허 4,399,216, 4,912,040, 4,740,461 및 4,959,455에 예시된 바와 같이 당업계에 공지된 형질감염 절차에 의해 수행될 수 있다. Depending on the particular embodiment, the transfection is for example the introduction of the polynucleotide into the in the virus (or virus into the vector), the packaging of the polynucleotide, and viruses, including transduction of a host cell with (or vector), a host cell by any known method for, or may be performed by the transfection procedures known in the art as exemplified in that U.S. Patent 4,399,216, 4.91204 million, 4,740,461 and 4,959,455 incorporated herein by reference for any purpose. 특정 실시태양에서, 사용되는 형질전환 절차는 형질전환시킬 숙주에 따라 결정된다. In certain embodiments, the transformation procedure used is determined according to the transformed host. 이종성 폴리뉴클레오티드를 포유동물 세포 내로 도입하기 위한 방법은 당업계에 잘 공지되어 있고, 덱스트란-매개 형질감염, 인산칼슘 침전, 폴리브렌 매개 형질감염, 원형질체 융합, 전기천공, 폴리뉴클레오티드(들)의 리포좀 내 봉입, 및 핵 내로 DNA의 직접 미세주사를 포함하고 이로 제한되지 않는다. Mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, polynucleotide (s) - heterologous poly A method for introducing a nucleotide mammal into mammalian cells are well known in the art, and dextran It includes direct microinjection of my enclosed, and into the nuclear DNA and liposomes not so limited.

발현을 위한 숙주로서 이용가능한 포유동물 세포주는 당업계에 잘 공지되어 있고, 차이니즈 햄스터 난소 (CHO) 세포, HeLa 세포, 베이비 햄스터 신장 (BHK) 세포, 원숭이 신장 세포 (COS), 인간 간세포 암종 세포 (예를 들어, Hep G2), 및 많은 다른 세포주를 포함하고 이로 제한되지 않는 아메리칸 타입 컬쳐 컬렉션 (ATCC)으로부터 이용가능한 많은 불멸화 세포주를 포함하고 이로 제한되지 않는다. Mammalian cell lines available as hosts for expression are well known in the art, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells ( for example, it includes a Hep G2), and a number of other cell lines contain many immortalized cell lines available from the American type Culture collection (ATCC) that are not limited to, and are not limited. 특정 실시태양에서, 세포주는 어떠한 세포주가 높은 발현 수준을 갖고 구성적 HGF 결합 특성을 갖는 항체를 생산하는지 결정하여 선택될 수 있다. In certain embodiments, cell lines may be selected to determine that produce antibodies that any cell line has a high expression level with constitutive HGF binding properties. 포유동물 숙주 세포에 대한 적절한 발현 벡터는 잘 공지되어 있다. Mammalian expression vectors suitable for the animal host cells are well known.

특정 실시태양에서, 항원 결합 단백질은 하나 이상의 폴리펩티드를 포함한다. In a specific embodiment, the antigen binding protein comprises at least one polypeptide. 특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드를 코딩하는 폴리뉴클레오티드 분자를 발현시키기 위해 임의의 다양한 발현 벡터/숙주 시스템을 사용할 수 있다. In certain embodiments, it may be used any of a variety of expression vector / host system to express the polynucleotide molecules encoding a polypeptide comprising one or more ABP or ABP ingredient itself. 그러한 시스템은 미생물, 예를 들어 재조합 박테리오파지, 플라스미드, 또는 코스미드 DNA 발현 벡터로 형질전환시킨 세균; Such a system in which bacterial microorganism, for example, transformed with a recombinant bacteriophage, plasmid, or cosmid DNA expression vectors; 효모 발현 벡터로 형질전환시킨 효모; Yeast was transformed with yeast expression vectors; 바이러스 발현 벡터 (예를 들어, 바큘로바이러스)로 감염시킨 곤충 세포 시스템; Virus expression vectors which infect an insect cell systems (e.g., baculovirus); 바이러스 발현 벡터 (예를 들어, 콜리플라워 모자이크 바이러스 CaMV, 담배 모자이크 바이러스 TMV)로 형질감염시키거나 세균 발현 벡터 (예를 들어, Ti 또는 pBR322 플라스미드)로 형질전환시킨 식물 세포 시스템; Virus expression vectors (e.g., cauliflower mosaic virus CaMV, Tobacco Mosaic Virus TMV) or with bacterial expression vectors to transfection (e. G., Ti or pBR322 plasmid) were transformed plant cell systems as; 또는 동물 세포 시스템을 포함하고 이로 제한되지 않는다. Or animal cell systems, including without limitation.

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드는 효모 내에서 재조합 방식으로 발현된다. In certain embodiments, the polypeptide comprising one or more ABP ingredient or ABP itself is expressed by recombinant methods in yeast. 특정 그러한 실시태양은 상업상 이용가능한 발현 시스템, 예를 들어, 피치아 ( Pichia ) 발현 시스템 (인비트로겐 (Invitrogen, 미국 캘리포니아주 샌디에고))을 제조사의 지시에 따라 사용한다. Certain such embodiments uses a commercially available expression system, for example, avoid the teeth (Pichia) expression system (Invitrogen (Invitrogen, San Diego, Calif.)) According to the manufacturer's instructions. 특정 실시태양에서, 그러한 시스템은 분비를 지시하기 위해 프레-프로-알파 서열에 의존한다. In certain embodiments, such a system frame to indicate the secretion-sequence depends on the alpha-Pro. 특정 실시태양에서, 삽입체의 전사는 메탄올에 의한 유도 시에 알콜 옥시다제 (AOX1) 프로모터에 의해 작동된다. In certain embodiments, transcription of the insert is driven by the alcohol oxidase (AOX1) promoter upon induction by methanol.

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 분비된 폴리펩티드는 효모 성장 배지로부터 정제된다. In certain embodiments, a secreted polypeptide comprising one or more ABP ingredient or ABP itself is purified from the yeast growth medium. 특정 실시태양에서, 효모 성장 배지로부터 폴리펩티드를 정제하기 위해 사용되는 방법은 세균 및 포유동물 세포 상등액으로부터 폴리펩티드를 정제하기 위해 사용된 것과 동일하다. In certain embodiments, the methods used to purify the polypeptide from yeast growth medium is the same as that used to purify the polypeptide from bacterial and mammalian cell supernatants.

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드를 코딩하는 핵산이 바큘로바이러스 발현 벡터, 예를 들어 pVL1393 (파밍겐 (PharMingen, 미국 캘리포니아주 샌 디에고)) 내에 클로닝된다. In certain embodiments, a nucleic acid encoding a polypeptide comprising one or more ABP ingredient or ABP itself baculovirus virus expression vector, for example, be cloned into pVL1393 (Pharmingen Gen (PharMingen, San Diego, Calif.)). 특정 실시태양에서, 그러한 벡터는 sF9 단백질-미함유 배지에서 스포돕테라 프루기페르다 ( Spodoptera frugiperda ) 세포를 감염시키고 재조합 폴리펩티드를 생산하기 위해 제조사 (파밍겐)의 지시에 따라 사용될 수 있다. In a specific embodiment, such vectors are sF9 protein may be used according to the manufacturer's instructions (Pharmingen gen) for TB-free sports program to help in the medium rugi Pere (Spodoptera frugiperda) infected cells and to produce a recombinant polypeptide. 특정 실시태양에서, 폴리펩티드는 헤파린-세파로스 컬럼 (파마시아 (Pharmacia))을 사용하여 상기 배지로부터 정제되고 농축된다. In certain embodiments, the polypeptide is a heparin-purified and concentrated from the culture medium by using the three Sepharose column (Pharmacia (Pharmacia)).

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드는 곤충 시스템에서 발현된다. In certain embodiments, the polypeptide comprising one or more ABP ingredient or ABP itself is expressed in an insect system. 폴리펩티드 발현을 위한 특정 곤충 시스템은 당업자에게 잘 공지되어 있다. Certain insect systems for polypeptide expression are well known to those skilled in the art. 하나의 그러한 시스템에서, 오토그라파 칼리포르니카 ( Autographa californica ) 핵 폴리헤드론 형성 바이러스 (AcNPV)가 스포돕테라 프루기페르다 세포 또는 트리코플루시아 라르바에 ( Trichoplusia larvae )에서 외래 유전자를 발현하기 위한 벡터로서 사용된다. In one such system, Autographa potassium formate Danica (Autographa californica) Ron nuclear polyhedra formed virus (AcNPV) is Spokane helping Terra frugiperda cells or tricot Flu Asia Arar bar (Trichoplusia larvae) for expressing foreign genes in It is used as a vector. 특정 실시태양에서, 폴리펩티드를 코딩하는 핵산 분자를 바이러스의 비필수 유전자 내로, 예를 들어 폴리헤드린 유전자 내에 삽입하고, 이 유전자에 대한 프로모터의 제어 하에 놓을 수 있다. In a specific embodiment, it is possible to insert the nucleic acid molecule encoding the polypeptide into a non-essential gene in a virus, such as the polyhedrin gene, and placed under control of the promoter for the gene. 특정 실시태양에서, 핵산 분자가 성공적으로 삽입되면, 비필수 유전자는 불활성화될 것이다. In a specific embodiment, when nucleic acid molecules are successfully inserted, non-essential genes will be inactivated. 특정 실시태양에서, 불활성화는 검출가능한 특징을 생성시킨다. In certain embodiments, the inactivation results in a detectable characteristic. 예를 들어, 폴리헤드린 유전자의 불활성화는 코트 단백질의 생산이 결여된 바이러스를 생산시킨다. For example, inactivation of the polyhedrin gene, thereby producing the production of virus lacking coat protein.

특정 실시태양에서, 재조합 바이러스가 에스. In certain embodiments, the recombinant virus S. 프루기페르다 세포 또는 트리코플루시아 라르바에를 감염시키기 위해 사용될 수 있다 (예를 들어, 문헌 [Smith et al., J. Virol., 46: 584 (1983)]; 및 [Engelhard et al., Proc. Nat. Acad. Sci. (USA), 91: 3224-7 (1994)] 참조). Frugiperda can be used to infect cells or tricot flu cyano L'bar (see, e.g., [Smith et al, J. Virol, 46:.. 584 (1983)]; and [Engelhard et al,. .... proc Nat Acad Sci (USA), 91: 3224-7 (1994)], see).

특정 실시태양에서, 세균 세포에서 생산된 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드는 세균 내에서 불용성 봉입체로서 생산된다. In certain embodiments, the polypeptide comprising one or more ABP ingredient or ABP itself produced in bacterial cells are produced as insoluble inclusion bodies in the bacteria. 특정 실시태양에서, 그러한 봉입체를 포함하는 숙주 세포는 원심분리에 의해 수거하고; In certain embodiments, host cells comprising such inclusion bodies are collected by centrifugation, and; 0.15 M NaCl, 10 mM Tris (pH 8), 1 mM EDTA 내에서 세척하고; 0.15 M NaCl, 10 mM Tris (pH 8), and washed in 1 mM EDTA; 0.1 mg/ml 리소자임 (시그마 (Sigma, 미국 미주리주 세인트루이스))으로 15분 동안 실온에서 처리한다. 0.1 mg / ml lysozyme (Sigma (Sigma, St. Louis, Missouri, USA)) is treated at room temperature for 15 minutes. 특정 실시태양에서, 용해액을 초음파 처리에 의해 투명하게 만들고, 세포 파쇄물을 12,000 X g에서 10분 동안 원심분리에 의해 펠렛화시킨다. In certain embodiments, creating the solution transparently by sonication, the cell debris then pelleted by centrifugation at 12,000 X g for 10 minutes. 특정 실시태양에서, 폴리펩티드-함유 펠렛을 50 mM Tris (pH 8) 및 10 mM EDTA 내에 재현탁하고; In certain embodiments, the polypeptide-containing pellet reproduced in 50 mM Tris (pH 8) and 10 mM EDTA and suspended; 50% 글리세롤 상에 적층하고; And layered on a 50% glycerol; 6000 X g에서 30분 동안 원심분리한다. 6000 centrifuge for 30 minutes at X g. 특정 실시태양에서, 펠렛은 Mg ++ 및 Ca ++ 가 존재하지 않는 표준 포스페이트 완충 염수 용액 (PBS) 내에 재현탁시킬 수 있다. In certain embodiments, the pellets can be resuspended in Ca ++ and Mg ++ is absent standard phosphate buffered saline solution (PBS). 특정 실시태양에서, 폴리펩티드는 재현탁시킨 펠렛을 변성 SDS 폴리아크릴아미드 겔에서 분획화함으로써 추가로 정제된다 (예를 들어, 문헌 [Sambrook et al., 상기 문헌] 참조). In certain embodiments, the polypeptide is further purified by a screen fraction pellet resuspended in modified SDS-polyacrylamide gel (for example, literature [Sambrook et al., Supra). 특정 실시태양에서, 상기 겔은 단백질을 가시화하기 위해 0.4 M KCl에 담글 수 있고, 이를 절제하여 SDS가 결여된 겔 전개 버퍼 내에서 전기용출시킬 수 있다. In certain embodiments, the gel may be immersed in 0.4 M KCl to visualize the protein, it is possible to electric elution in the SDS gel lacking deployment buffer excised it. 특정 실시태양에 따라, 글루타티온-S-트랜스퍼라제 (GST) 융합 단백질이 세균 내에서 가용성 단백질로서 생산된다. Depending on the specific embodiment, this -S- glutathione transferase (GST) fusion protein is produced as a soluble protein within the bacteria. 특정 실시태양에서, 상기 GST 융합 단백질은 GST 정제 모듈 (파마시아)을 사용하여 정제된다. In certain embodiments, the GST fusion proteins are purified using a GST Purification Module (Pharmacia).

특정 실시태양에서, 특정 폴리펩티드, 예를 들어, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드를 "재폴딩하는" 것이 바람직하다. In certain embodiments, a particular polypeptide, for example, the "re-folded" a polypeptide comprising one or more ABP ingredient or ABP itself is preferred. 특정 실시태양에서, 그러한 폴리펩티드는 본원에서 논의된 특정 재조합 시스템을 사용하여 생산된다. In certain embodiments, such polypeptides are produced using certain recombinant systems discussed herein. 특정 실시태양에서, 폴리펩티드는 목적하는 3차 구조의 형성 및/또는 디술피드 연결의 생성을 위해 "재폴딩"되고/되거나 산화된다. In certain embodiments, the polypeptide is "re-folded" and / or oxide to the generation of three-dimensional structure formation and / or disulfide connectivity desired. 특정 실시태양에서, 상기 구조 및/또는 연결은 폴리펩티드의 특정 생물학적 활성에 관련된다. In certain embodiments, the structure and / or the connection is associated with a specific biological activity of the polypeptide. 특정 실시태양에서, 재폴딩은 당업계에 공지된 임의의 많은 절차를 사용하여 달성된다. In a specific embodiment, the re-folding is accomplished using any number of procedures known in the art. 예시적인 방법은 가용화된 폴리펩티드 물질을 무질서유발제 (chaotropic agent)의 존재 하에 대개 7을 넘는 pH에 노출시키는 것을 포함하고 이로 제한되지 않는다. An exemplary method involves exposure to more than 7, usually in the presence of a disorder of the solubilized polypeptide inducer substance (chaotropic agent) and pH are not limited. 예시적인 무질서유발제는 구아니딘이다. An exemplary disorder inducer is a guanidine. 특정 실시태양에서, 재폴딩/산화 용액은 또한 환원제 및 상기 환원제의 산화 형태를 함유한다. In a specific embodiment, the re-folding / oxidation solution will also contain an oxidized form of the reducing agent and the reducing agent. 특정 실시태양에서, 환원제 및 그의 산화된 형태는 디술피드 셔플링 (shuffling)이 일어나도록 하는 특정 레독스 전위를 생성시킬 비율로 존재한다. In certain embodiments, the reducing agent and its oxidized form are present in a ratio to generate a particular redox potential which raise up the disulfide shuffling (shuffling). 특정 실시태양에서, 그러한 셔플링은 시스테인 다리의 형성을 가능하게 한다. In certain embodiments, such shuffling allows the formation of cysteine ​​bridges. 예시적인 레독스 커플은 시스테인/시스타민, 글루타티온/디티오비스GSH, 염화제2구리, 디티오트레이톨 DTT/디티안 DTT, 및 2-머캅토에탄올 (bME)/디티오-bME를 포함하고 이로 제한되지 않는다. Exemplary redox couples include cysteine ​​/ cystamine, glutathione / dithiobis GSH, cupric chloride, dithiothreitol DTT / dithiane DTT, and 2-mercaptoethanol (bME) / dithio -bME which not limited. 특정 실시태양에서, 공용매가 재폴딩의 효율을 증가시키기 위해 사용된다. In certain embodiments, the co-solvent is used to increase the efficiency of re-folding. 예시적인 공용매는 글리세롤, 다양한 분자량의 폴리에틸렌 글리콜, 및 아르기닌을 포함하고 이로 제한되지 않는다. Exemplary co-solvents include glycerol, polyethylene glycol of various molecular weights, and arginine and without limitation.

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드를 실질적으로 정제한다. In a particular embodiment, the substantially purified polypeptide comprising one or more ABP or ABP ingredient itself. 특정 단백질 정제 기술은 당업자에게 공지되어 있다. Specific protein purification techniques are known to those skilled in the art. 특정 실시태양에서, 단백질 정제는 비-폴리펩티드 분획으로부터 폴리펩티드 분획의 조질 분획화를 포함한다. In certain embodiments, the purified protein is a non-crude fractionation of the polypeptide and a polypeptide fraction from the fraction. 특정 실시태양에서, 폴리펩티드는 크로마토그래피 및/또는 전기영동 기술을 이용하여 정제한다. In certain embodiments, the polypeptide is purified using chromatographic and / or electrophoretic techniques. 예시적인 정제 방법은 황산암모늄을 사용한 침전; Exemplary purification methods are precipitation with ammonium sulfate; PEG를 사용한 침전; Precipitation with PEG; 면역침전; Immunoprecipitation; 열 변성, 이어서 원심분리; Heat denaturation, followed by centrifugation; 친화도 크로마토그래피 (예를 들어, 단백질-A-세파로스), 이온 교환 크로마토그래피, 배제 크로마토그래피, 및 역상 크로마토그래피를 포함하고 이로 제한되지 않는 크로마토그래피; Affinity chromatography (e. G., Protein -A--Sepharose), ion exchange chromatography, exclusion chromatography, and chromatography including reverse phase chromatography and is not limited thereto; 겔 여과; Gel filtration; 히드록시아파타이트 크로마토그래피; Hydroxyapatite chromatography; 등전 포커싱 (isoelectric focusing); Isoelectric focusing (isoelectric focusing); 폴리아크릴아미드 겔 전기영동; Polyacrylamide gel electrophoresis; 및 상기 및 다른 기술의 조합을 포함하고 이로 제한되지 않는다. And it does not comprise a combination of these and other techniques are limited. 특정 실시태양에서, 폴리펩티드는 신속한 단백질 액체 크로마토그래피 또는 고압 액체 크로마토그래피 (HPLC)에 의해 정제된다. In certain embodiments, the polypeptide is purified by fast protein liquid chromatography or high pressure liquid chromatography (HPLC). 특정 실시태양에서, 정제 단계는 변화될 수 있거나, 특정 단계가 생략될 수 있고, 실질적으로 정제된 폴리펩티드의 제조를 위한 적합한 방법을 계속 수행할 수 있다. In certain embodiments, purification steps may be changed, and certain steps may be omitted, it is possible to continue with the method appropriate for the manufacture of a substantially purified polypeptide.

특정 실시태양에서, 폴리펩티드 제제의 정제 정도를 정량한다. In certain embodiments, the amount the amount of purified polypeptide preparation. 정제 정도를 정량하기 위한 특정 방법은 당업자에게 공지되어 있다. Specific methods for quantifying the degree of purification are known to those skilled in the art. 특정한 예시적인 방법은 제제의 특이적 결합 활성의 결정, 및 SDS/PAGE 분석에 의한 제제 내의 폴리펩티드의 양의 평가를 포함하고 이로 제한되지 않는다. Particular illustrative method includes the evaluation of the amount of the polypeptide in the preparation according to the determination, and SDS / PAGE analysis of the specific binding activity of the formulation and not so limited. 폴리펩티드 제제의 정제 양을 평가하기 위한 특정한 예시적인 방법은 제제의 결합 활성을 계산하고 이를 초기 추출물의 결합 활성에 비교하는 것을 포함한다. Specific exemplary method for assessing the amount of purification of a polypeptide preparation comprise calculating the binding activity of a preparation and comparing it to the binding activity of the initial extract. 특정 실시태양에서, 상기 계산의 결과는 "정제 배수"로서 표현된다. In certain embodiments, the result of the calculation is represented as "purified drainage". 결합 활성의 양을 나타내기 위해 사용되는 단위는 수행된 특정 분석에 따라 결정된다. The units used to represent the amount of binding activity is determined according to the specific analysis performed.

특정 실시태양에서, 하나 이상의 ABP 성분 또는 ABP 자체를 포함하는 폴리펩티드는 부분적으로 정제된다. In certain embodiments, the polypeptide comprising one or more ABP ingredient or ABP itself is partially purified. 특정 실시태양에서, 부분 정제는 보다 적은 정제 단계를 사용하거나 동일한 일반적인 정제 계획의 상이한 형태를 사용하여 달성할 수 있다. In a specific embodiment, the part purification can be achieved by using different types of using less purification steps or to the same general purification scheme. 예를 들어, 특정 실시태양에서, HPLC 장치를 사용하여 수행되는 양이온 교환 컬럼 크로마토그래피는 일반적으로 저압 크로마토그래피 시스템을 사용하는 동일한 기술보다 더 큰 "정제 배수"를 생성시킬 것이다. For example, in certain embodiments, the cation-exchange column chromatography performed using an HPLC apparatus will generally be produced larger "purified drain" than the same technique of using a low pressure chromatography system. 특정 실시태양에서, 보다 낮은 정도의 정제를 일으키는 방법은 폴리펩티드의 총 회수, 또는 폴리펩티드의 결합 활성 유지에 있어서 잇점을 가질 수 있다. In a specific embodiment, the method causes a lower degree of purification may have advantages in total recovery, or maintaining binding activity of the polypeptide of the polypeptide.

특정 예에서, 폴리펩티드의 전기영동 이동은 상이한 조건의 SDS/PAGE를 이용하여 때때로 유의하게 변할 수 있다 (예를 들어, 문헌 [Capaldi et al., Biochem. Biophys. Res. Comm., 76: 425 (1977)] 참조). In certain instances, the electrophoretic migration of a polypeptide can sometimes significantly vary using the SDS / PAGE of the different conditions (see, e.g., [Capaldi et al, Biochem Biophys Res Comm, 76:..... 425 ( 1977) reference). 상이한 전기영동 조건 하에서, 정제된 또는 부분 정제된 폴리펩티드의 겉보기 분자량이 상이할 수 있음이 이해될 것이다. Under different electrophoresis conditions, the apparent molecular weight will be in the purified or partially purified polypeptide understood that the same may be different.

예시적인 에피토프 Exemplary epitopes

항-PCSK9 항체가 결합하는 에피토프를 제공한다. It provides an epitope that binds an antibody, wherein -PCSK9. 일부 실시태양에서, 본원에 개시된 항체가 결합하는 에피토프가 특히 유용하다. In some embodiments, the epitope to which antibodies bind as disclosed herein is particularly useful. 일부 실시태양에서, 본원에 기재된 항체가 결합하는 임의의 에피토프에 결합하는 항원 결합 단백질이 유용하다. In some embodiments, useful are antigen binding proteins that bind to any epitope of the antibody binding described herein. 일부 실시태양에서, 표 2와 도 2 및 3에 나열된 임의의 항체가 결합하는 에피토프가 특히 유용하다. In some embodiments, the epitope that binds any of the antibodies listed in Figures 2 and 3 in Table 2 is particularly useful. 일부 실시태양에서, 에피토프는 PCSK9의 촉매 도메인 상에 존재한다. In some embodiments, the epitope is present on the catalytic domain of PCSK9.

특정 실시태양에서, PCSK9 에피토프는 항-PCSK9 항체 또는 PCSK9에 대한 항원 결합 단백질의 결합을 방지하기 (예를 들어, 감소시키기) 위해 사용될 수 있다. In certain embodiments, PCSK9 epitope can be used to prevent the binding of the antigen binding protein to the anti-antibody or -PCSK9 PCSK9 (e. G. To, reduced). 특정 실시태양에서, PCSK9 에피토프는 항-PCSK9 항체 또는 PCSK9에 대한 항원 결합 단백질의 결합을 감소시키기 위해 사용될 수 있다. In certain embodiments, PCSK9 epitope can be used to reduce the binding of the antigen binding protein to the anti-antibody or -PCSK9 PCSK9. 특정 실시태양에서, PCSK9 에피토프는 항-PCSK9 항체 또는 PCSK9에 대한 항원 결합 단백질의 결합을 실질적으로 억제하기 위해 사용될 수 있다. In certain embodiments, PCSK9 epitopes may be used to substantially inhibit the binding of the antigen binding protein to the anti-antibody or -PCSK9 PCSK9.

특정 실시태양에서, PCSK9 에피토프는 PCSK9에 결합하는 항체 또는 항원 결합 단백질을 단리하기 위해 사용될 수 있다. In certain embodiments, PCSK9 epitope can be used to isolate the antibody or antigen-binding proteins that bind to PCSK9. 특정 실시태양에서, PCSK9 에피토프는 PCSK9에 결합하는 항체 또는 항원 결합 단백질을 생성하기 위해 사용될 수 있다. In certain embodiments, PCSK9 epitope can be used to produce an antibody or antigen-binding proteins that bind to PCSK9. 특정 실시태양에서, PCSK9 에피토프 또는 PCSK9 에피토프를 포함하는 서열은 PCSK9에 결합하는 항체 또는 항원 결합 단백질을 생성하기 위해 면역원으로서 사용될 수 있다. In certain embodiments, the sequence comprising an epitope PCSK9 or PCSK9 epitope can be used as immunogens to produce an antibody or antigen-binding proteins that bind to PCSK9. 특정 실시태양에서, PCSK9 에피토프는 동물에게 투여될 수 있고, PCSK9에 결합하는 항체를 후속적으로 동물로부터 얻을 수 있다. In certain embodiments, PCSK9 epitope can be administered to an animal, it is possible to obtain an antibody binding to PCSK9 subsequently from the animal. 특정 실시태양에서, PCSK9 에피토프 또는 PCSK9 에피토프를 포함하는 서열은 정상적인 PCSK9-매개 활성, 예를 들어 PCSK9와 LDLR의 회합을 저해하기 위해 사용될 수 있다. In certain embodiments, the sequence comprising an epitope PCSK9 or PCSK9 epitopes include, for normal PCSK9- mediated activity, for example, may be used to inhibit the association of PCSK9 and LDLR.

일부 실시태양에서, 본원에 개시된 항원 결합 단백질은 N-말단 프로도메인, 섭틸리신-유사 촉매 도메인 및/또는 C-말단 도메인에 특이적으로 결합한다. In some embodiments, the antigen binding protein described herein is N- terminal pro domain, Sup Tilly Shin-engage with similar catalytic domain and / or specific for C- terminal domain. 일부 실시태양에서, 항원 결합 단백질은 PCSK-9의 기질 결합 그루브에 결합한다 (그 전문을 본원에 참조로 포함시킨 문헌 [Cunningham et al.]에 설명됨). In some embodiments, the antigen binding protein is coupled to the substrate binding groove of PCSK-9 (to be described in that literature [Cunningham et al.] Including its entirety herein by reference).

일부 실시태양에서, 항체와 접촉하거나 항체에 의해 묻히는 잔기를 함유하는 도메인(들)/구역(들)은 PCSK9 (예를 들어, 야생형 항원) 내의 특이적인 잔기를 돌연변이시키고 항원 결합 단백질이 돌연변이된 또는 변이체 PCSK9 단백질에 결합할 수 있는지 여부를 결정함으로써 확인할 수 있다. In some embodiments, the domain in contact with an antibody or containing buried residues by the antibody (s) / region (s) are PCSK9 mutants a specific residue in the (e. G., Wild-type antigen) and an antigen binding protein mutation or It can be identified by determining whether it can bind to the mutant PCSK9 protein. 많은 개별 돌연변이를 형성함으로써, 결합에서 직접적인 역할을 수행하거나, 돌연변이가 항원 결합 단백질과 항원 사이의 결합에 영향을 미칠 수 있도록 항체와 충분하게 근접하는 잔기를 확인할 수 있다. By forming a number of distinct mutations, it does play a direct role in binding, or mutations may be found with the antibody residues that sufficient proximity to affect the coupling between the antigen binding protein to the antigen. 이들 아미노산에 대한 정보로부터, 항원 결합 단백질과 접촉하거나 항체에 의해 덮이는 잔기를 함유하는 항원의 도메인(들) 또는 구역(들)이 설명될 수 있다. From about amino acid thereof, is in contact with the antigen-binding protein, or covered by the antibody has a domain (s) or zone (s) of the antigen-containing moiety may be described. 그러한 도메인은 항원 결합 단백질의 결합 에피토프를 포함할 수 있다. Such domain may include a combination epitope of the antigen binding proteins. 상기 일반적인 방법의 하나의 특정한 예에서는 아르기닌/글루탐산 스캐닝 프로토콜을 이용한다 (예를 들어, [Nanevicz, T., et al., 1995, J. Biol. Chem., 270:37, 21619-21625] 및 [Zupnick, A., et al., 2006, J. Biol. Chem., 281:29, 20464-20473] 참조). In one specific example of the general method utilizes the arginine / glutamic acid scanning protocols (e.g., [Nanevicz, T., et al, 1995, J. Biol Chem, 270:... 37, 21619-21625] and [ . Zupnick, A., et al, 2006, J. Biol Chem, 281:.. 29, see 20464-20473). 일반적으로, 아르기닌 및 글루탐산은 야생형 폴리펩티드 내의 아미노산을 치환하고 (대개 개별적으로), 이는 이들 아미노산이 전하를 띄고 부피가 커서 돌연변이가 도입되는 항원의 구역에서 항원 결합 단백질과 항원 사이의 결합을 파괴할 가능성을 갖기 때문이다. Typically, arginine and glutamic acid is an antigen from the area of ​​the antigen, and replacing the amino acid in the wild-type polypeptide (typically individually), which cursor is the volume mutations are introduced into these amino acids and bears an electric charge coupled likely to destroy the bond between the protein and the antigen because to have a. 야생형 항원 내에 존재하는 아르기닌은 글루탐산으로 교체된다. Arginine present in wild-type antigen is replaced by glutamic acid. 다양한 그러한 개별 돌연변이체를 얻고, 수집한 결합 결과를 결합에 영향을 미치는 잔기를 결정하기 위해 분석한다. Obtain a wide range of those individual mutant and analyzed to determine the residues that influence the binding results collected in the combination.

실시예 39에서는 본원에서 제공되는 PCSK9 항원 결합 단백질에 대한 PCSK9의 하나의 그러한 아르기닌/글루탐산 스캐닝을 설명한다. Example 39 describes the one that arginine / glutamic acid scanning of PCSK9 on PCSK9 antigen binding protein provided herein. 일련의 돌연변이체 PCSK9 항원을 생성시키고, 여기서 각각의 돌연변이체 항원은 단일 돌연변이를 가졌다. Creating a series of mutant PCSK9 antigen and wherein each of the mutant antigen had a single mutation. 다양한 PCSK9 ABP에 대한 각각의 돌연변이체 PCSK9 항원의 결합을 측정하고, 야생형 PCSK9 (서열 303)에 결합하는 선택된 ABP의 능력에 비교하였다. Measuring the binding of each mutant PCSK9 antigen for various PCSK9 ABP and compared to the ability of the selected ABP binding to wild-type PCSK9 (SEQ ID NO: 303).

항원 결합 단백질과 변이체 PCSK9 사이의 결합의 변경 (예를 들어 감소 또는 증가)은 본원에서 사용될 때 항원 결합 단백질의 결합 친화도의 변화 (예를 들어, 하기 실시예에서 설명되는 비아코어 시험 또는 비드 기반 분석과 같은 공지의 방법에 의해 측정시에), EC 50 의 변화, 및/또는 총 결합 용량의 변화 (예를 들어 감소) (예를 들어, 항원 결합 단백질 농도 대 항원 농도의 그래프에서 Bmax의 감소로 입증됨)가 존재함을 의미한다. Changing the coupling between the antigen-binding protein and the mutant PCSK9 (e.g. increase or decrease) when used herein, change of the binding affinity of the antigen binding proteins (e. G., Vias described in the Examples core test or bead-based notice how changes in, EC 50 at the time of measurement) by the same and analysis, and / or a change (e. g. reduction of the total binding capacity) (e. g., reduction in the Bmax in a graph of the antigen binding protein concentration versus antigen concentration It means that the search proved to be) present. 결합의 유의한 변경은 돌연변이된 잔기가 항원 결합 단백질에 대한 결합에 직접 관여되거나, 결합 단백질이 항원에 결합될 때 결합 단백질에 근접하게 존재함을 나타낸다. A significant change in binding the mutated residues are directly involved in the binding to an antigen binding protein, it indicates that the binding protein is present in close proximity to the binding protein when it binds to the antigen.

일부 실시태양에서, 결합의 유의한 감소는 항원 결합 단백질과 돌연변이체 PCSK9 항원 사이의 결합 친화도, EC50, 및/또는 용량이 항원 결합 단백질과 야생형 PCSK9 (예를 들어, 서열 1 및/또는 서열 303에 제시된) 사이의 결합에 비해 10% 초과, 20% 초과, 40% 초과, 50% 초과, 55% 초과, 60% 초과, 65% 초과, 70% 초과, 75% 초과, 80% 초과, 85% 초과, 90% 초과 또는 95% 초과로 감소됨을 의미한다. In some embodiments, a significant reduction in binding is antigen-binding protein and mutant binding affinity between PCSK9 antigen, EC50, and / or the antigen-binding capacity of proteins and wild-type PCSK9 (e.g., SEQ ID NO: 1 and / or SEQ ID NO: 303 to greater than 10% as compared to the bond between the indicated), 20%, greater than 40%, greater than 50%, greater than 55%, greater than 60%, greater than 65%, greater than 70%, greater than 75%, greater than 80%, greater than 85% exceeded, means decreased by more than 90% or more than 95%. 특정 실시태양에서, 결합은 검출가능한 한계 미만으로 감소된다. In certain embodiments, the binding is reduced to less than the detectable limit. 일부 실시태양에서, 결합의 유의한 감소는 변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합이 항원 결합 단백질과 야생형 PCSK9 단백질 (예를 들어, 서열 1 및/또는 서열 303의 단백질) 사이에서 관찰되는 결합의 50% 미만 (예를 들어, 40%, 35%, 30%, 25%, 20%, 15% 또는 10% 미만)일 때 입증된다. The bond is observed between in some embodiments, a significant reduction in the bond mutant PCSK9 binding of the antigen binding protein to the protein is an antigen-binding protein and the wild-type PCSK9 protein (e.g., SEQ ID NO: 1 and / or the protein of SEQ ID NO: 303) less than 50% (e.g., 40%, 35%, 30%, 25%, 20%, less than 15% or 10%) is demonstrated when the. 그러한 결합 측정은 당업계에 공지된 다양한 결합 분석을 이용하여 이루어질 수 있다. Such binding measurements can be made using the analysis of a variety of known coupling in the art. 하나의 그러한 분석의 구체적인 예를 실시예 39에 설명한다. It will be described one specific example of such an analysis in Example 39.

일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303) 내의 잔기가 아르기닌 또는 글루탐산으로 치환된, 변이체 PCSK9 단백질에 대한 유의하게 더 낮은 결합을 보이는 항원 결합 단백질을 제공한다. In some embodiments, provides a wild-type PCSK9 proteins exhibit significantly lower binding to the moiety in the (e. G., SEQ ID NO: 1 or SEQ ID NO: 303) substituted for arginine or glutamic acid, mutant PCSK9 protein antigen-binding protein. 일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해 돌연변이 R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, E582R, D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, 및 Q554R 중 임의의 하나 이상 (예를 들어 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 또는 244)을 갖는 변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합은 유의하게 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein mutation R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, E582R, D162R, R164E relative to (e. G., SEQ ID NO: 1 or SEQ ID NO: 303), E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and any one or more of Q554R (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 244) a variant combining the antigen binding protein to the protein having PCSK9 is significantly decreased or increased. 본원에서 사용되는 약칭 표기에서, 형식은 야생형 잔기: 폴리펩티드 내의 위치: 돌연변이체 잔기이고, 여기서 잔기의 넘버링은 서열 1 또는 서열 303에서 표시된 바와 같다. In abbreviated notation used herein, the format is the wild-type residue: position in the polypeptide: and mutant residue, wherein the residue numbering is as shown in SEQ ID NO: 1 or SEQ ID NO: 303.

일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1에 제시된 위치 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554에서 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 이상)의 돌연변이를 갖는 돌연변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합은 유의하게 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein compared to (e. G., SEQ ID NO: 1 or SEQ ID NO: 303), the position shown in SEQ ID NO: 1, 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413 , mutants having a mutation of the 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and more 1-554 (e.g., one, two, three, four, five or more) binding of antigen-binding protein for the body PCSK9 protein is significantly decreased or increased. 일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1에 제시된 위치 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554에서 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 이상)의 돌연변이를 갖는 돌연변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합은 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein compared to (e. G., SEQ ID NO: 1 or SEQ ID NO: 303), the position shown in SEQ ID NO: 1, 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413 , mutants having a mutation of the 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and more 1-554 (e.g., one, two, three, four, five or more) binding of antigen-binding protein for the body PCSK9 protein is decreased or increased. 일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1 내에서 위치 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554에서 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 이상)의 돌연변이를 갖는 돌연변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합은 실질적으로 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein (e.g., SEQ ID NO: 1 or SEQ ID NO: 303), and position 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413 in SEQ ID NO: 1 compared , mutants having a mutation of the 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and more 1-554 (e.g., one, two, three, four, five or more) binding of antigen-binding protein for the body PCSK9 protein is substantially reduced or increased.

일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1 또는 서열 303 내에서 돌연변이 R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, E582R, D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, 및 Q554R 중 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 등)을 갖는 돌연변이체 PCSK9 단백질에 대한 ABP의 결합은 유의하게 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein (e.g., SEQ ID NO: 1 or SEQ ID NO: 303), mutations in SEQ ID NO: 1 or SEQ ID NO: 303 R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R than, mutant having A413R, E582R, D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and Q554R one or more (e.g., one, two, three, four, five, etc.) form ABP binding of PCSK9 protein is to be significantly reduced or increased.

일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1 또는 서열 303 내에서 돌연변이 R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R, A413R, 및 E582R 중 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 등)을 갖는 돌연변이체 PCSK9 단백질에 대한 ABP의 결합은 유의하게 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein (e.g., SEQ ID NO: 1 or SEQ ID NO: 303), mutations in SEQ ID NO: 1 or SEQ ID NO: 303 R207E, D208R, R185E, R439E, E513R, V538R, E539R, T132R, S351R, A390R than, the combination of ABP for the mutant PCSK9 protein having at least one of A413R, and E582R (e.g., one, two, three, four, five, etc.) is significantly decreased or increased. 일부 실시태양에서, 결합은 감소한다. In some embodiments, the combination is reduced. 일부 실시태양에서, 결합의 감소는 EC50의 변화로서 관찰된다. In some embodiments, the reduction in binding is observed as a change in EC50. 일부 실시태양에서, EC50의 변화는 EC50의 수치값의 증가이다 (따라서 결합의 감소이다). In some embodiments, the change in the EC50 (the reduction of thus combining) the increase of the numerical value of EC50.

일부 실시태양에서, 야생형 PCSK9 단백질 (예를 들어, 서열 1 또는 서열 303)에 비해, 서열 1 내에서 돌연변이 D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, 및 Q554R 중 하나 이상 (예를 들어, 1, 2, 3, 4, 5개 등)을 갖는 돌연변이체 PCSK9 단백질에 대한 ABP의 결합은 유의하게 감소하거나 증가한다. In some embodiments, the wild-type PCSK9 protein (e.g., SEQ ID NO: 1 or SEQ ID NO: 303), SEQ ID NO: 1 within the mutation D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and Q554R in than in the combination of ABP for the mutant PCSK9 protein having one or more (e.g., one, two, three, four, five, etc.) is significantly decreased or increased. 일부 실시태양에서, 결합은 감소한다. In some embodiments, the combination is reduced. 일부 실시태양에서, 결합의 감소는 Bmax의 변화로서 관찰된다. In some embodiments, the reduction in binding is observed as a change in Bmax. 일부 실시태양에서, Bmax의 이동은 ABP에 의해 생성된 최대 신호의 감소이다. In some embodiments, the movement of Bmax is a reduction in the maximum signal generated by the ABP. 일부 실시태양에서, 에피토프의 일부인 아미노산에 대해, Bmax는 적어도 10% 감소하고, 예를 들어, 적어도 임의의 다음의 양: 20, 30, 40, 50, 60, 70, 80, 90, 95, 98, 99, 또는 100%의 감소는 일부 실시태양에서 잔기가 에피토프의 일부임을 나타낸다. In some embodiments, for a part of amino acids epitope, Bmax is reduced at least 10%, for example, at least any of the following amounts: 20, 30, 40, 50, 60, 70, 80, 90, 95, 98 , 99, or 100% reduction indicates that the residue is part of the epitope in some embodiments.

지금 나열한 변이체 형태는 서열 1 또는 서열 303에 제시된 야생형 서열에 관하여 언급하지만, PCSK9의 대립유전자 변이체에서 지시된 위치의 아미노산이 다를 수 있음을 알 것이다. Now listed mutant form is mentioned with respect to the wild type sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 303. However, it will be appreciated that the amino acid of the position indicated on the allelic variants of PCSK9 be different. 그러한 대립유전자 형태의 PCSK9에 대한 유의하게 보다 낮은 결합을 보이는 항원 결합 단백질이 또한 고려된다. Such antagonistic antigen seems to be significantly lower than the binding to PCSK9 gene in the form of binding protein are also contemplated. 따라서, 일부 실시태양에서, 임의의 상기 실시태양은 순수하게 도 1a에 제시된 야생형 서열보다는 대립유전자 서열에 비교될 수 있다. Thus, in some embodiments, any of the above embodiments may be compared to the allele sequence than the wild type sequence set forth in Figure 1a purely.

일부 실시태양에서, 야생형 PCSK9 단백질 내의 선택된 위치에서 잔기가 임의의 다른 잔기로 돌연변이되는 변이체 PCSK9 단백질에 대한 항원 결합 단백질의 결합은 유의하게 감소한다. In some embodiments, the wild-type combination of PCSK9 antigen binding to the mutant PCSK9 protein moiety is mutated to any other residue at a selected position in the protein, the protein will be significantly reduced. 일부 실시태양에서, 본원에 설명된 아르기닌/글루탐산 교체가 확인된 위치에 대해 사용된다. In some embodiments, it is used for the the arginine / glutamic acid replacement described herein determine position. 일부 실시태양에서, 알라닌이 확인된 위치에 대해 사용된다. In some embodiments, an alanine is used for position confirmation.

상기 주지한 바와 같이, 항원 결합 단백질과의 결합에 직접 관여하거나 그에 의해 덮이는 잔기는 스캐닝 결과로부터 확인될 수 있다. As noted above, the moiety is directly involved in the binding of the antigen binding proteins, or covered by it it can be identified from the scanning result. 따라서, 이들 잔기는 항원 결합 단백질이 결합하는 결합 구역(들)을 함유하는 서열 1 (또는 서열 303 또는 서열 3)의 도메인 또는 구역을 표시할 수 있다. Accordingly, these residues may display a domain or region of SEQ ID NO: 1 (or SEQ ID NO: 303 or SEQ ID NO: 3) containing the binding region (s) the binding of the antigen binding proteins. 실시예 39에 요약된 결과에서 알 수 있는 바와 같이, 일부 실시태양에서 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554 중 적어도 하나를 함유하는 도메인에 결합한다. Performed As can be seen from the summarized results are shown in Example 39, the antigen in some embodiments binding protein is the amino acid of SEQ ID NO: 1 or SEQ ID NO: 303, 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390 , it binds to a domain containing 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and 554 at least one of. 일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, 및 554 중 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is an amino acid of SEQ ID NO: 1 or SEQ ID NO: 303, 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413, 582, 162, 164, 167, 123, 129, will be coupled to a zone containing a 311, 313, 337, 519, 521, and 554 at least one of.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 162, 164, 167, 207 및/또는 208 중 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to a zone containing at least one of SEQ ID NO: 1 or amino acids 162, 164, 167, 207 and / or 208 of SEQ ID NO: 303. 일부 실시태양에서, 1 초과 (예를 들어, 2, 3, 4, 또는 5개)의 확인된 잔기는 ABP가 결합하는 구역의 일부이다. In some embodiments, the identification of residues 1 excess (e. G., Two, three, four, or five) are part of the section that ABP is a bond. 일부 실시태양에서, ABP는 ABP 21B12와 경쟁한다. In some embodiments, ABP competes with ABP 21B12.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 185의 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to a zone containing at least one amino acid 185 of SEQ ID NO: 1 or SEQ ID NO: 303. 일부 실시태양에서, ABP는 ABP 31H4와 경쟁한다. In some embodiments, ABP competes with ABP 31H4.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 439, 513, 538, 및/또는 539 중 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to a zone containing amino acid of SEQ ID NO: 1 or SEQ ID NO: 303, 439, 513, 538, and / or at least one of 539. 일부 실시태양에서, 1 초과 (예를 들어, 2, 3, 또는 4개)의 확인된 잔기는 ABP가 결합하는 구역의 일부이다. In some embodiments, the identification of residues 1 excess (e. G., Two, three, or four) is a part of a zone that ABP is a bond. 일부 실시태양에서, ABP는 ABP 31A4와 경쟁한다. In some embodiments, ABP competes with ABP 31A4.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 123, 129, 311, 313, 337, 132, 351, 390, 및/또는 413 중 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to a zone containing at least one of SEQ ID NO: 1 or an amino acid sequence of the 303 123, 129, 311, 313, 337, 132, 351, 390, and / or 413. 일부 실시태양에서, 1 초과 (예를 들어, 2, 3, 4, 5, 6, 7, 8, 또는 9개)의 확인된 잔기는 ABP가 결합하는 구역의 일부이다. In some embodiments, the identification of residues 1 excess (e.g., 2, 3, 4, 5, 6, 7, 8, or 9) is a part of the area that ABP is a bond. 일부 실시태양에서, ABP는 ABP 12H11과 경쟁한다. In some embodiments, ABP competes with ABP 12H11.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 아미노산 582, 519, 521, 및/또는 554 중 적어도 하나를 함유하는 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to a zone containing at least one of SEQ ID NO: 1 or an amino acid sequence of the 303 582, 519, 521, and / or 554. 일부 실시태양에서, 1 초과 (예를 들어, 2, 3, 또는 4개)의 확인된 잔기는 ABP가 결합하는 구역의 일부이다. In some embodiments, the identification of residues 1 excess (e. G., Two, three, or four) is a part of a zone that ABP is a bond. 일부 실시태양에서, ABP는 ABP 3C4와 경쟁한다. In some embodiments, ABP competes with ABP 3C4.

일부 실시태양에서, 항원 결합 단백질은 서열 1 또는 서열 303의 단편 또는 전장 서열 내의 상기한 구역에 결합한다. In some embodiments, the antigen binding protein is coupled to the one region in the full length or a fragment of SEQ ID NO: 1 or SEQ ID NO: 303 SEQ ID NO. 다른 실시태양에서, 항원 결합 단백질은 이들 구역으로 이루어지는 폴리펩티드에 결합한다. In another embodiment, the antigen binding protein binds to a polypeptide consisting of these areas. "서열 1 또는 서열 303"에 대한 언급은 이들 서열 중 하나 또는 둘 모두가 사용되거나 관련될 수 있음을 나타낸다. References to "SEQ ID NO: 1 or SEQ ID NO: 303" indicates that one or both of these sequences for all to be used or associated. 상기 구문은 단지 하나만이 사용되어야 함을 나타내지는 않는다. The phrase does not indicate just that this one should be used.

상기 주지한 바와 같이, 상기 설명은 서열 1에 관하여 구체적인 아미노산 위치를 언급한다. As noted above, the above description refers to the specific amino acid position with respect to SEQ ID NO: 1. 그러나, 명세서 전체에서, 일반적으로, 서열 3에 제공되는, 위치 31에서 시작하는 Pro/Cat 도메인에 대해 언급한다. However, in the specification, in general, it refers to the Pro / Cat domain beginning at position 31, which is provided in SEQ ID NO: 3. 아래에서 알 수 있는 바와 같이, 서열 1 및 서열 303은 PCSK9의 신호 서열이 결여된다. As can be seen in the following, SEQ ID NO: 1 and SEQ ID NO: 303 it lacks the signal sequence of the PCSK9. 따라서, 이들 다양한 개시내용 사이의 임의의 비교는 넘버링에서의 상기 차이를 고려해야 한다. Thus, any comparison between these various disclosure should take into account the difference in numbering. 특히, 서열 1의 임의의 아미노산 위치는 아미노산 위치 30의 아미노산, 특히 서열 3의 단백질에 대응할 것이다. In particular, any amino acid positions of SEQ ID NO: 1 will correspond to the protein of the amino acid of amino acid position 30, in particular SEQ ID NO: 3. 예를 들어, 서열 1의 위치 207은 서열 3의 위치 237에 대응한다 (전장 서열, 및 일반적으로 본 명세서에서 사용된 넘버링 시스템). For example, position 207 of SEQ ID NO: 1 corresponds to position 237 of SEQ ID NO: 3 (full-length sequence, and typically the numbering system used herein). 표 39.6에서는 서열 1 (및/또는 서열 303)을 언급하는 상기한 위치가 서열 3 (신호 서열을 포함하는)에 상응하는 방법을 개략한다. Table 39.6, outline a method corresponding to the above-mentioned position of SEQ ID NO: 1 (and / or SEQ ID NO: 303) (containing a signal sequence) SEQ ID NO: 3. 따라서, 서열 1 (및/또는 서열 303)에 관하여 설명되는 임의의 상기한 실시태양은 표시된 대응하는 위치에 의해 서열 3에 관하여 설명된다. Thus, SEQ ID NO: 1 (and / or SEQ ID NO: 303), any of the aforementioned embodiments are described with respect to SEQ ID NO: 3 is described by corresponding to the displayed position.

일부 실시태양에서, ABP 21B12는 잔기 162-167 (예를 들어, 서열 1의 잔기 D162-E167)을 포함하는 에피토프에 결합한다. In some embodiments, ABP 21B12 binds to an epitope comprising residues 162-167 (e. G., Residues D162-E167 of SEQ ID NO: 1). 일부 실시태양에서, ABP 12H11은 잔기 123-132 (예를 들어, 서열 1의 S123-T132)를 포함하는 에피토프에 결합한다. In some embodiments, the ABP 12H11 residues 123-132 (for example, S123-T132 of SEQ ID NO: 1) binds to an epitope comprising a. 일부 실시태양에서, ABP 12H11은 잔기 311-313 (예를 들어, 서열 1의 A311-D313)을 포함하는 에피토프에 결합한다. In some embodiments, the ABP 12H11 (e.g., A311-D313 of SEQ ID NO: 1) residues 311-313 binds to an epitope comprising a. 일부 실시태양에서, ABP는 서열의 이들 가닥 중 임의의 하나를 포함하는 에피토프에 결합할 수 있다. In some embodiments, ABP can bind to an epitope comprising any one of these strands of the sequence.

경쟁성 항원 결합 단백질 Competing antigen binding protein

다른 측면에서, PCSK9에 대한 특이적인 결합에 대해 본원에 설명된 에피토프에 결합하는 하나의 예시된 항체 또는 기능적 단편과 경쟁하는 항원 결합 단백질을 제공한다. In another aspect, there is provided a specific example of the one antibody binding to the epitope described herein for binding or antigen binding protein that competes with the functional fragment of the PCSK9. 상기 항원 결합 단백질은 또한 본원에 예시된 항원 결합 단백질 중 하나와 동일한 에피토프, 또는 겹치는 에피토프에 결합할 수 있다. The antigen binding protein may also be bonded to the same epitope, or an epitope that overlaps with one of the antigen binding proteins exemplified herein. 예시된 항원 결합 단백질과 경쟁하고 그와 동일한 에피토프에 결합하는 항원 결합 단백질 및 단편은 유사한 기능적 특성을 보일 것으로 예상된다. Compete with the exemplified antigen binding proteins and antigen-binding proteins and fragments that bind to the same epitope as that is expected to show similar functional properties. 예시된 항원 결합 단백질 및 단편은 표 2 및/또는 도 2-3 및 도 15에 포함된 중쇄 및 경쇄, 가변 구역 도메인 및 CDR을 갖는 것을 포함하여 상기 설명된 것을 포함한다. Exemplified antigen binding proteins and fragments include those described above, including those having the heavy and light chains, variable regions and CDR domain contained in Table 2 and / or Fig. 2-3 and Fig. 따라서, 구체적인 예로서, 제공되는 항원 결합 단백질은 Thus, as a specific example, the antigen binding protein is provided

(a) 도 2-3 및 15에 제시된 항체에 대해 나열된 6개의 모든 CDR; (A) Figure 6 all CDR listed for the antibodies set forth in 2-3 and 15;

(b) 표 2에 제시된 항체에 대해 나열된 VH 및 VL; (B) listed for the antibodies shown in Table 2 VH and VL; 또는 or

(c) 표 2에 나열된 항체에 대해 명시된 2개의 경쇄 및 2개의 중쇄를 갖는 항체 또는 항원 결합 단백질과 경쟁하는 것을 포함한다. (C) involves competition with the antibody or antigen-binding proteins having two light chains and two heavy chains set forth for the antibodies are listed in Table 2 below.

특정 치료 용도 및 제약 조성물 Specific therapeutic use and to pharmaceutical compositions

특정 예에서, PCSK9 활성은 많은 인간 질병 상태와 상호관련된다. In a particular example, PCSK9 activity is correlated with many human disease states. 예를 들어, 특정 예에서, 너무 많거나 너무 적은 PCSK9 활성은 특정 병태, 예를 들어 고콜레스테롤혈증과 상호관련된다. For example, in certain instances, it is too much or too little PCSK9 activity correlates to contain high cholesterol certain conditions, for example. 따라서, 특정 예에서, PCSK9 활성을 조정하는 것이 치료상 유용할 수 있다. Thus, it may be useful for the treatment to adjust the specific example, PCSK9 activity. 특정 실시태양에서, PCSK9에 대한 중화 항원 결합 단백질이 적어도 하나의 PCSK9 활성 (예를 들어, LDLR에 대한 결합)을 조정하기 위해 사용된다. In certain embodiments, neutralizing antigen binding proteins are at least one of PCSK9 activity against PCSK9 is used to adjust (e. G., Binding to the LDLR). 상기 방법은 상승된 혈청 콜레스테롤 수준과 관련되거나, 상승된 콜레스테롤 수준이 관련되는 질환을 치료하고/하거나 예방하고/하거나 질환의 의 위험을 감소시킬 수 있다. The method or associated with elevated serum cholesterol levels, which can treat elevated cholesterol levels related disease and / or prevent and / or reduce the risk of the disease.

당업자가 알 수 있는 바와 같이, 본 명세서에 비추어, 변화된 콜레스테롤, LDL, 또는 LDLR 수준에 관련되거나 포함하거나 영향을 받을 수 있는 질환은 항원 결합 단백질의 다양한 실시태양에 의해 처리될 수 있다. As will be appreciated by one skilled in the art, in light of the present specification, the changes of cholesterol, LDL, or diseases that may be related or include or affect the level of LDLR can be treated by various embodiments of the antigen binding proteins. 일부 실시태양에서, "콜레스테롤 관련 질환" ("혈청 콜레스테롤 관련 질환" 포함)은 고콜레스테롤혈증, 심장 질병, 대사 증후군, 당뇨병, 관상동맥 심장 질병, 뇌졸중, 심혈관 질병, 알츠하이머 병, 및 일반적으로 예를 들어, 상승된 총 혈청 콜레스테롤, 상승된 LDL, 상승된 트리글리세리드, 상승된 VLDL, 및/또는 적은 HDL에 의해 나타날 수 있는 이상지질혈증 중 임의의 하나 이상을 포함한다. In some embodiments, the "cholesterol-related diseases" (including "serum cholesterol related disorders") is high cholesterol, heart disease, metabolic syndrome, diabetes, coronary heart disease, stroke, cardiovascular disease, Alzheimer's disease, and generally for g., comprises an elevated serum total cholesterol, elevated LDL, elevated triglycerides, elevated VLDL, and / or one or more of any of dyslipidemia that can occur by low HDL. ABP를 단독으로 또는 하나 이상의 다른 물질과 조합으로 사용하여 치료할 수 있는 1차 및 2차 이상지질혈증의 일부 비-제한적인 예는 대사 증후군, 당뇨병, 가족성 복합 고지질혈증, 가족성 고중성지방혈증, 가족성 고콜레스테롤혈증, 예를 들어 이형접합 고콜레스테롤혈증, 동형접합 고콜레스테롤혈증, 가족성 결손 아포지단백질 B-100; Some of the later primary and secondary, which can be treated by using alone or with one or more other substances and combinations of ABP dyslipidemia Non-limiting examples of metabolic syndrome, diabetes, familial combined hyperlipidemia, familial high triglycerides hypertriglyceridemia, familial hypercholesterolemia, for example heterozygous hypercholesterolemia, homozygous hypercholesterolemia, familial defective apolipoprotein B-100; 다유전자성 고콜레스테롤혈증; The genetic hypercholesterolemia; 잔존물 제거 질병, 간 지방분해효소 결핍; Remove remnants disease, hepatic lipase deficiency; 식상(dietary indiscretion), 갑상선기능저하증, 에스트로겐 및 프로게스틴 요법, 베타-차단제, 및 티아지드 이뇨제를 포함한 약물 중 임의의 것에 2차성의 이상지질혈증; Fed up (dietary indiscretion), thyroid hormone, estrogen and progestin therapy, beta-blockers and thiazides medications that any two Seong dyslipidemia of including diuretics; 신 증후군, 만성 신부전증, 쿠싱 증후군, 원발 담즙성 간경화, 글리코겐 저장 질병, 간암, 담증울체, 말단비대증, 인슐린종, 단리된 성장 호르몬 결핍, 및 알콜-유도된 고중성지방혈증을 포함한다. Nephrotic syndrome, chronic renal failure, Cushing's syndrome, primary biliary cirrhosis, glycogen storage disease, liver cancer, damjeung cholestasis, acromegaly, insulin species, with isolated growth hormone deficiency, and alcohol - including induced hypertriglyceridemia. ABP는 또한 죽상동맥경화성 질병, 예를 들어, 관상동맥 심장 질병, 관상 동맥 질병, 말초 동맥 질병, 뇌졸중 (허혈성 및 출혈성), 협심증, 또는 뇌혈관 질병 및 급성 관상동맥 증후군, 심근 경색을 예방 또는 치료하는데 유용할 수 있다. ABP also atherosclerotic disease, for example, coronary heart disease, coronary artery disease, peripheral artery disease, stroke (ischemic and hemorrhagic), angina, or cerebrovascular prevention or treatment of vascular disease and acute coronary syndrome, myocardial infarction to be useful. 일부 실시태양에서, ABP는 비치명적 심장 마비, 치명적 및 비-치명적 뇌졸중, 특정 종류의 심장 수술, 심부전증으로 인한 입원, 심장 질병이 있는 환자에서 흉통, 및/또는 확립된 심장 질병, 예를 들어 이전의 심장 마비, 이전의 심장 수술으로 인한 심혈관 사건, 및/또는 막힌 동맥의 증거가 있는 흉통의 위험을 감소시키는데 유용하다. In some embodiments, ABP is a non-fatal heart attack, fatal and non-fatal stroke and certain types of heart surgery, hospitalization due to heart failure, chest pain in patients with heart disease, and / or established heart disease, for example, the previous of a heart attack, it is useful in reducing the risk of chest pain with evidence of cardiovascular events, and / or blockage of the arteries caused by previous heart surgery. 일부 실시태양에서, ABP 및 방법은 재발성 심혈관 사건의 위험을 감소시키기 위해 사용될 수 있다. In some embodiments, ABP, and methods can be used to reduce the risk of recurrent cardiovascular events.

당업자가 알 수 있는 바와 같이, 스타틴의 사용을 통해 일반적으로 처리가능한 (치료가능하거나 예방가능한) 질병 또는 질환에서 또한 본 발명의 항원 결합 단백질의 적용이 유익할 수 있다. As will be appreciated by one skilled in the art, can be through the use of statins is also advantageous application of the antigen-binding protein of the invention in a possible processed normally (treatable available or preventing) a disease or disorder. 또한, 일부 실시태양에서, 콜레스테롤 합성의 방지 또는 증가된 LDLR 발현이 유익할 수 있는 질환 또는 질병은 또한 항원 결합 단백질의 다양한 실시태양에 의해 치료될 수 있다. Further, in some embodiments, the disease or disorder in the prevention of cholesterol synthesis or increase the expression of LDLR can be advantageous it may also be treated by various embodiments of the antigen binding proteins. 또한, 당업자가 알 수 있는 바와 같이, 항-PCSK9 항체의 사용은 당뇨병의 치료에서 특히 유용할 수 있다. In addition, as can be appreciated by one skilled in the art, wherein the use of -PCSK9 antibodies may be particularly useful in the treatment of diabetes. 당뇨병은 관상동맥 심장 질병에 대한 위험 인자일 뿐만 아니라, 인슐린은 PCSK9의 발현을 증가시킨다. Diabetes is not only a risk factor for coronary heart disease, insulin increases the expression of PCSK9. 즉, 당뇨병의 사람은 상승된 혈장 지질 수준 (높은 PCSK9 수준에 관련될 수 있는)을 갖고, 이들 수준을 저하시키는 것이 유익할 수 있다. In other words, the people of diabetes can be advantageous to have an elevated plasma lipid levels (which may be related to high levels of PCSK9), a decrease of these levels. 이는 일반적으로 그 전문을 본원에 참조로 포함시킨 문헌 [Costet et al. This document which generally include in their entirety herein by reference [Costet et al. ("Hepatic PCSK9 Expression is Regulated by Nutirtional Status via Insulin and Sterol Regulatiory Element-binding Protein 1C", J. Biol. Chem., 281: 6211-6218, 2006)]에 보다 상세히 논의되어 있다. It is more fully discussed in: ( "Hepatic PCSK9 Expression is Regulated by Nutirtional Status via Insulin and Sterol Regulatiory Element-binding Protein 1C", J. Biol Chem, 281 6211-6218, 2006..)].

일부 실시태양에서, 항원 결합 단백질은 당뇨병, 복부 대동맥류, 죽상동맥경화증 및/또는 말초 혈관 질병이 있는 사람에게 그들의 혈청 콜레스테롤 수준을 보다 안정한 범위로 감소시키기 위해 투여된다. In some embodiments, the antigen binding protein is a person with diabetes, abdominal aortic aneurysm, atherosclerosis and / or peripheral vascular disease treated to reduce their serum cholesterol levels more stable range. 일부 실시태양에서, 항원 결합 단백질은 임의의 본원에 기재된 질환을 발병할 위험이 있는 환자에게 투여된다. In some embodiments, the antigen binding protein is administered to patients at risk of developing the disorders described herein in any. 일부 실시태양에서, ABP는 고혈압 또는 초기 심장 마비의 가족력이 있는 흡연자에게 투여된다. In some embodiments, ABP is administered to smokers with a family history of early heart attack or high blood pressure.

일부 실시태양에서, 대상은 2004 NCEP 치료 목표에서 중간 정도의 위험 또는 보다 큰 위험에 있으면 ABP를 투여한다. In some embodiments, the subject is administered the ABP is in danger or larger risk of medium from 2004 NCEP treatment goals. 일부 실시태양에서, ABP는 대상의 LDL 콜레스테롤 수준이 160 mg/dl을 초과하는 경우에 대상에게 투여된다. In some embodiments, ABP is administered to a subject if the LDL cholesterol level of the subject exceeds 160 mg / dl. 일부 실시태양에서, ABP는 대상의 LDL 콜레스테롤 수준이 130을 초과하는 경우에 (그리고 2004 NCEP 치료 목표에 따라 중간 정도 또는 중간 정도로 높은 위험에 있으면) 투여된다. In some embodiments, ABP is administered (If a high degree of risk to medium or medium and in accordance with the 2004 NCEP treatment target) if the LDL cholesterol level of the subject exceeds 130. 일부 실시태양에서, ABP는 대상의 LDL 콜레스테롤 수준이 100을 초과하는 경우에 (그리고 2004 NCEP 치료 목표에 따라 높거나 매우 높은 위험에 있으면) 투여된다. In some embodiments, ABP is administered (and 2004 if the NCEP treatment goals, or higher depending on the very high risk) if the LDL cholesterol level of greater than 100 targets.

의사는 특정 환자의 개별 프로필에 따라 적절한 치료 적응증 및 표적 지질 수준을 선택할 수 있을 것이다. Your doctor will be able to select the appropriate treatment indications and target lipid levels depending on the individual profile of the particular patient. 고지혈증 치료를 지도하는 널리 승인된 하나의 표준은 문헌 [Third Report of the National Cholesterol Education Program (NCEP) Expert Panel on Detection, Evaluation, and Treatment of the High Blood Cholesterol in Adults (Adult Treatment Panel III) Final Report, National Institutes of Health, NIH Publication No. One standard that is widely approved to lead the cholesterol treatment literature [Third Report of the National Cholesterol Education Program (NCEP) Expert Panel on Detection, Evaluation, and Treatment of the High Blood Cholesterol in Adults (Adult Treatment Panel III) Final Report, National Institutes of Health, NIH Publication No. 02-5215 (2002)]이고, 그의 출판 간행물의 전문을 본원에 참조로 포함시킨다. And 02-5215 (2002)], and include the full text of his publications published by reference.

일부 실시태양에서, PCSK9에 대한 항원 결합 단백질은 비정상적으로 높은 수준 또는 심지어 정상 수준으로부터 PCSK9 활성의 양을 감소시키기 위해 사용된다. In some embodiments, the antigen binding to PCSK9 protein is used to reduce the amount of PCSK9 activity from an abnormally high level or even normal. 일부 실시태양에서, PCSK9에 대한 항원 결합 단백질은 고콜레스테롤혈증을 치료 또는 예방하기 위해, 및/또는 그를 위한 의약의 제조에서, 및/또는 다른 콜레스테롤 관련 질환 (예를 들어 본원에 나타낸 것)에 대해 사용된다. In some embodiments, the antigen binding protein to PCSK9 is hypercholesterolemia for treating or preventing, and / or in the manufacture of a medicament therefor, and / or other cholesterol-related diseases for the (for example shown in the present application) It is used. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 PCSK9 활성이 정상인 고콜레스테롤혈증과 같은 병태를 치료 또는 예방하기 위해 사용된다. In a specific embodiment, the antigen binding protein to PCSK9 is used and the normal PCSK9 activity to treat or prevent conditions such as hypercholesterolemia. 예를 들어, 상기 병태에서, 정상 미만으로 PCSK9 활성의 감소는 치료 효과를 제공할 수 있다. For example, in the above conditions, the decrease in PCSK9 activity to below normal may provide a therapeutic effect.

일부 실시태양에서, PCSK9 활성을 조정하기 위해 PCSK9에 대한 하나 초과의 항원 결합 단백질이 사용된다. In some embodiments, the antigen binding protein of more than one of the PCSK9 is used to adjust the PCSK9 activity.

특정 실시태양에서, 치료 유효량의 PCSK9에 대한 하나 이상의 항원 결합 단백질 및 다른 치료제를 투여하는 것을 포함하는, 콜레스테롤 관련 질환, 예를 들어 고콜레스테롤혈증을 치료하는 방법을 제공한다. It provides a method of treating hypercholesterolemia and for example, cholesterol-related disease, which comprises administering one or more antigen-binding proteins, and other therapeutic agents for PCSK9 in a specific embodiment, the therapeutically effective amount.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 단독으로 투여된다. In a specific embodiment, the antigen binding protein to PCSK9 is administered alone. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 적어도 하나의 다른 치료제의 투여 전에 투여된다. In a specific embodiment, the antigen binding protein to PCSK9 is administered prior to administration of at least one other therapeutic agent. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 적어도 하나의 다른 치료제의 투여와 동시에 투여된다. In a specific embodiment, the antigen binding protein to PCSK9 is administered concurrently with the administration of at least one other therapeutic agent. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 적어도 하나의 다른 치료제의 투여 후에 투여된다. In a specific embodiment, the antigen binding protein to PCSK9 is administered after administration of at least one other therapeutic agent. 다른 실시태양에서, PCSK9에 대한 항원 결합 단백질은 적어도 하나의 다른 치료제의 투여 전에 투여된다. In another embodiment, the antigen binding protein to PCSK9 is administered prior to administration of at least one other therapeutic agent. 치료제 (항원 결합 단백질 외에)는 적어도 하나의 다른 콜레스테롤-저하제(들) (혈청 및/또는 총 체내 콜레스테롤)을 포함하고 이로 제한되지 않는다. Therapeutic agent (in addition to the antigen-binding protein) has at least one other cholesterol-lowering agents do not include (s) (serum and / or total cholesterol) and limited. 일부 실시태양에서, 상기 물질은 LDLR의 발현을 증가시키고, 이는 혈청 HDL 수준을 증가시키거나, LDL 수준을 저하시키거나, 트리글리세리드 수준을 저하시키는 것으로 관찰되었다. In some embodiments, the substance increasing the expression of the LDLR and, it has been observed that to increase the serum level of HDL or decreased level of LDL, or a lowering triglyceride levels. 예시적인 물질은 스타틴 (아토르바스타틴, 세리바스타틴, 플루바스타틴, 로바스타틴, 메바스타틴, 피타바스타틴, 프라바스타틴, 로수바스타틴, 심바스타틴), 니코틴산 (니아신) (NIACOR, NIASPAN (서방형 니아신), SLO-NIACIN (서방형 니아신)), 피브르산 (LOPID (겜피브로질), TRICOR (페노피브레이트), 담즙산 흡착제 (sequestrant) (QUESTRAN (콜레스티라민), 콜레세벨람 (WELCHOL), COLESTID (콜레스티폴)), 콜레스테롤 흡수 억제제 (ZETIA (에제티미브)), 니코틴산과 스타틴의 복합제 (ADVICOR (로바스타틴 및 NIASPAN), 스타틴과 흡수 억제제의 복합제 (VYTORIN (ZOCOR 및 ZETIA) 및/또는 지질 변형제를 포함하고 이로 제한되지 않는다. 일부 실시태양에서, ABP는 PPAR 감마 작용제, PPAR 알파/감마 작용제, 스쿠알렌 합성효소 억제제, CETP 억제제, 항-고혈압제, 당뇨병 치료제 (예를 들어 술포닐 우레아, Exemplary materials are statins (atorvastatin, cerivastatin, fluvastatin, lovastatin, mevastatin, pitavastatin, rosuvastatin pravastatin, simvastatin), nicotinic acid (niacin) (NIACOR, NIASPAN (slow release niacin), SLO- acid nIACIN (slow release niacin)), fibric (LOPID (gemfibrozil), TRICOR (fenofibrate), bile acid adsorbent (sequestrant) (QUESTRAN (cholestyramine), Collet colesevelam (WELCHOL), COLESTID (colestipol)) , cholesterol absorption inhibitors (ZETIA (ezetimibe)), complexes of nicotinic acid and a statin (ADVICOR (lovastatin and NIASPAN), statins and complexes (VYTORIN (ZOCOR and ZETIA of absorption inhibitor) and / or included, and this limits the lipid modification of the . is not in some embodiments, the ABP PPAR gamma agonists, PPAR alpha / gamma agonists, squalene synthetase inhibitor, a CETP inhibitor, an anti-hypertensive agent, an antidiabetic agent (e.g., a sulfonylurea, 인슐린, GLP-1 유사체, DDPIV 억제제), ApoB 조정물질, MTP 억제제는 및/또는 폐쇄 죽상동맥경화 치료와 조합된다. 일부 실시태양에서, ABP는 대상에서 LDLR 단백질 수준을 증가시키는 물질, 예를 들어 스타틴, 온코스타틴 M과 같은 특정 시토킨, 에스트로겐, 및/또는 특정 식물 성분, 예를 들어 베르베린과 조합된다. 일부 실시태양에서, ABP는 대상에서 혈청 콜레스테롤 수준을 증가시키는 물질 (예를 들어 특정 항-정신병제, 특정 HIV 프로테아제 억제제, 식이 인자, 예를 들어 고 프럭토스, 수크로스, 콜레스테롤 또는 특정 지방산, 및 RXR, RAR, LXR, FXR에 대한 특정 핵 수용체 작용제 및 길항제)과 조합된다. 일부 실시태양에서, ABP는 대상에서 PCSK9 수준을 증가키는 물질, 예를 들어 스타틴 및/또는 인슐린과 조합된다. 2가지 물질의 조합에서는 다른 물질의 바람직하지 않 Insulin, GLP-1 analogs, DDPIV inhibitors), ApoB adjusting substance, MTP inhibitors is combined with and / or closed-atherosclerotic therapy. In some embodiments, ABP include, for substances, for increasing the LDLR protein levels in the target statins, oncostatin particular cytokine, estrogen, and / or a specific plant component, such as M, for example, is combined with berberine. in some embodiments, ABP is a material (for example a specific anti increase the serum cholesterol level in a subject - it is combined with a psychotic agent, particular HIV protease inhibitor, dietary factors, such as high-fructose, sucrose, cholesterol or a specific nuclear receptor agonists and antagonists) of a particular fatty acid, and RXR, RAR, LXR, FXR some embodiments in the aspect, the ABP is increased key PCSK9 levels in the target substance is, for example, is combined with a statin and / or insulin. not desirable for other materials in the combination of the two materials 부작용이 ABP에 의해 완화될 수 있다. 당업자가 알 수 있는 바와 같이, 일부 실시태양에서, ABP는 다른 물질/화합물과 조합된다. Side effects can be mitigated by the ABP. As will be appreciated by one skilled in the art, in some embodiments, ABP is combined with other materials / compounds. 일부 실시태양에서, ABP 및 다른 물질은 동시에 투여된다. In some embodiments, ABP, and other materials are administered at the same time. 일부 실시태양에서, ABP 및 다른 물질은 동시에 투여되지 않고, 여기서 ABP는 다른 물질이 투여되기 전에 또는 투여된 후에 투여된다. In some embodiments, ABP, and other materials are not administered simultaneously, where ABP is administered after or before the administration of other substances has been administered. 일부 실시태양에서, 대상은 ABP 및 다른 물질 (LDLR 수준을 증가시키는)을 동일한 예방 기간, 질환 발생, 및/또는 치료 기간 동안 투여받는다. In some embodiments, the target is subjected during the ABP administration and other substances (which increases the level of LDLR) of the same period of prevention, disease, and / or duration of treatment.

본 발명의 제약 조성물은 조합 요법으로, 즉, 다른 물질과 조합으로 투여될 수 있다. Pharmaceutical compositions of the invention in combination therapies, that is, may be administered in combination with other materials. 특정 실시태양에서, 조합 요법은 PCSK9에 결합할 수 있는 항원 결합 단백질을 적어도 하나의 항-콜레스테롤제와 조합으로 포함한다. Comprises cholesterol in combination with the - In certain embodiments, the combination therapy is an antigen binding protein capable of binding to PCSK9 at least one anti. 물질은 시험관 내에서 합성된 화학 조성물, 항체, 항원 결합 구역, 및 그의 조합 및 컨쥬게이트를 포함하고 이로 제한되지 않는다. Material comprises the chemical compositions, antibodies, antigen-binding section, and combinations thereof, and conjugates synthesized in vitro, and are not limited. 특정 실시태양에서, 물질은 작용제, 길항제, 알로스테리 (allosteric) 조정물질, 또는 독소로서 역할을 할 수 있다. In certain embodiments, the material may act as agonists, antagonists, Al Ross Terry (allosteric) adjusting material, or a toxin. 특정 실시태양에서, 물질은 그의 표적을 억제하거나 자극하는 (예를 들어, 수용체 또는 효소 활성화 또는 억제) 역할을 하여, LDLR의 증가된 발현을 촉진하거나 혈청 콜레스테롤 수준을 감소시킬 수 있다. In a specific embodiment, the material to inhibit or stimulate its target to act (e. G., Receptor or enzyme activation or inhibition), it is possible to promote the increased expression of LDLR or reducing serum cholesterol levels.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 콜레스테롤-저하제 (혈청 및/또는 총 콜레스테롤)를 사용한 치료 전에, 동시에 및 치료 후에 투여될 수 있다. In a specific embodiment, the antigen binding protein to PCSK9 is cholesterol before treatment with the reducing agent (serum and / or cholesterol), may be administered at the same time and after the treatment. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 고콜레스테롤혈증, 심장 질병, 당뇨병, 및/또는 임의의 콜레스테롤 관련 질환의 발현을 예방 또는 완화시키기 위해 예방적으로 투여될 수 있다. In a specific embodiment, the antigen binding protein to PCSK9 can be administered prophylactically to prevent or alleviate high cholesterol, heart disease, diabetes, and / or any expression of cholesterol-related diseases. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 기존의 고콜레스테롤혈증 병태의 치료를 위해 투여될 수 있다. In a specific embodiment, the antigen binding protein to PCSK9 is that existing can be administered for the treatment of hypercholesterolemia condition. 일부 실시태양에서, ABP는 질환 및/또는 질환과 연관된 증상의 발현을 지연시킨다. In some embodiments, ABP delays the expression of the symptoms associated with the disease and / or disorder. 일부 실시태양에서, ABP는 임의의 하나의 콜레스테롤 관련 질환 또는 그의 하위세트의 임의의 증상이 결여된 대상에게 제공된다. In some embodiments, ABP is provided to target any of the symptoms of any one of cholesterol-related diseases, or a subset of the missing.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 다양한 콜레스테롤 관련 질환, 예를 들어 고콜레스테롤혈증을 치료하기 위해 특정 치료제와 함께 사용된다. In a specific embodiment, the antigen binding protein to PCSK9 is used with particular therapeutic agents to treat hypercholesterolemia and for a variety of cholesterol-related diseases, for example. 특정 실시태양에서, 병태 및 목적하는 수준의 치료를 고려하여, 2 또는 3개 이상의 물질이 투여될 수 있다. In certain embodiments, in view of the level of care for conditions and purposes, there are two or three or more substances can be administered. 특정 실시태양에서, 상기 물질들은 동일한 제형 내에 포함시킴으로써 함께 제공될 수 있다. In certain embodiments, the materials can be provided with the inclusion in the same formulation. 특정 실시태양에서, 상기 물질(들) 및 PCSK9에 대한 항원 결합 단백질은 동일한 제형 내에 포함시킴으로써 함께 제공될 수 있다. In a specific embodiment, the antigen binding protein to the material (s) and PCSK9 may be provided with the inclusion in the same formulation. 특정 실시태양에서, 상기 물질들은 따로 제형화되거나 치료 키트 내에 포함시킴으로써 함께 제공될 수 있다. In certain embodiments, the materials can be provided with the inclusion in the separately formulated or therapeutic kit. 특정 실시태양에서, 상기 물질 및 PCSK9에 대한 항원 결합 단백질은 따로 제형화되거나 치료 키트 내에 포함시킴으로써 함께 제공될 수 있다. In a specific embodiment, the antigen binding protein to the materials and PCSK9 may be provided together by including in the separately formulated or therapeutic kit. 특정 실시태양에서, 상기 물질들은 따로 제공될 수 있다. In certain embodiments, the materials can be provided separately. 특정 실시태양에서, 유전자 요법에 의해 투여될 때, 단백질 물질을 코딩하는 유전자 및/또는 PCSK9에 대한 항원 결합 단백질은 동일한 벡터 내에 포함될 수 있다. In certain embodiments, when administered by gene therapy, antigen-binding proteins for a gene and / or PCSK9 encoding a protein material may be included in the same vector. 특정 실시태양에서, 단백질 물질을 코딩하는 유전자 및/또는 PCSK9에 대한 항원 결합 단백질은 동일한 프로모터 구역의 제어 하에 놓일 수 있다. In a specific embodiment, the antigen binding protein of the gene and / or PCSK9 encoding the protein material may be placed under the control of the same promoter region. 특정 실시태양에서, 단백질 물질을 코딩하는 유전자 및/또는 PCSK9에 대한 항원 결합 단백질은 별개의 벡터 내에 존재할 수 있다. In a specific embodiment, the antigen binding protein of the gene and / or PCSK9 encoding the protein material may be present in a separate vector.

특정 실시태양에서, 본 발명은 PCSK9에 대한 항원 결합 단백질을 제약상 허용되는 희석제, 담체, 가용화제, 유화제, 보존제 및/또는 보조제와 함께 포함하는 제약 조성물을 제공한다. In certain embodiments, the invention provides a pharmaceutical composition comprising together with a diluent, carrier, solubilizer, emulsifier, preservative and / or adjuvant acceptable for antigen-binding protein for the pharmaceutical PCSK9.

특정 실시태양에서, 본 발명은 PCSK9에 대한 항원 결합 단백질 및 치료 유효량의 적어도 하나의 추가의 치료제를 제약상 허용되는 희석제, 담체, 가용화제, 유화제, 보존제 및/또는 보조제와 함께 포함하는 제약 조성물을 제공한다. In certain embodiments, the present invention is a pharmaceutical composition comprising together with antigen-binding protein and treating at least one diluent is added to a pharmaceutically acceptable therapeutic agent in the effective amount of a carrier, solubilizer, emulsifier, preservative and / or adjuvant for the PCSK9 to provide.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 염증에 대한 적어도 하나의 치료제와 함께 사용될 수 있다. In a specific embodiment, the antigen binding protein to PCSK9 can be used in combination with at least one therapeutic agent for inflammation. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 면역 질환에 대한 적어도 하나의 치료제와 함께 사용될 수 있다. In a specific embodiment, the antigen binding protein to PCSK9 can be used in combination with at least one therapeutic agent for immune diseases. 염증 및 면역 질환에 대한 예시적인 치료제는 시클로옥시게나제 타입 1 (COX-1) 및 시클로옥시게나제 타입 2 (COX-2) 억제제, 38 kDa 미토겐-활성화된 단백질 키나제 (p38-MAPK)의 소분자 조정물질; Exemplary therapeutic agents for inflammation and immune disorders are cyclooxygenase type 1 (COX-1) and cyclooxygenase type 2 (COX-2) inhibitors, 38 kDa mitogen-of the activated protein kinase (p38-MAPK) small molecule adjusting material; 염증 경로에 관여하는 세포내 분자의 소분자 조정물질을 포함하고 이로 제한되지 않고, 여기서 상기 세포내 분자는 jnk, IKK, NF-κB, ZAP70, 및 lck를 포함하고 이로 제한되지 않는다. Not include small molecule substances adjustment of intracellular molecules involved in inflammation path and not limited to, molecules in the cell where is not included in the jnk, IKK, NF-κB, ZAP70, and lck, and limited. 염증에 대한 특정 예시적인 치료제는 예를 들어, 문헌 [CA Dinarello & LL Moldawer Proinflammatory and Anti-Inflammatory Cytokines in Rheumatoid Arthritis: A Primer for Clinicians Third Edition (2001) Amgen Inc. Specific examples of therapeutic agents for inflammation, for example, the literature [CA Dinarello & LL Moldawer Proinflammatory and Anti-Inflammatory Cytokines in Rheumatoid Arthritis: A Primer for Clinicians Third Edition (2001) Amgen Inc. Thousand Oaks, CA]에 기재되어 있다. Thousand Oaks, are described in CA].

특정 실시태양에서, 제약 조성물은 PCSK9에 대한 하나 초과의 상이한 항원 결합 단백질을 포함할 것이다. In certain embodiments, the pharmaceutical composition will comprise different antigen-binding protein of more than one of the PCSK9. 특정 실시태양에서, 제약 조성물은 PCSK9에 대한 하나 초과의 항원 결합 단백질을 포함할 것이고, 여기서 PCSK9에 대한 항원 결합 단백질은 하나 초과의 에피토프에 결합한다. In certain embodiments, the pharmaceutical composition will contain an antigen binding protein of more than one of the PCSK9, wherein the antigen-binding protein for binding to an epitope of PCSK9 is more than one. 일부 실시태양에서, 다양한 항원 결합 단백질은 PCSK9에 대한 결합을 위해 서로 경쟁하지 않을 것이다. In some embodiments, various antigen binding proteins will not compete with each other for binding to PCSK9. 일부 실시태양에서, 표 2와 도 2 및/또는 3에 제시된 임의의 항원 결합 단백질들은 제약 조성물 내에서 함께 조합될 수 있다. In some embodiments, the table 2 and any antigen-binding proteins shown in Figure 2 and / or 3 may be combined together in a pharmaceutical composition.

특정 실시태양에서, 허용되는 제형화 물질은 바람직하게는 사용된 용량 및 농도에서 수여자에 대해 무독성이다. In certain embodiments, acceptable formulation materials are preferably non-toxic to the number of women in the dose and concentration in use. 일부 실시태양에서, 제형화 물질(들)은 피하 및/또는 정맥내 투여를 위한 것이다. In some embodiments, the formulated material (s) is for administration subcutaneously and / or intravenously. 특정 실시태양에서, 제약 조성물은 예를 들어 조성물의 pH, 몰랄 삼투압 농도, 점도, 투명도, 색상, 등장성, 냄새, 멸균성, 안정성, 해리 또는 방출 속도, 흡착 또는 투과를 변형, 유지 또는 보존하기 위해 제형화 물질을 함유할 수 있다. In certain embodiments, the pharmaceutical composition for for example modifying the composition of the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, dissociation, or release rate, absorption or transmission, maintaining or preserving for it may contain formulating materials. 특정 실시태양에서, 적합한 제형화 물질은 아미노산 (예를 들어 글라이신, 글루타민, 아스파라긴, 아르기닌 또는 라이신); In certain embodiments, suitable formulation materials are amino acids (e.g. glycine, glutamine, asparagine, arginine or lysine); 항미생물제; Antimicrobials; 항산화제 (예를 들어 아스코르브산, 아황산나트륨 또는 아황산수소나트륨); Antioxidants (e.g. ascorbic acid, sodium sulfite or sodium bisulfite); 버퍼 (예를 들어 보레이트, 비카르보네이트, Tris-HCl, 시트레이트, 포스페이트 또는 다른 유기산); Buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); 증량제 (예를 들어 만니톨 또는 글라이신); Bulking agent (e.g. mannitol or glycine); 킬레이팅제 (예를 들어 에틸렌디아민 테트라아세트산 (EDTA)); (E.g. ethylenediaminetetraacetic acid (EDTA)) chelating agents; 착화제 (예를 들어 카페인, 폴리비닐피롤리돈, 베타-시클로덱스트린 또는 히드록시프로필-베타-시클로덱스트린); Complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta-cyclodextrin); 충전제; Filler; 단당류; Monosaccharides; 이당류; saccharose; 및 다른 탄수화물 (예를 들어 글루코스, 만노스 또는 덱스트린); And other carbohydrates (such as glucose, mannose, or dextrins); 단백질 (예를 들어 혈청 알부민, 젤라틴 또는 면역글로불린); Protein (e.g. serum albumin, gelatin, or immunoglobulins); 착색제, 향미제 및 희석제; Coloring agents, flavoring agents, and diluents; 유화제; Emulsifier; 친수성 중합체 (예를 들어 폴리비닐피롤리돈); Hydrophilic polymers (e.g. polyvinyl pyrrolidone); 저 분자량 폴리펩티드; Low molecular weight polypeptides; 염 형성 반대 이온 (예를 들어 나트륨); Salt forming counterions (such as sodium); 보존제 (예를 들어 벤즈알코늄 클로라이드, 벤조산, 살리실산, 티메로살, 페네틸 알콜, 메틸파라벤, 프로필파라벤, 클로르헥시딘, 소르브산 또는 과산화수소); Preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); 용매 (예를 들어 글리세린, 프로필렌 글리콜 또는 폴리에틸렌 글리콜); Solvents (such as glycerin, propylene glycol or polyethylene glycol); 당 알콜 (예를 들어 만니톨 또는 소르비톨); Sugar alcohols (e.g. mannitol or sorbitol); 현탁제; Suspending agents; 계면활성제 또는 습윤제 (예를 들어 플루로닉, PEG, 소르비탄 에스테르, 폴리소르베이트, 예를 들어 폴리소르베이트 20, 폴리소르베이트 80, 트리톤, 트로메타민, 레시틴, 콜레스테롤, 틸록사팔); Surfactants or wetting agents (e.g. Pluronic, PEG, sorbitan esters, polysorbate, such as polysorbate 20, polysorbate 80, triton, tromethamine, lecithin, cholesterol, tilrok forty-eight); 안정성 향상제 (예를 들어 수크로스 또는 소르비톨); Stability-improving agent (e.g., sucrose or sorbitol); 긴장성 (tonicity) 향상제 (예를 들어 알칼리 금속 할라이드, 바람직하게는 염화나트륨 또는 염화칼륨, 만니톨 소르비톨); Tension (tonicity) improver (e.g. an alkali metal halide, preferably sodium chloride or potassium chloride, mannitol sorbitol); 전달 비히클; Delivery vehicles; 희석제; diluent; 부형제 및/또는 제약상 보조제를 포함하고 이로 제한되지 않는다 (Remington's Pharmaceutical Sciences, 18th Edition, AR Gennaro, ed., Mack Publishing Company (1995)). Including excipients and / or pharmaceutical adjuvants and are not limited to (. Remington's Pharmaceutical Sciences, 18th Edition, AR Gennaro, ed, Mack Publishing Company (1995)). 일부 실시태양에서, 제형은 PBS; In some embodiments, the formulations PBS; 20 mM NaOAC (pH 5.2), 50 mM NaCl; 20 mM NaOAC (pH 5.2), 50 mM NaCl; 및/또는 10 mM NAOAC (pH 5.2), 9% 수크로스를 포함한다. And / or 10 mM and NAOAC (pH 5.2), containing 9% sucrose.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질 및/또는 치료적 분자는 당업계에 공지된 반감기 연장 비히클에 연결된다. In a specific embodiment, the antigen binding protein and / or therapeutic molecules to the PCSK9 is connected to a half-life extending vehicle known in the art. 상기 비히클은 폴리에틸렌 글리콜, 글리코겐 (예를 들어, ABP의 글리코실화), 및 덱스트란을 포함하고 이로 제한되지 않는다. The vehicle is a polyethylene glycol, glycogen (e.g., glycosylation of ABP) include, and dextran are not so limited. 상기 비히클은 예를 들어 임의의 목적으로 본원에 참조로 포함시킨 미국 특허 출원 09/428,082 (현재 미국 특허 6,660,843) 및 공개된 PCT 출원 WO 99/25044에 설명되어 있다. The vehicle may, for example, are described in that U.S. Patent Application 09/428 082 (now U.S. Patent 6,660,843) and published PCT application WO 99/25044 incorporated herein by reference for any purpose.

특정 실시태양에서, 최적 제약 조성물은 예를 들어, 의도된 투여 경로, 전달 방식 및 목적하는 용량에 따라 당업자가 결정할 것이다 (예를 들어, [REMINGTON'S PHARMACEUTICAL SCIENCES, 상기 문헌] 참조). In certain embodiments, the optimal pharmaceutical composition will, for example, those skilled in the art will determine according to the intended route of administration, delivery methods and purposes capacity (see, for example, [REMINGTON'S PHARMACEUTICAL SCIENCES, supra). 특정 실시태양에서, 상기 조성물은 본 발명의 항체의 물리적 상태, 안정성, 생체 내 방출율 및 생체 내 청소율에 영향을 미칠 수 있다. In certain embodiments, the composition can have a physical state, stability, release rate and in vivo biological effect in the clearance of the antibodies of the invention.

특정 실시태양에서, 제약 조성물 내의 1차 비히클 또는 담체는 성질이 수성 또는 비-수성일 수 있다. In certain embodiments, the primary vehicle or carrier in a pharmaceutical composition is tempered aqueous or non-aqueous may be. 예를 들어, 특정 실시태양에서, 적합한 비히클 또는 담체는 가능하게는 비경구 투여용 조성물에 통상적인 다른 물질을 보충한 주사용수, 생리학적 염수 용액 또는 인공 뇌척수액일 수 있다. For example, in certain embodiments, it may be a suitable vehicle or carrier possibly a parenteral administration composition conventional other substances water for injection, physiological saline solution or artificial cerebrospinal fluid supplement for the. 일부 실시태양에서, 염수는 등장성 포스페이트-완충 염수를 포함한다. In some embodiments, the salt is an isotonic phosphate-buffered saline and a. 특정 실시태양에서, 중성 완충 염수 또는 혈청 알부민과 혼합한 염수가 추가의 예시적인 비히클이다. In certain embodiments, an exemplary vehicle in a neutral buffered saline or serum albumin and a mixture of brine added. 특정 실시태양에서, 제약 조성물은 약 pH 7.0-8.5의 Tris 버퍼, 또는 약 pH 4.0-5.5의 아세테이트 버퍼를 포함하고, 이는 소르비톨 또는 그에 대한 적합한 대체물을 추가로 포함할 수 있다. In certain embodiments, the pharmaceutical composition comprises a Tris buffer, or acetate buffer of about pH 4.0-5.5 of about pH 7.0-8.5, which may further include sorbitol or a suitable substitute thereof. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 조성물은 목적하는 순도를 갖는 선택된 조성물을 선택적인 제형화 물질 (Remington's pharmaceutical Sciences, 상기 문헌)과 동결건조 케이크 또는 수용액의 형태로 혼합함으로써 저장을 위해 제조할 수 있다. In certain embodiments, the composition comprising the antigen binding protein to PCSK9 with or independently with at least one additional therapeutic agent is an optional formulated material the selected composition having the desired purity (Remington's pharmaceutical Sciences, supra) and freeze- It may be prepared for storage by mixing in the form of a dry cake or aqueous solutions. 또한, 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 조성물은 수크로스와 같은 적절한 부형제를 사용하여 동결건조물로서 제형화할 수 있다. Further, in certain embodiments, the composition comprising the antigen binding protein to PCSK9 with or independently with at least one additional therapeutic agent can be formulated as a lyophilizate using appropriate excipients such as sucrose.

특정 실시태양에서, 제약 조성물은 비경구 전달을 위해 선택될 수 있다. In certain embodiments, the pharmaceutical compositions can be selected for parenteral delivery. 특정 실시태양에서, 조성물은 흡입을 위해 또는 소화관을 통한 전달, 예를 들어 경구 전달을 위해 선택될 수 있다. In certain embodiments, the composition is delivered for inhalation or through the alimentary tract, for example, may be selected for oral delivery. 그러한 제약상 허용되는 조성물의 제조는 당업자의 능력 내에 있다. Preparation of the composition to be pharmaceutically acceptable such are within the ordinary skill in the art of power.

특정 실시태양에서, 제형화 성분은 투여 부위에 허용되는 농도로 존재한다. In certain embodiments, the formulation components are present in concentration that are acceptable to the site of administration. 특정 실시태양에서, 버퍼는 조성물을 생리학적 pH 또는 근소하게 더 낮은 pH에서, 대개 약 5 내지 약 8의 pH 범위 내에서 유지하기 위해 사용된다. In certain embodiments, the buffer in the physiological pH or marginally lower pH compositions, are often used to maintain pH in the range of about 5 to about 8.

특정 실시태양에서, 비경구 투여가 고려될 때, 치료 조성물은 PCSK9에 대한 목적하는 항원 결합 단백질을 제약상 허용되는 비히클 내에서 추가의 치료제와 함께 또는 단독으로 포함하는, 발열원이 없는 비경구로 허용되는 수용액 형태로 존재할 수 있다. In certain embodiments, parenteral, when administered to consider, treatment compositions which, pyrogen allowed parenterally without containing the desired antigen-binding protein according to or independently with the additional therapeutic agent in the vehicle which is pharmaceutically acceptable for PCSK9 It may be in the form of an aqueous solution. 특정 실시태양에서, 비경구 주사를 위한 비히클은 멸균 증류수이고, 여기서 PCSK9에 대한 항원 결합 단백질은 적어도 하나의 추가의 치료제와 함께 또는 단독으로, 적합하게 보존된 멸균 등장성 용액으로서 제형화된다. In certain embodiments, a vehicle for parenteral injection is sterile distilled water, wherein the antigen binding protein to PCSK9 is at least a screen or singly with one additional therapeutic agent, formulated as a suitably preserved sterile isotonic solution. 특정 실시태양에서, 제제는 이어서 데포 (depot) 주사를 통해 전달될 수 있는 제품의 제어 또는 지속 방출을 제공할 수 있는 주사가능한 미세구, 생체분해성 입자, 중합체성 화합물 (예를 들어 폴리락트산 또는 폴리글리콜산), 비드 또는 리포좀과 같은 물질을 갖는 목적하는 분자의 제형을 포함할 수 있다. In certain embodiments, the formulation is then depot (depot) to be provided to control or sustained release of the product which may be injectable microspheres which passed through the scanning, biodegradable particles, polymeric compounds (such as polylactic acid or poly glycolic acid), it is possible to include the formulation of the desired molecule with a material, such as beads or liposomes. 특정 실시태양에서, 히알루론산이 또한 사용될 수 있고, 순환계에서 지속 기간을 촉진하는 효과를 가질 수 있다. In certain embodiments, hyaluronic acid may also be used and may have the effect of promoting sustained duration in the circulation. 특정 실시태양에서, 이식가능한 약물 전달 장치가 목적하는 분자를 도입하기 위해 사용될 수 있다. In certain embodiments, it can be used for introducing a molecule which is an implantable drug delivery device object.

특정 실시태양에서, 제약 조성물은 흡입을 위해 제형화될 수 있다. In certain embodiments, the pharmaceutical composition can be formulated for inhalation. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질은 적어도 하나의 추가의 치료제와 함께 또는 단독으로 흡입용 건조 분말로서 제형화될 수 있다. In a specific embodiment, the antigen binding to PCSK9 protein may be formulated as dry powder for inhalation in single or together with at least one additional therapeutic agent. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 흡입 용액은 에어로졸 전달을 위한 추진제를 사용하여 제형화될 수 있다. In a specific embodiment, the inhalation solution comprising the antigen binding protein to PCSK9 with or independently with at least one additional therapeutic agent may be formulated with a propellant for aerosol delivery. 특정 실시태양에서, 용액은 분무될 수 있다. In certain embodiments, the solution can be sprayed. 폐 투여는 화학적으로 변형된 단백질의 폐 전달을 설명하는 PCT 출원 PCT/US94/001875에 추가로 설명되어 있다. Pulmonary administration is further described in PCT Application PCT / US94 / 001875, which describes pulmonary delivery of chemically modified proteins.

특정 실시태양에서, 제형이 경구로 투여될 수 있음이 고려된다. Is that in certain embodiments, the dosage form can be orally administered is considered. 특정 실시태양에서, 상기 방식으로 투여되는 PCSK9에 대한 항원 결합 단백질은 적어도 하나의 추가의 치료제와 함께 또는 단독으로 정제 및 캡슐과 같은 고체 투여형의 조제에서 관습적으로 사용되는 담체를 사용하거나 사용하지 않고 제형화될 수 있다. In a specific embodiment, the antigen binding to PCSK9 is administered in this manner the protein is with or without a carrier, at least using one with additional therapeutic agent or in the preparation of solid dosage forms such as tablets and capsules alone customary but it can be formulated. 특정 실시태양에서, 캡슐은 생체이용률이 최대화되고 전신 도입전 파괴가 최소화되는 위장관 내의 지점에서 제형의 활성 부분을 방출하도록 설계될 수 있다. In certain embodiments, a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract which maximizes bioavailability and around the fracture is minimal systemic introduction. 특정 실시태양에서, PCSK9에 대한 항원 결합 단백질 및/또는 임의의 추가의 치료제의 흡수를 용이하게 하기 위해 적어도 하나의 추가의 물질이 포함될 수 있다. In certain embodiments, it may include at least one additional material in order to facilitate the antigen-binding protein and / or any additional therapeutic agents in the absorption of the PCSK9. 특정 실시태양에서, 희석제, 향미제, 저융점 왁스, 식물유, 윤활제, 현탁화제, 정제 붕해제 및 결합제가 또한 사용될 수 있다. In certain embodiments, diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders may also be used.

특정 실시태양에서, 제약 조성물은 유효량의 PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 정제의 제조에 적합한 무독성 부형제와의 혼합물로 포함할 수 있다. In certain embodiments, the pharmaceutical composition may comprise an antigen-binding protein to an effective amount of PCSK9 in a mixture with non-toxic, suitable excipients for the production of tablets or alone with the at least one additional therapeutic agent. 특정 실시태양에서, 정제를 멸균수 또는 다른 적절한 비히클에 용해시킴으로써, 용액을 단위 투여 형태로 제조할 수 있다. In certain embodiments, by dissolving the tablets in sterile water, or another appropriate vehicle, solutions can be prepared in unit dosage form. 특정 실시태양에서, 적합한 부형제는 불활성 희석제, 예를 들어 탄산칼슘, 탄산나트륨 또는 중탄산나트륨, 락토스 또는 인산칼슘; In certain embodiments, suitable excipients include inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; 또는 결합제, 예를 들어 전분, 젤라틴 또는 아카시아; Or binding agents, for example starch, gelatin or acacia; 또는 활택제, 예를 들어 스테아르산마그네슘, 스테아르산 또는 탈크를 포함하고 이로 제한되지 않는다. Or include lubricants, for example magnesium stearate, stearic acid or talc is not so limited.

PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제(들)과 함께 또는 단독으로 지속- 또는 제어-전달 제형 내에 포함하는 제형을 포함한 추가의 제약 조성물이 당업자에게 명백할 것이다. The antigen binding protein to PCSK9 at least one additional therapeutic agent (s) and with or without sustained-or controlled-additional pharmaceutical compositions, including a formulation contained within the delivery formulations will be apparent to those skilled in the art. 특정 실시태양에서, 다양한 다른 지속- 또는 제어-전달 수단, 예를 들어 리포좀 담체, 생체분해성 미세입자 또는 다공성 비드 및 데포 주사를 제형화하기 위한 기술은 당업자에게 공지되어 있다. In certain embodiments, a variety of other sustained- or controlled-delivery means, such as liposome carriers, techniques for formulating a biodegradable microparticles or porous beads and depot injections are known to those skilled in the art. 예를 들어, 제약 조성물의 전달을 위한 다공성 중합성 미세입자의 제어 방출을 설명하는 PCT 출원 PCT/US93/00829를 참조한다. For example, reference is made to PCT application PCT / US93 / 00829 that describes controlled release of porous polymeric microparticles for delivery of pharmaceutical compositions. 특정 실시태양에서, 지속-방출 제제는 성형품, 예를 들어, 필름 또는 미세캡슐 형태의 반투과성 중합체 매트릭스를 포함할 수 있다. In certain embodiments, sustained-release formulations may include a molded article, e.g., films, or microcapsules in the form of a semi-permeable polymer matrix. 지속 방출 매트릭스는 폴리에스테르, 히드로겔, 폴리락티드 (US 3,773,919 및 EP 058,481), L-글루탐산 및 감마 에틸-L-글루타메이트의 공중합체 (Sidman et al., Biopolymers 22:547-556 (1983)), 폴리(2-히드록시에틸-메타크릴레이트) ([Langer et al., J. Biomed. Mater. Res. 15:167-277 (1981)] 및 [Langer, Chem. Tech. 12:98-105 (1982)]), 에틸렌 비닐 아세테이트 (Langer et al., 1981, 상기 문헌) 또는 폴리-D(-)-3-히드록시부티르산 (EP 133,988)을 포함할 수 있다. The sustained release matrix is ​​a polyester, copolymers of hydrogels, polylactides (US 3,773,919 and EP 058,481), L- glutamic acid and gamma ethyl -L- glutamate (Sidman et al, Biopolymers 22:. 547-556 (1983)) , poly (2-hydroxyethyl-methacrylate) ([Langer et al, J. Biomed Mater Res 15:.... 167-277 (1981)].. and [Langer, Chem Tech 12: 98-105 (1982)), ethylene vinyl acetate (Langer et al, 1981, supra) or poly -D (-.) - may include a 3-hydroxybutyric acid (EP 133,988). 특정 실시태양에서, 지속 방출 조성물은 또한 당업계에 공지된 임의의 여러 방법에 의해 제조할 수 있는 리포좀을 포함할 수 있다. In certain embodiments, sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art. 예를 들어, 문헌 [Eppstein et al., Proc. See, e.g., [Eppstein et al., Proc. Natl. Natl. Acad. Acad. Sci. Sci. USA, 82:3688-3692 (1985)]; USA, 82: 3688-3692 (1985)]; EP 036,676; EP 036,676; EP 088,046 및 EP 143,949를 참조한다. See EP 088,046 and EP 143,949.

생체 내 투여를 위해 사용되는 제약 조성물은 대개 멸균된다. Pharmaceutical compositions used for in vivo administration are typically sterile. 특정 실시태양에서, 멸균은 멸균 여과막을 통한 여과에 의해 달성할 수 있다. In certain embodiments, sterilization may be accomplished by filtration through sterile filtration membranes. 특정 실시태양에서, 조성물을 동결건조할 때, 상기 방법을 이용한 멸균을 동결건조 및 재구성 전에 또는 후에 수행할 수 있다. In certain embodiments, when the lyophilized composition, it is possible to perform sterilization using the method before lyophilization, and reconstruction or after. 특정 실시태양에서, 비경구 투여를 위한 조성물은 동결건조 형태 또는 용액으로 저장할 수 있다. In certain embodiments, the composition for parenteral administration may be stored in lyophilized form or in solution. 특정 실시태양에서, 비경구 조성물은 일반적으로 멸균 접근 포트가 있는 용기, 예를 들어, 피하 주사 바늘로 뚫을 수 있는 스토퍼가 있는 정맥내 용액 백 또는 바이알에 넣어진다. In certain embodiments, parenteral compositions generally sterile container with the access port, for example, is put on an intravenous solution bag or a vial with a stopper which can penetrate to a hypodermic needle.

특정 실시태양에서, 일단 제약 조성물이 제형화되면, 이를 멸균 바이알 내에 용액, 현탁액, 겔, 에멀젼, 고체, 또는 탈수 또는 동결건조 분말로서 저장할 수 있다. In certain embodiments, once the pharmaceutical composition formulation hwadoemyeon, and store it as a solution, suspension, gel, emulsion, solid, or dehydrated or lyophilized powder in sterile vials. 특정 실시태양에서, 상기 제형은 바로 사용되는 (ready-to-use) 형태 또는 투여 전에 재구성되는 형태 (예를 들어, 동결건조 형태)로 저장할 수 있다. In certain embodiments, the formulation is ready to use (ready-to-use) form or in the form of reconstructed prior to administration which can be stored in (for example, lyophilized form).

특정 실시태양에서, 단일-용량 투여 단위를 생산하기 위한 키트를 제공한다. In a specific embodiment, the single- provides a kit for the production of a dose unit. 특정 실시태양에서, 키트는 건조된 단백질을 갖는 제1 용기 및 수성 제형을 갖는 제2 용기를 포함할 수 있다. In certain embodiments, the kit may include a second container having a first container and an aqueous formulation having a dried protein. 특정 실시태양에서, 단일 및 다수-챔버의 예비-충전된 시린지 (예를 들어, 액체 시린지 및 리오시린지 (lyosyringe))를 포함하는 키트를 제공한다. In a specific embodiment, the single- and multi-reserve chamber (e. G., Liquid syringes and Rio syringe (lyosyringe)) filled syringe provides a kit comprising a.

특정 실시태양에서, 치료상 사용될 PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 제약 조성물의 유효량은 예를 들어 치료 환경 및 목표에 따라 결정될 것이다. In certain embodiments, the effective amount of the pharmaceutical composition comprising the antigen binding protein, alone or together with at least one additional therapeutic agent for treating a PCSK9 be used, for example, will depend on the therapeutic goal and environment. 당업자는 특정 실시태양에 따라 치료를 위한 적절한 투여량 수준이 부분적으로 전달되는 분자, PCSK9에 대한 항원 결합 단백질이 적어도 하나의 추가의 치료제와 함께 또는 단독으로 사용되는 적응증, 투여 경로, 및 환자의 체격 (체중, 체표면적 또는 장기 크기) 및/또는 상태 (연령 및 전반적인 건강)에 따라 변할 것임을 알 것이다. Those skilled in the art particular embodiments molecules appropriate dosage levels for treatment in accordance with the sun that are partially transmitted to the antigen binding to PCSK9 indications for which the protein is used either alone or together with at least one additional therapeutic agent, the route of administration, and the physique of the patient (body weight, body surface area or organ size) and / or the state will recognize that changes depending on (the age and general health). 특정 실시태양에서, 임상의는 최적 치료 효과를 얻기 위해 투여량을 적정하고 투여 경로를 변형시킬 수 있다. In a specific embodiment, the clinician may be appropriate to modify the route of administration, the dose to achieve the optimal therapeutic effect. 특정 실시태양에서, 전형적인 투여량은 상기 언급된 인자에 따라 약 0.1 ㎍/kg 내지 약 100 mg/kg 이상일 수 있다. In certain embodiments, a typical dosage may be about 0.1 ㎍ / kg to about 100 mg / kg, depending on the aforementioned factors. 특정 실시태양에서, 투여량은 0.1 ㎍/kg 내지 약 100 mg/kg; In certain embodiments, the dosage is 0.1 ㎍ / kg to about 100 mg / kg; 또는 1 ㎍/kg 내지 약 100 mg/kg; Or 1 ㎍ / kg to about 100 mg / kg; 또는 5 ㎍/kg 내지 약 100 mg/kg일 수 있다. Or it may be a 5 ㎍ / kg to about 100 mg / kg.

특정 실시태양에서, 투여 빈도는 사용된 제형 내의 PCSK9에 대한 항원 결합 단백질 및/또는 임의의 추가의 치료제의 약동학 파라미터를 고려할 것이다. In certain embodiments, the frequency of administration will consider the antigen binding protein and / or pharmacokinetic parameters for any further treatment for PCSK9 in the formulation used. 특정 실시태양에서, 임상의는 목적하는 효과를 달성하는 투여량이 도달될 때까지 조성물을 투여할 것이다. In a specific embodiment, the clinician will administer the composition until a dosage is reached that achieves the desired effect. 따라서, 특정 실시태양에서, 조성물은 단일 용량으로서, 또는 시간 경과에 따라 2회 이상 용량 (동일한 양의 목적하는 분자를 함유할 수 있거나 함유하지 않을 수 있는)으로서, 또는 이식 장치 또는 카테터를 통한 연속 주입으로서 투여될 수 있다. Thus, in certain embodiments, the composition comprises a continuous through, or implantation device or catheter as a (which may or may not contain, or may contain the desired molecule to the same amount of) two or more times capacity as a single dose, or time It can be administered as an injection. 적절한 투여량의 추가의 미세조정은 통상적으로 당업자에 의해 이루어지고, 이들이 통상적으로 수행하는 업무의 범위 내에 있다. Additional fine-tuning of the appropriate dosage is typically made by those skilled in the art, it is within the scope of the task to which they are carried out in a conventional. 특정 실시태양에서, 적절한 투여량은 적절한 용량-반응 데이타의 사용을 통해 확인할 수 있다. In certain embodiments, appropriate dosages are appropriate dose-response can be identified through the use of the data. 일부 실시태양에서, 투여량 및 투여 빈도는 달성되는 목적하는 콜레스테롤 수준 (혈청 및/또는 총) 및 대상의 현재 콜레스테롤 수준, LDL 수준 및/또는 LDLR 수준을 고려할 수 있고, 이들은 모두 당업자에게 잘 공지된 방법에 의해 얻을 수 있다. In some embodiments, the dosage and frequency of administration may be considered the desired cholesterol levels to be achieved (serum and / or total) and presence of cholesterol level in the target, LDL levels and / or LDLR levels, all of which is well known to those skilled in the art It can be obtained by the methods.

특정 실시태양에서, 제약 조성물의 투여 경로는 공지의 방법에 따르고, 예를 들어, 경구, 정맥내, 복강내, 뇌내 (실질내), 뇌실내, 근육내, 피하, 눈내, 동맥내, 문맥내 또는 병변내 경로에 의한 주사를 통해; In certain embodiments, the administration route of the pharmaceutical composition is following a known method, for example, oral, intravenous, intraperitoneal, intracerebral (parenchyma), intraventricular, intramuscular, subcutaneous, nunnae, intraarterial, context or lesions through the scanning by the path; 지속 방출 시스템 또는 이식 장치에 의한다. The by sustained release systems or implantation device. 특정 실시태양에서, 조성물은 볼러스 (bolus) 주사에 의해, 또는 주입에 의해 연속적으로 또는 이식 장치에 의해 투여될 수 있다. In certain embodiments, the compositions may be administered by bolus (bolus) in succession by, or infusion by injection or implantation device.

특정 실시태양에서, 조성물은 목적하는 분자가 그 위해 흡수되거나 봉입된 막, 스펀지 또는 다른 적절한 물질의 이식을 통해 국소 투여될 수 있다. In certain embodiments, the composition comprises a molecule of interest can be administered topically through the implantation of an absorbent or encapsulating membrane, sponge or another appropriate material for that. 특정 실시태양에서, 이식 장치가 사용되는 경우에, 장치는 임의의 적합한 조직 또는 장기 내로 이식될 수 있고, 목적하는 분자의 전달은 확산, 시한 (timed)-방출 볼러스 또는 연속 투여를 통할 수 있다. There could work to release bolus, or continuous administration from a specific embodiment, the case where the implant use, the device may be implanted into any suitable tissue or organ, delivery of the desired molecule is spread, time (timed) .

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 제약 조성물을 생체 외 방식으로 사용하는 것이 바람직할 수 있다. In certain embodiments, the pharmaceutical compositions comprising the antigen-binding protein to PCSK9 with or independently with at least one additional therapeutic agent can be preferably used in an ex vivo manner. 상기 경우에, 환자로부터 제거된 세포, 조직 및/또는 장기를 PCSK9에 대한 항원 결합 단백질을 적어도 하나의 추가의 치료제와 함께 또는 단독으로 포함하는 제약 조성물에 노출시키고, 그 후 세포, 조직 및/또는 장기를 후속적으로 환자에게 다시 이식한다. In this case, the cells removed from a patient, tissue, and / or the long-to expose the antigen binding protein to PCSK9 at least one additional pharmaceutical composition comprising or alone with a therapeutic agent of, after which the cells, tissues and / or the re-implanted in the patient's organs subsequently.

특정 실시태양에서, PCSK9에 대한 항원 결합 단백질 및/또는 임의의 추가의 치료제는 폴리펩티드를 발현하고 분비하도록 본원에 설명된 것과 같은 방법을 사용하여 유전공학 처리된 특정 세포를 이식함으로써 전달될 수 있다. In a specific embodiment, the antigen binding to PCSK9 protein and / or therapeutic agent for any further may be delivered by implantation of a particular cell-treated gene technology using the same method as the one described herein, to express a polypeptide secretion. 특정 실시태양에서, 상기 세포는 동물 또는 인간 세포일 수 있고, 자가성, 이종성 또는 이종발생성일 수 있다. In certain embodiments, the cells may be animal or human cells, and may be self-holy sex, heterologous or heterogeneous occurs. 특정 실시태양에서, 세포는 불멸화될 수 있다. In certain embodiments, the cells may be immortalized. 특정 실시태양에서, 면역학적 반응 기회를 감소시키기 위해, 세포는 둘러싸는 조직의 침윤을 피하도록 봉입될 수 있다. In certain embodiments, in order to reduce the immunological reaction opportunities, the cells may be encapsulated to avoid infiltration of surrounding tissue is. 특정 실시태양에서, 봉입 물질은 단백질 생성물(들)의 방출을 허용하지만, 환자의 면역계에 의한 또는 둘러싸는 조직으로부터의 다른 유해 인자에 의한 세포의 파괴를 방지하는, 대개 생체적합성의 반투과성 중합성 인클로져 (enclosure) 또는 막이다. In a specific embodiment, the encapsulating materials allows the release of the protein product (s) but prevent the destruction of the cells by other harmful factors from or surrounding tissue by the immune system of a patient, typically a semi-permeable biocompatible polymeric enclosures (enclosure) or a film.

PCSK9 활성을 유의하게 중화하는 ABP의 능력에 기초하여 (하기 실시예에서 입증되는 바와 같이), 이들 ABP는 PCSK9-매개 활성에 의해 발생하는 증상 및 병태, 예를 들어 고콜레스테롤혈증의 치료 및 예방에서 치료 효과를 가질 것이다. Based on the ability of ABP to significantly neutralize PCSK9 activity (as evidenced in the Examples below), these ABP is in the symptoms and conditions, for example treatment and prevention of hypercholesterolemia generated by the active medium PCSK9- It will have a therapeutic effect.

진단 용도 For diagnostic purposes

일부 실시태양에서, ABP는 진단 도구로서 사용된다. In some embodiments, ABP is used as a diagnostic tool. ABP는 샘플 및/또는 대상 내에 존재하는 PCSK9의 양을 분석하기 위해 사용될 수 있다. ABP may be used to analyze the amount of PCSK9 present in the sample and / or destination. 당업자가 알 수 있는 바와 같이, 상기 ABP는 중화 ABP일 필요가 없다. As will be appreciated by one skilled in the art, the ABP need not be neutralized ABP. 일부 실시태양에서, 진단적 ABP는 중화 ABP가 아니다. In some embodiments, the diagnostic ABP is not a neutralizing ABP. 일부 실시태양에서, 진단적 ABP는 중화 ABP가 결합하는 에피토프와 상이한 에피토프에 결합한다. In some embodiments, the diagnostic ABP binds to an epitope different from the epitope for the neutralizing ABP binding. 일부 실시태양에서, 2개의 ABP는 서로 경쟁하지 않는다. In some embodiments, the ABP two do not compete with each other.

일부 실시태양에서, 본원에서 개시되는 ABP는 PCSK9의 수준 변화와 연관된 질병 또는 질환의 스크리닝/진단을 위해 포유동물 조직 또는 세포 내에서 PCSK9의 검출을 위한 분석 키트 및/또는 방법에서 사용되거나 제공된다. In some embodiments, ABP disclosed herein are provided or used at a level change associated with a disease or disorder of the screening / diagnosing a mammalian tissue or cell within the PCSK9 assay kit and / or method for the detection of the order of PCSK9. 키트는 PCSK9에 결합하는 ABP, 및 존재할 경우 PCSK9에 대한 ABP의 결합, 및 임의로 PCSK9 단백질 수준을 나타내기 위한 수단을 포함한다. The kit includes ABP, and binding of PCSK9 ABP on if they exist, and, optionally, means for indicating the level of PCSK9 protein that binds to PCSK9. ABP의 존재를 나타내기 위한 다양한 수단을 사용할 수 있다. You can use a variety of means to indicate the presence of ABP. 예를 들어, 형광단, 다른 분자 프로브, 또는 효소가 ABP에 연결될 수 있고, ABP의 존재는 다양한 방법으로 관찰할 수 있다. For example, a fluorophore, and the other probe molecules, or enzymes can be coupled to the ABP, the presence of ABP can be observed in a number of ways. 그러한 질환을 스크리닝하기 위한 방법은 키트의 사용, 또는 간단히 개시된 ABP 중 하나의 사용, 및 ABP가 샘플 내의 PCSK9에 결합하는지 여부의 결정을 수반할 수 있다. A method for screening for such a disease may use the kit, or simply described using one of the ABP, the ABP and may involve the determination of whether or not coupled to a PCSK9 in a sample. 당업자가 알 수 있는 바와 같이, 높은 또는 상승된 수준의 PCSK9는 샘플 내의 PCSK9에 대한 다량의 ABP 결합을 유발할 것이다. As will be appreciated by one skilled in the art, high or elevated levels of PCSK9 will cause a large amount of ABP binding to PCSK9 in a sample. 따라서, ABP 결합 정도는 얼마나 많은 PCSK9가 샘플 내에 존재하는지 결정하기 위해 사용될 수 있다. Thus, ABP coupling degree is how many PCSK9 may be used to determine that present in the sample. 소정량 (예를 들어, PCSK9 관련 질환에 걸리지 않은 사람이 가질 양 또는 범위)보다 많은 양의 PCSK9가 존재하는 대상 또는 샘플은 PCSK9 매개 질환이 존재하는 것으로 특성이 결정될 수 있다. Predetermined amount of the sample or the target of a large amount of PCSK9 is present than (e.g., PCSK9 the amount or range that takes the person to have associated diseases) can be determined by the characteristics of the PCSK9-mediated diseases present. 일부 실시태양에서, ABP는 스타틴이 대상에서 PCSK9의 양을 증가시켰는지 결정하기 위해 스타틴을 복용하는 대상에게 투여한다. In some embodiments, ABP is administered to the subject you are taking a statin to determine whether statins increased the amount of PCSK9 in a subject.

일부 실시태양에서, ABP는 비-중화 ABP이고, ABP 및/또는 스타틴 치료를 받는 대상에서 PCSK9의 양을 결정하기 위해 사용된다. In some embodiments, the ABP non- is used to determine the amount of PCSK9 in the neutralization ABP, and the target receives the ABP, and / or statin treatment.

실시예 Example

수행된 실험과 달성된 결과를 포함한 하기 실시예는 단지 예시적인 목적으로 제공되고, 본 발명을 제한하는 것으로 해석되어서는 안 된다. Embodiment to include the results achieved with the experimental example is provided to perform the illustrative purposes only, and are not to be construed as limiting the invention.

실시예 1 Example 1

면역화 및 적정 Immunization and titration

항-PCSK9 항체 및 하이브리도마의 생성 Wherein the generation of antibodies and hybridomas -PCSK9

PCSK9의 성숙형에 대한 항체 (도 1a에 서열을 도시하고, 프로-도메인을 밑줄친다)를 인간 면역글로불린 유전자를 함유하는 마우스인 XenoMouse® 마우스 (아브게닉스 (Abgenix, 미국 캘리포니아주 프레몬트))에서 생성시켰다. Antibodies to the mature form of PCSK9 (showing the sequence in Fig. 1a, Pro-beats underscore the domain) of a mouse containing a human immunoglobulin gene XenoMouse® mice (Havre to Nicks (Abgenix, Fremont, Calif.)) in was created. 2개의 군의 XenoMouse® 마우스, 즉 1군 및 2군을 사용하여 PCSK9에 대한 항체를 생성시켰다. The two groups XenoMouse® mice, that is, using the group 1 and group 2 were generated antibodies to PCSK9. 1군은 완전 인간 IgG2κ 및 IgG2λ 항체를 생산하는 XenoMouse® 주 XMG2-KL의 마우스를 포함하였다. Group 1 comprised a mouse of XenoMouse® main XMG2-KL to produce fully human antibodies IgG2κ and IgG2λ. 1군 마우스를 인간 PCSK9로 면역화시켰다. The first group of mice were immunized with human PCSK9. PCSK9는 참조로서 GenBank 서열 (NM_174936)을 사용하여 표준 재조합 기술을 이용하여 제조하였다. PCSK9 was prepared using standard recombinant techniques using the GenBank sequence (NM_174936) as the reference. 2군은 완전 인간 IgG4κ 및 IgG4λ 항체를 생산하는 XenoMouse® 주 XMG4-KL의 마우스를 포함하였다. Group 2 comprised a main XenoMouse® mice XMG4-KL to produce fully human antibodies IgG4κ and IgG4λ. 2군 마우스를 또한 인간 PCSK9로 면역화시켰다. A second group of mice were also immunized with human PCSK9.

두 군의 마우스에 표 3의 스케줄에 따라 항원을 11회 주사하였다. An antigen according to the schedule shown in Table 3 to the mice of both groups were injected 11 times. 초기 면역화시에, 각각의 마우스에 복강내 전달되는 총 10 ㎍의 항원을 복부 내로 주사하였다. In the initial immunization, a total of 10 ㎍ antigen delivered intraperitoneally in each mouse was injected into the abdomen. 후속 추가접종 (boost)은 5 ㎍ 용량이고, 주사는 복부 내로의 복강내 주사와 꼬리 기부에서의 피하 주사를 교대로 수행하였다. Subsequent booster (boost) is a 5 ㎍ capacity, scanning was carried out in turn the subcutaneous injection in the tail base injection with the abdominal cavity into the stomach. 복강내 주사를 위해, 항원은 TiterMax® Gold (시그마, Cat# T2684)를 사용하여 에멀젼으로서 제조하고, 피하 주사를 위해 항원을 알룸 (Alum) (인산알루미늄) 및 CpG 올리고와 혼합한다. For intraperitoneal injection, the antigen is TiterMax® Gold using (Sigma, Cat # T2684) prepared as an emulsion, mixed with the antigen for a hypodermic alum (Alum) (aluminum phosphate) and a CpG oligonucleotide. 주사 2 내지 8 및 10에서, 각각의 마우스에게 어주번트 알룸 겔 내의 총 5 ㎍의 항원을 주사하였다. In scanning from 2 to 8 and 10, a total of 5 ㎍ antigen in the adjuvant alum gel eoju was injected to each mouse. 마우스 당 5 ㎍의 항원의 최종 주사를 Phospho 완충 염수 내에서 전달하고, 2개의 부위로, 즉 복부로 50% IP 및 꼬리 기부에서 50% SQ로 전달하였다. A final injection of antigen per mouse in 5 ㎍ Phospho buffered saline to pass, and the two parts, that were passed from 50% IP and the tail base with the stomach by 50% SQ. 면역화 프로그램을 하기 표 3에 요약한다. An immunization program are summarized in Table 3.

Figure pat00003

XenoMouse 동물의 적정을 위해 사용된 프로토콜은 다음과 같았다: 코스타(Costar) 3368 배지 결합 플레이트를 8 ㎍/ml의 뉴트라바딘 (50 ㎕/웰)으로 코팅하고, 4℃에서 1XPBS/O.05% 아지드 내에서 밤새 인큐베이팅하였다. The protocol used for titration of the XenoMouse animal was as follows: Costa (Costar) coated with a 3368 medium binding plates 8 ㎍ / Nutra badin (50 ㎕ / well) in ml, and 1XPBS / O.05% at 4 ℃ O in the azide it was incubated overnight. 이들을 RO 수를 사용하는 타이터테크(TiterTek) 3-사이클 세척을 이용하여 세척하였다. It was washed with a titer Tech (TiterTek) 3- washing cycle that uses the RO. 플레이트를 250 ㎕의 1XPBS/1% 우유를 사용하여 차단하고, 적어도 30분 동안 RT에서 인큐베이팅하였다. A blocking plate using a 250 ㎕ 1XPBS / 1% milk, and the mixture was incubated at RT for at least 30 minutes. 블록을 RO 수를 사용하는 타이터테크 3-사이클 세척을 이용하여 세척 제거하였다. Block was removed by washing the titer Tech 3-washing cycle that uses the RO. 이어서, 1XPBS/1% 우유/10 mM Ca 2+ (분석 희석제) 중의 2 ㎍/ml의 b-인간 PCSK9 (50 ㎕/웰)를 포획하고, 1 hr 동안 RT에서 인큐베이팅하였다. Were then incubated in 1XPBS / 1% milk / 10 mM Ca 2+ (analysis diluent) 2 ㎍ / ml of b- human PCSK9 (50 ㎕ / well) and trapping, RT for 1 hr in the. 이어서, RO 수를 사용하는 타이터테크 3-사이클 세척을 이용하여 세척하였다. It was then washed with a titer Tech 3-cycle wash that uses the RO. 1차 항체에 대해, 혈청을 1:100으로부터 이중으로 1:3 적정하였다. For the primary antibody, the serum 1: 1 with double from 100: 3 was adjusted. 이를 분석 희석제 (50 ㎕/웰) 내에서 수행하고, 1 hr 동안 RT에서 인큐베이팅하였다. Do this in the analysis of a diluent (50 ㎕ / well), and the mixture was incubated at RT for 1 hr. 이어서, RO 수를 사용하는 타이터테크 3-사이클 세척을 이용하여 세척하였다. It was then washed with a titer Tech 3-cycle wash that uses the RO. 2차 항체는 분석 희석제 중의 400 ng/ml의 염소 항-인간 IgG Fc HRP (50 ㎕/웰)이었다. Secondary antibody is goat anti of 400 ng / ml in diluent analysis - was a human IgG Fc HRP (50 ㎕ / well). 이것을 1 hr 동안 RT에서 인큐베이팅하였다. This was incubated for 1 hr at RT. 이어서, 이를 RO 수를 사용하는 타이터테크 3-사이클 세척을 이용하여 세척하고, 종이 타월 상에서 두드려서 건조시켰다. Then, it was washed by using the titer Tech 3-cycle washing using the RO water and dried by tapping on a paper towel. 기질에 대해, 1단계 TMB 용액 (네오겐 (Neogen, 미국 켄터키주 렉싱톤))을 사용하고 (50 ㎕/웰), 이를 30분 동안 RT에서 발색시켰다. To the substrate, 1 step TMB solution (Neogen (Neogen, Lexington, Kentucky, United States)), and using (50 ㎕ / well) and was color-developing them at RT for 30 min.

ELISA 분석에서 따른 프로토콜은 다음과 같았다: V5His 태그가 없는 b-PCSK.9를 포함하는 샘플에 대해, 다음 프로토콜을 사용하였다: 코스타 3368 배지 결합 플레이트 (코닝 라이프 사이언시스 (Corning Life Sciences))를 사용하였다. In accordance with the protocol ELISA assays were as follows: for samples containing b-PCSK.9 V5His there is no tag, and use the following protocol: Use the Costa 3368 medium binding plates (Corning Life Scientology system (Corning Life Sciences)) It was. 플레이트를 1XPBS/0.05% 아지드 중의 8 ㎍/ml의 뉴트라바딘 (50 ㎕/웰)으로 코팅하였다. Plates were coated with Nutra badin (50 ㎕ / well) for 8 ㎍ / ml in 1XPBS / 0.05% azide. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 타이터테크 M384 플레이트 세척기 (타이터테크 (Titertek, 미국 앨라배마주 헌츠빌))를 사용하여 세척하였다. It was then washed using the M384 Tech titer plate washer (titer Tech (Titertek, Huntsville, Alabama, USA)) plate. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 250 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 1XPBS / 1% milk in 250 ㎕, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 M384 플레이트 세척기로 세척하였다. Then, the plate was washed with M384 plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 포획 샘플은 V5 태그가 없는 b-hu PCSK9이고, 1XPBS/1% 우유/10 mM Ca 2+ 중의 2 ㎍/ml (40 ㎕/웰)로 첨가하였다. Take a sample was added to the V5 tag, and the b-hu PCSK9-free, 1XPBS / 1% milk / 10 mM Ca 2+ 2 ㎍ / ml (40 ㎕ / well) in the. 이어서, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 혈청을 1:100으로부터 이중으로 1:3 적정하고, H열은 혈청에 대해 블랭크 (blank)였다. In duplicate from 100: 1: 13 serum titration and, H column was blank (blank) for the serum. 적정은 분석 희석제 내에서 50 ㎕/웰의 부피로 수행하였다. Proper analysis was carried out in a diluent to 50 ㎕ / volume of the well. 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. The plate was incubated at room temperature for 1 hour. 이어서, 3-사이클 세척을 수행하였다. Then, it was carried out three-cycle washing. 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 염소 항-인간 IgG Fc HRP (50 ㎕/웰)를 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 2+ 100 ng / ml of (1: 4000) of goat anti-human IgG Fc was added to HRP (50 ㎕ / well) to the plate, which was incubated at room temperature for 1 hour. 플레이트를 3-사이클 세척을 사용하여 다시 1회 세척하였다. The plate was washed once again using the 3-cycle washing. 이어서, 플레이트를 종이 타월로 두드려서 건조시켰다. Then, the plate was dried by tapping on a paper towel. 마지막으로, 1단계 TMB (네오겐) (50 ㎕/웰)를 플레이트에 첨가하고, 1N 염산 (50 ㎕/웰)로 30분 후에 실온에서 켄칭(quenching)하였다. Finally, the quenched (quenching) at room temperature in 30 minutes by TMB (Neogen) was added (50 ㎕ / well) to the plates, and 1N hydrochloric acid (50 ㎕ / well) Step 1. OD는 타이터테크 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. OD is titer was read immediately at 450 nm using a plate reader Tech.

플레이트 결합된 PCSK9를 검출하기 위한 양성 대조군은 분석 희석제 내에 3 ㎍/ml로부터 이중으로 1:3 적정한 가용성 LDL 수용체 (R&D 시스템즈 (R&D Systems), Cat #2148LD/CF) 및 폴리클로날 토끼 항-PCSK9 항체 (케이멘 케미칼 (Caymen Chemical) #10007185)이었다. Positive control for detecting the plate-bonded PCSK9 is in duplicate from 3 ㎍ / ml in the analyzed diluent 1:03 suitable soluble LDL receptor (R & D Systems (R & D Systems), Cat # 2148LD / CF) and a polyclonal rabbit anti--PCSK9 antibodies were (Cayman Chemical (Caymen Chemical) # 10007185). LDLR은 염소 항-LDLR (R&D 시스템즈, Cat #AF2148) 및 토끼 항-염소 IgGFc HRP를 400 ng/ml의 농도로 사용하여 검출하였고; LDLR is goat anti -LDLR (R & D Systems, Cat # AF2148) and rabbit anti-goat HRP was detected using the IgGFc to 400 ng / ml concentration of; 토끼 폴리클로날 항체는 염소 항-토끼 IgG Fc를 분석 희석제 중에 400 ng/ml의 농도로 사용하여 검출하였다. Rabbit polyclonal antibody is goat anti-were detected with a concentration of 400 ng / ml of rabbit IgG Fc in the analyzed diluent. 음성 대조군은 분석 희석제 중에 1:100으로부터 이중으로 1:3 적정한 나이브 (naive) XMG2-KL 및 XMG4-KL 혈청이었다. The negative control group was first analyzed in the diluent: double from 100 1: 3 was reasonable naive (naive) XMG2 and XMG4-KL-KL serum.

V5His 태그가 없는 b-PCSK9를 포함하는 샘플에 대해, 다음 프로토콜을 사용하였다: 코스타 3368 배지 결합 플레이트 (코닝 라이프 사이언시스)를 사용하였다. For the sample containing the b-V5His tagged PCSK9-free, it was used the following protocol was used for Costa 3368 medium binding plates (Corning Life cyan system). 플레이트를 1XPBS/0.05% 아지드 중의 8 ㎍/ml의 뉴트라바딘 (50 ㎕/웰)으로 코팅하였다. Plates were coated with Nutra badin (50 ㎕ / well) for 8 ㎍ / ml in 1XPBS / 0.05% azide. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 타이터테크 M384 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)로 세척하였다. Subsequently, the plates were washed with titer Tech M384 plate washer (Titertek, Huntsville, Alabama, United States). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 250 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 1XPBS / 1% milk in 250 ㎕, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 M384 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a plate washer M384. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 포획 샘플은 V5 태그가 있는 b-hu PCSK9이고, 1XPBS/1% 우유/10 mM Ca 2+ 중에 2 ㎍/ml (40 ㎕/웰)로 첨가하였다. Take a sample was added to the b-hu PCSK9 and, 1XPBS / 1% 2 ㎍ / ml (40 ㎕ / well) in the milk / 10 mM Ca 2+ with a V5 tag. 이어서, 플레이트를 1 시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 혈청을 1:100으로부터 이중으로 1:3 적정하였고, H열은 혈청에 대해 블랭크였다. Double as one from 100: 1 was a serum titration 3, H column was a blank for serum. 적정은 분석 희석제 내에서 50 ㎕/웰의 부피로 수행하였다. Proper analysis was carried out in a diluent to 50 ㎕ / volume of the well. 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. The plate was incubated at room temperature for 1 hour. 다음으로, 플레이트를 3-사이클 세척을 사용하여 작동되는 M384 플레이트 세척기를 사용하여 세척하였다. Next, the plate was washed using a plate washer M384 is operated using 3-cycle washing. 1XPBS/1% 우유/10 mM Ca 2+ 중의 400 ng/ml의 염소 항-인간 IgG Fc HRP를 50 ㎕/웰로 플레이트에 첨가하고, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 400 ng / ml of goat anti of 2+ was added to human IgG Fc HRP for 50 ㎕ / well of the plate, followed by incubating the plate at room temperature for 1 hour. 플레이트를 3-사이클 세척을 사용하여 다시 1회 세척하였다. The plate was washed once again using the 3-cycle washing. 이어서, 플레이트를 종이 타월로 두드려서 건조시켰다. Then, the plate was dried by tapping on a paper towel. 마지막으로, 1단계 TMB (네오겐) (50 ㎕/웰)를 플레이트에 첨가하고, 플레이트를 1N 염산 (50 ㎕/웰)으로 30분 후에 실온에서 켄칭하였다. Finally, in step 1 TMB (Neogen) (50 ㎕ / well) after addition to the plate, 30 plates with 1N hydrochloric acid (50 ㎕ / well) was quenched at room temperature. OD를 타이터테크 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. And the OD using a titer plate reader TECH was immediately read at 450 nm.

양성 대조군은 분석 희석제 내에 3 ㎍/ml로부터 이중으로 1:3 적정한 LDLR 및 토끼 항-PCSK9이었다. The positive control group was of a double from 3 ㎍ / ml in the analyzed diluent 1:03 was appropriate LDLR and rabbit anti -PCSK9. LDLR은 염소 항-LDLR (R&D 시스템즈, Cat #AF2148) 및 토끼 항-염소 IgG Fc HRP를 400 ng/ml의 농도로 사용하여 검출하고; LDLR is goat anti -LDLR (R & D Systems, Cat # AF2148) and rabbit anti-goat IgG Fc and detected using HRP as 400 ng / ml concentration of; 토끼 폴리클로날 항체는 염소 항-토끼 IgG Fc를 분석 희석제 중의 400 ng/ml의 농도로 사용하여 검출하였다. Rabbit polyclonal antibody is goat anti-rabbit IgG Fc was detected using a concentration of 400 ng / ml in diluent analysis. 인간 항-His 1.2,3 및 항-V5 1.7.1을 분석 희석제 내에 1 ㎍/ml로부터 이중으로 1:3 적정하고; Human anti -His 1.2,3 and wherein the double -V5 1.7.1 from 1 ㎍ / ml in the analyzed diluent 1:03 and titration; 둘 모두 염소 항-인간 IgG Fc HRP를 분석 희석제 중에 400 ng/ml의 농도로 사용하여 검출하였다. Both goat anti-were detected with a concentration of 400 ng / ml human IgG Fc HRP diluent in the analysis. 음성 대조군은 분석 희석제 내에 1:100으로부터 이중으로 1:3 적정한 나이브 XMG2-KL 및 XMG4-KL 혈청이었다. The negative control group was first analyzed in the diluent: double from 100 1: 3 was reasonable naive XMG2 and XMG4-KL-KL serum.

인간 PCSK9에 대한 항체의 역가는 기재된 바와 같은 가용성 항원으로 면역화시킨 마우스에 대한 ELISA 분석에 의해 시험하였다. For mice immunized with soluble antigen as described inverse of antibody titer against human PCSK9 it was tested by ELISA analysis. 표 4에 ELISA 데이타를 요약하였고, 이는 PCSK9에 특이적인 것으로 나타난 몇몇 마우스가 존재함을 나타낸다. ELISA data were summarized in Table 4, which indicates that some of the mice there appears to be specific for PCSK9. 예를 들어, 표 4를 참조한다. For example, reference is made to Table 4 below. 따라서, 면역화 프로그램의 끝에, 수확을 위해 10마리의 마우스 (표 4에서 굵은 글씨체)를 선택하고, 비장세포 및 림프구를 본원에서 설명되는 바와 같이 각각 비장 및 림프절로부터 단리하였다. Thus, at the end of the immunization program, to select the harvest of 10 mice (bold in Table 4), and spleen cells and lymphocytes were isolated from the splenic and lymph node, respectively, as described herein.

Figure pat00004

실시예 2 Example 2

림프구의 회수, B-세포 단리, 융합 및 하이브리도마의 생성 Recovery of lymphocytes, B- cells is isolated, the generation of fusion and hybridoma

본 실시예에서는 면역 세포를 수확하고 하이브리도마를 생성하는 방법을 개략한다. In this embodiment, a schematic method for harvesting immune cells to generate hybridomas. 선택된 면역화된 마우스를 경추 탈골에 의해 희생시키고, 배액 (draining) 림프절을 수확하고 각각의 코호트 (cohort)로부터 모았다. Were sacrificed by cervical dislocation on the selected immunized mouse, harvesting the drained (draining) lymph nodes are collected from each cohort (cohort). DMEM 내에서 연마하여 조직으로부터 세포를 방출시킴으로써 B 세포를 림프 조직으로부터 분리시키고, 세포를 DMEM 내에 현탁시켰다. By grinding in DMEM to release the cells from the tissue to remove the B cells from lymphoid tissue and the cells were suspended in DMEM. 세포를 계수하고, 1억개의 림프구당 0.9 ml DMEM을 세포 펠렛에 첨가하여 세포를 부드럽지만 완전히 재현탁시켰다. Counting the cells, and the addition of 0.9 ml DMEM per 100 million lymphocytes in the cell pellet and the cells smoothly, but had suspended completely reproduced.

림프구를 ATCC로부터 구입한 비분비형 골수종 P3X63Ag8.653 세포 (cat.# CRL 1580) (Kearney et al., (1979) J. Immunol. 123, 1548-1550)와 1:4의 비로 혼합하였다. Were mixed at a ratio of 4: splitless purchased from ATCC-free lymphocytes myeloma P3X63Ag8.653 cells (. Cat # CRL 1580) (.. Kearney et al, (1979) J. Immunol 123, 1548-1550) and 1. 세포 혼합물을 400 xg에서 4 분 원심분리에 의해 부드럽게 펠렛화하였다. The cell mixture was gently pelleted by 4 minutes' centrifugation at 400 xg. 상등액을 따라낸 후, 1 ml 피펫을 사용하여 세포를 부드럽게 혼합하였다. After taking along the supernatant, the cells were gently mixed using a 1 ml pipette. 예열시킨 PEG/DMSO 용액 (시그마, cat# P7306) (1백만 개의 B-세포당 1 ml)을 1 분에 걸쳐 부드럽게 교반하면서 서서히 첨가한 후, 1 분 혼합하였다. PEG / DMSO solution was warmed up (Sigma, cat # P7306) was slowly added with (B- 1 million cells per 1 ml) and stirring gently over 1 min, mixed for one minute. 이어서, 예열시킨 IDMEM (1백만 개의 B 세포당 2 ml) (글루타민이 없는 DMEM, L-글루타민, pen/strep, MEM 비-필수 아미노산 (모두 인비트로겐으로부터)을 부드럽게 교반하면서 2분에 걸쳐 첨가하였다. 마지막으로 예열시킨 IDMEM (10 6 개의 B-세포당 8 ml)을 3분에 걸쳐 첨가하였다. Then, the warm-up was IDMEM (1 ml per 2 million B cells) (DMEM, L- glutamine, pen / strep, glutamine, MEM non-free were as essential amino acids (all stirred gently from Invitrogen) was added over 2 min . the last IDMEM (10 6 of 8 ml per B- cells) was preheated was added over a period of 3 minutes.

융합된 세포를 400 xg에서 6 분 원심분리하고, 1백만 개의 B-세포당 20 ml 선택 배지 (DMEM (인비트로겐), L-글루타민을 보충한 15% FBS (하이클론 (Hyclone)), pen/strep, MEM 비-필수 아미노산, 피루브산나트륨, 2-머캅토에탄올 (모두 인비트로겐으로부터), HA-아자세린 하이포잔틴 및 OPI (옥살로아세테이트, 피루베이트, 소 인슐린) (둘 모두 시그마) 및 IL-6 (뵈링거 만하임 (Boehringer Mannheim))) 내에 재현탁시켰다. Separating 6 minutes centrifugation at 400 xg, and the fused cells, 20 ml selection per million B- cell medium (DMEM (Invitrogen), 15% FBS supplemented with L- glutamine (High Clone (Hyclone)), pen / strep, MEM non-essential amino acids, sodium pyruvate, 2-mercaptoethanol (all from Invitrogen), HA- aza serine hypoxanthine and OPI (oxaloacetic acetate, pyruvate, bovine insulin) (both Sigma) and IL- 6 was resuspended in (boe ringer Mannheim (Boehringer Mannheim))). 세포를 20-30 분 동안 37℃에서 인큐베이팅한 후, 200 ml의 선택 배지 내에 재현탁시키고, 3-4일 동안 T175 플라스크 내에서 배양한 후 96웰 플레이팅하였다. After incubating the cells at 37 ℃ for 20-30 minutes, they were plated to 96-well and then resuspended, in the T175 culture flask for 3-4 days in a selective medium in 200 ml. 따라서, PCSK9에 대한 항원 결합 단백질을 생산하는 하이브리도마가 생산되었다. Thus, a hybridoma which produces an antigen-binding protein of the PCSK9 were produced.

실시예 3 Example 3

PCSK9 항체의 선택 Selection of PCSK9 Antibody

본 실시예에서는 다양한 PCSK9 항원 결합 단백질을 특성결정하고 선택하는 방법을 개략한다. In this embodiment, a schematic of a method for determining and selecting the various PCSK9 antigen binding protein characteristics. PCSK9에 대한 분비형 항체 (실시예 1 및 2에서 생산된 하이브리도마로부터 생산됨)의 결합을 평가하였다. They were evaluated for binding of the secreted antibody (for example 1 and being produced from a hybridoma produced in 2) to PCSK9. 항체의 선택은 LDLR에 대한 PCSK9 결합의 결합 데이타 및 억제, 및 친화도에 기반하였다. The choice of the antibody was based on the binding of PCSK9 binding to the LDLR data and suppressed, and affinity. 가용성 PCSK9에 대한 결합은 아래 설명된 바와 같이 ELISA에 의해 분석하였다. Binding to soluble PCSK9 was analyzed by ELISA as described below. 비아코어® (표면 플라스몬 공명)을 사용하여 결합 친화도를 정량하였다. Using the Biacore ® (surface plasmon resonance) was assayed for binding affinity.

일차 스크린 The primary screen

야생형 PCSK9에 결합하는 항체에 대한 1차 스크린을 수행하였다. It was carried out primary screen for antibodies which bind to the wild-type PCSK9. 1차 스크린을 2개의 수확물에 대해 수행하였다. The primary screen 2 was performed for the two crops. 1차 스크린은 ELISA 분석을 포함하고, 다음 프로토콜을 사용하여 수행하였다: The primary screen was performed, including ELISA assays, using the following protocol:

코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 사용하였다. Costa 3702 medium binding 384-well plates (Corning Life cyan system) was used. 플레이트를 1XPBS/0.05% 아지드 중의 4 ㎍/ml 농도의 뉴트라바딘 (40 ㎕/웰의 부피)으로 코팅하였다. Plates were coated with Nutra badin (40 ㎕ / volume of the well) in 1XPBS / 0.05% ah 4 ㎍ / ml concentration of azide. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 타이터테크 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Subsequently, the plate was washed using a titer plate washer Tech (Titertek, Huntsville, Alabama, United States). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 플레이트를 다시 세척하였다. The plates were washed again. 다시, 3-사이클 세척을 수행하였다. Again, it was carried out the three-cycle washing. 포획 샘플은 V5 태그가 없는 비오티닐화된-PCSK9이었고, 1XPBS/1% 우유/10 mM Ca 2+ 중에 0.9 ㎍/ml (40 ㎕/웰의 부피)로 첨가하였다. Take a sample was added to V5 was biotinylated -PCSK9 tag-free, 1XPBS / 1% milk / 10 mM Ca 0.9 ㎍ / ml (40 ㎕ / volume of the well) in the 2+. 이어서, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 다음으로, 플레이트를 3-사이클 세척을 사용하여 작동되는 타이터테크 플레이트 세척기를 사용하여 세척하였다. Next, the plate was washed using a plate washer titer Tech operated using 3-cycle washing. 10 ㎕의 상등액을 40 ㎕의 1XPBS/1% 우유/10 mM Ca 2+ 내로 옮기고, 1.5시간 동안 실온에서 인큐베이팅하였다. The supernatant was transferred into a 10 ㎕ 1XPBS / 1% milk / 10 mM Ca 2+ for 40 ㎕, was incubated at room temperature for 1.5 hours. 다시, 플레이트를 3-사이클 세척을 사용하여 작동되는 타이터테크 플레이트 세척기를 사용하여 세척하였다. Again, the plate was washed using a plate washer titer Tech operated using 3-cycle washing. 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 농도의 40 ㎕/웰의 염소 항-인간 IgG Fc POD를 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 2+ 100 ng / ml of (1: 4000) of goat 40 ㎕ / well of the concentration of anti-human IgG Fc POD was added to the plate, which was incubated at room temperature for 1 hour. 플레이트를 3-사이클 세척을 사용하여 다시 1회 세척하였다. The plate was washed once again using the 3-cycle washing. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산을 사용하는 켄칭을 30분 후에 실온에서 수행하였다. Finally, the addition of the quench 40 ㎕ / step 1 of the well TMB (Neogen) to the plate, the use of 1N hydrochloric acid 40 ㎕ / well was performed at room temperature in 30 minutes. OD를 타이터테크 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. And the OD using a titer plate reader TECH was immediately read at 450 nm.

1차 스크린으로 총 3104개의 항원 특이적 하이브리도마를 2개의 수확물로부터 확인하였다. The primary screen identified a total of 3104 of antigen specific hybridomas from two crops. 가장 높은 ELISA OD에 기초하여, 수확물당 1500개의 하이브리도마를 총 3000개의 양성물에 대해 진행시켰다. Based on the high ELISA OD, it was conducted for the 1500 hybridomas per harvest in 3000 positive water gun.

확인 스크리닝 Check screening

이어서, 안정한 하이브리도마가 확립된 것을 확인하기 위해 3000개의 양성물을 야생형 PCSK9에 대한 결합에 대해 재스크리닝하였다. Then, the material was screened for the 3000-positive wild-type PCSK9 binding to the water to ensure that the stable hybridoma is established. 스크리닝은 다음과 같이 수행하였다: 코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 사용하였다. Screening was performed as follows: was used for Costa 3702 medium binding 384-well plates (Corning Life cyan system). 플레이트를 1XPBS/0.05% 아지드 중의 3 ㎍/ml의 뉴트라바딘 (40 ㎕/웰의 부피)으로 코팅하였다. Were coated with a 1XPBS / 0.05% ah Nutra badin (40 ㎕ / volume of the well) of 3 ㎍ / ml of the azide plate. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 타이터테크 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Subsequently, the plate was washed using a titer plate washer Tech (Titertek, Huntsville, Alabama, United States). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 M384 플레이트 세척기로 세척하였다. Then, the plate was washed with M384 plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 포획 샘플은 V5 태그가 없는 b-PCSK9이고, 1XPBS/1% 우유/10 mM Ca 2+ 중의 0.9 ㎍/ml로 40 ㎕/웰의 부피로 첨가하였다. Take samples and b-PCSK9 without a V5 tag, a 0.9 ㎍ / ml in 1XPBS / 1% milk / 10 mM Ca 2+ was added to 40 ㎕ / volume of the well. 이어서, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 다음으로, 플레이트를 3-사이클 세척을 이용하여 세척하였다. Next, the plate was washed with a 3-cycle washing. 10 ㎕의 상등액을 40 ㎕의 1XPBS/1% 우유/10 mM Ca 2+ 내로 옮기고, 1.5시간 동안 실온에서 인큐베이팅하였다. The supernatant was transferred into a 10 ㎕ 1XPBS / 1% milk / 10 mM Ca 2+ for 40 ㎕, was incubated at room temperature for 1.5 hours. 다시, 플레이트를 3-사이클 세척을 사용하여 작동되는 타이터테크 플레이트 세척기를 사용하여 세척하였다. Again, the plate was washed using a plate washer titer Tech operated using 3-cycle washing. 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 농도의 40 ㎕/웰의 염소 항-인간 IgG Fc POD를 플레이트에 첨가하고, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 2+ 100 ng / ml of (1: 4000) of goat 40 ㎕ / well of the concentration of anti-human IgG Fc POD was added to the plate and incubating the plates at room temperature for one hour It was. 플레이트를 3-사이클 세척을 사용하여 작동되는 Titertek 플레이트 세척기를 사용하여 다시 1회 세척하였다. Using the Titertek plate washer that the operation plate using 3-cycle wash washed once again. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산으로 30분 후에 실온에서 켄칭하였다. Finally, 40 ㎕ / step 1 of the well TMB (Neogen) after the addition of the plates, and 30 minutes, and 1N hydrochloric acid in 40 ㎕ / well was quenched at room temperature. OD는 Titertek 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. OD was read immediately at 450 nm using a Titertek plate reader. 총 2441개의 양성을 제2 스크린에서 반복하였다. A total of 2441 training was repeated in a second screen. 이어서, 이들 항체를 후속적인 스크리닝에서 사용하였다. Subsequently, these antibodies were used in subsequent screening.

마우스 교차-반응성 스크리닝 Mouse cross-reactivity screening

이어서, 하이브리도마의 패널을 항체가 인간 및 마우스 PCSK9 모두에 결합할 수 있는지를 확인하기 위해 마우스 PCSK9에 대한 교차-반응성에 대해 스크리닝하였다. Then, the cross on the mouse PCSK9 to ensure that the panel of hybridoma antibodies can bind to both human and mouse PCSK9 - were screened for reactivity. 다음 프로토콜을 교차-반응성 스크리닝에서 사용하였다: 코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 사용하였다. The following protocol cross-reactivity was used in the screening was used for Costa 3702 medium binding 384 well plates (Corning Life Scientific System). 플레이트를 1XPBS/0.05% 아지드 중의 3 ㎍/ml의 뉴트라바딘 (40 ㎕/웰의 부피)으로 코팅하였다. Were coated with a 1XPBS / 0.05% ah Nutra badin (40 ㎕ / volume of the well) of 3 ㎍ / ml of the azide plate. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 Titertek 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer (Titertek, Huntsville, Alabama, USA). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 포획 샘플은 비오티닐화된-마우스 PCSK9이고, 1XPBS/1% 우유/10 mM Ca 2+ 중의 1 ㎍/ml로 40 ㎕/웰의 부피로 첨가하였다. Was added to a mouse PCSK9, 1XPBS / 1% milk / 10 mM Ca 1 ㎍ / 40 ㎕ in ml / volume of the wells of the 2 + - takes samples biotinylated. 이어서, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 다음으로, 플레이트를 3-사이클 세척을 사용하여 작동되는 Titertek 플레이트 세척기를 사용하여 세척하였다. Next, the plate was washed using a Titertek plate washer operated using 3-cycle washing. 50 ㎕의 상등액을 플레이트로 옮기고, 1시간 동안 실온에서 인큐베이팅하였다. Transfer the supernatant of the 50 ㎕ the plate was incubated at room temperature for 1 hour. 다시, 플레이트를 3-사이클 세척을 이용하여 세척하였다. Again, the plate was washed with a 3-cycle washing. 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 농도의 40 ㎕/웰의 염소 항-인간 IgG Fc POD를 플레이트에 첨가하고, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 2+ 100 ng / ml of (1: 4000) of goat 40 ㎕ / well of the concentration of anti-human IgG Fc POD was added to the plate and incubating the plates at room temperature for one hour It was. 플레이트를 3-사이클 세척을 사용하여 다시 1회 세척하였다. The plate was washed once again using the 3-cycle washing. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산으로 30분 후에 실온에서 켄칭하였다. Finally, 40 ㎕ / step 1 of the well TMB (Neogen) after the addition of the plates, and 30 minutes, and 1N hydrochloric acid in 40 ㎕ / well was quenched at room temperature. OD를 Titertek 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. The OD was read immediately at 450 nm using a Titertek plate reader. 579개의 항체가 마우스 PCSK9와 교차-반응하는 것으로 관찰되었다. 579 antibodies are intersecting and mouse PCSK9 - has been observed to respond. 이어서, 이들 항체를 후속적인 스크리닝에서 사용하였다. Subsequently, these antibodies were used in subsequent screening.

D374Y 돌연변이체 결합 스크리닝 D374Y mutant binding screening

PCSK9에서 D374Y 돌연변이는 인간 집단에서 보고되었다 (예를 들어, [Timms KM et al., "A muntation in PCSK9 causing autosomal-dominant hypercholesterolemia in a Utah pedigree", Hum. Genet. 114: 349-353, 2004]). D374Y mutation in PCSK9 has been reported in the human population (e.g., [Timms KM et al, "A muntation in PCSK9 causing autosomal-dominant hypercholesterolemia in a Utah pedigree", Hum Genet 114:... 349-353, 2004] ). 이어서, 항체가 야생형에 특이적인지 또는 PCSK9의 D374Y 형태에 결합되는지 결정하기 위해서, 샘플을 돌연변이 D374Y를 포함하는 돌연변이체 PCSK9 서열에 대한 결합에 대해 스크리닝하였다. Then, the antibody to determine binding to D374Y form of jeokinji specific for wild type or PCSK9, were screened for binding the sample to the mutant PCSK9 sequence containing the mutation D374Y. 스크리닝을 위한 프로토콜은 다음과 같았다: 코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 스크리닝에서 사용하였다. Protocols for screening was as follows: Costa 3702 medium binding 384 well plates (Corning Life Scientific System) was used in the screening. 플레이트를 1XPBS/0.05% 아지드 중의 4 ㎍/ml의 뉴트라바딘 (40 ㎕/웰의 부피)으로 코팅하였다. Were coated with a 1XPBS / 0.05% ah Nutra badin (40 ㎕ / volume of the well) of 4 ㎍ / ml of the azide plate. 플레이트를 40℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 40 ℃. 이어서, 플레이트를 Titertek 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer (Titertek, Huntsville, Alabama, USA). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 1XPBS/1% 우유/10 mM Ca 2+ 중의 1 ㎍/ml 농도의 비오티닐화된 인간 PCSK9 D374Y로 코팅하고, 1시간 동안 실온에서 인큐베이팅하였다. Coating a plate with 1XPBS / 1% milk / 10 mM Ca 1 ㎍ / ml concentration of biotinylated human PCSK9 D374Y of 2+, and the mixture was incubated at room temperature for 1 hour. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 마지막의 고갈 (exhaust) 하이브리도마 배양 상등액을 PBS/우유/Ca 2+ 내에 1:5 (10 ml + 40 ml)로 희석하고, 1시간 동안 실온에서 인큐베이팅하였다. The end of the run out (exhaust) hybridoma culture supernatant in 1 PBS / milk / Ca 2+: diluted to 5 (10 ml + 40 ml), and the mixture was incubated at room temperature for 1 hour. 다음으로, 1XPBS/1% 우유/10 mM Ca 2+ 중의 1 ㎍/ml의 40 ㎕/웰의 토끼 항-인간 PCSK9 (케이만 케미칼 (Cayman Chemical)) 및 인간 항-His 1.2.3 1:2를 플레이트 상으로 적정한 후, 1시간 동안 실온에서 인큐베이팅하였다. Next, 1XPBS / 1% milk / 10 mM Ca 2+ 1 ㎍ / ml of 40 ㎕ / well of rabbit anti-in-human PCSK9 (Cayman Chemical (Cayman Chemical)), and human anti--His 1.2.3 1: 2 after proper to the plate, and incubated at room temperature for 1 hour. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 농도의 40 ㎕/웰의 염소 항-인간 IgG Fc HRP를 플레이트에 첨가하고, 플레이트 1시간 동안 실온에서 인큐베이팅하였다. It was incubated at room temperature for the addition of the human IgG Fc HRP to the plate and the plate one hour (4000 1) of 40 ㎕ / well of a chlorine concentration of 1XPBS / 1% milk / 10 mM Ca 100 ng / ml of 2+ . 1XPBS/1% 우유/10 mM Ca 2+ 중의 100 ng/ml (1:4000)의 농도의 40 ㎕/웰의 염소 항-토끼 IgG Fc HRP를 플레이트에 첨가하고, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. 1XPBS / 1% milk / 10 mM Ca 100 ng / ml of 2+ (1: 4000) 40 ㎕ / well of goat anti of the concentration of - the addition of rabbit IgG Fc HRP to the plate and incubating the plates at room temperature for one hour It was. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산으로 30분 후에 실온에서 켄칭하였다. Finally, 40 ㎕ / step 1 of the well TMB (Neogen) after the addition of the plates, and 30 minutes, and 1N hydrochloric acid in 40 ㎕ / well was quenched at room temperature. OD를 Titertek 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. The OD was read immediately at 450 nm using a Titertek plate reader. 야생형 PCSK9에 대한 양성 적중의 96% 초과 항체가 돌연변이체 PCSK9에도 결합하였다. 96% excess of the antibody-positive hit for a wild-type PCSK9 were coupled to mutant PCSK9.

대규모 수용체 리간드 차단 스크리닝 Large blocking receptor ligand screening

LDLR에 대한 PCSK9 결합을 차단하는 항체를 스크리닝하기 위해, D374Y PCSK9 돌연변이체를 사용하는 분석을 개발하였다. In order to screen for antibodies that block PCSK9 binding to the LDLR, it developed the analysis using D374Y PCSK9 mutants. 상기 분석을 위해 돌연변이체를 사용하였고, 이는 LDLR에 대해 보다 높은 결합 친화도를 가져서 보다 예민한 수용체 리간드 차단 분석이 개발할 수 있기 때문이다. Was used as a mutant for the assay, since a more sensitive analysis of receptor ligands blocked develop gajyeoseo a higher binding affinity for LDLR. 다음 프로토콜을 수용체 리간드 차단 스크리닝에서 사용하였다: 코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 스크리닝에서 사용하였다. The following protocol was used in the receptor-ligand blocking screening: the Costa 3702 medium binding 384-well plates (Corning Life cyan system) was used in the screening. 플레이트를 1XPBS/0.05% 아지드 중의 2 ㎍/ml의 염소 항-LDLR (R&D, Cat #AF2148) (40 ㎕/웰의 부피)로 코팅하였다. Plates were coated with 1XPBS / 0.05% O 2 ㎍ / ml goat anti -LDLR (R & D, Cat # AF2148) (40 ㎕ / volume of the well) of the azide. 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 Titertek 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer (Titertek, Huntsville, Alabama, USA). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 포획 샘플은 LDLR (R&D, Cat #2148LD/CF)이었고, 1XPBS/1% 우유/10 mM Ca 2+ 중의 0.4 ㎍/ml로 40 ㎕/웰의 부피로 첨가하였다. Take a sample was added to LDLR (R & D, Cat # 2148LD / CF) was, 1XPBS / 1% milk / 10 mM Ca 40 ㎕ / volume of the well with 0.4 ㎍ / ml in 2 +. 이어서, 플레이트를 1시간 10분 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 10 minutes and 1 hour. 동시에, 20 ng/ml의 비오티닐화된 인간 D374Y PCSK9를 Nunc 폴리프로필렌 플레이트 내에서 15 마이크로리터의 하이브리도마 고갈 상등액과 함께 인큐베이팅하고, 고갈 상등액 농도를 1:5로 희석하였다. At the same time, the 20 ng / ml biotinylated human PCSK9 D374Y the Nunc poly hybridoma incubated with hybridoma supernatant was depleted, the depleted supernatant concentration of 15 microliters in the polypropylene plate for 1 was diluted to 5. 이어서, 플레이트를 약 1시간 30분 동안 실온에서 예비-인큐베이팅하였다. Then, at room temperature for a pre-plate approximately one and a half hours were incubated. 다음으로, 플레이트를 3-사이클 세척을 사용하여 작동되는 Titertek 플레이트 세척기를 사용하여 세척하였다. Next, the plate was washed using a Titertek plate washer operated using 3-cycle washing. 50 ㎕/웰의 예비-인큐베이팅한 혼합물을 LDLR 코팅된 ELISA 플레이트 상으로 옮기고, 1시간 동안 실온에서 인큐베이팅하였다. 50 ㎕ / well of pre-incubating the mixture LDLR was transferred onto the coated ELISA plate and incubated for 1 hour at room temperature. LDLR-결합된 b-PCSK9를 검출하기 위해, 분석 희석제 중의 500 ng/ml의 40 ㎕/웰의 스트렙타비딘 HRP를 플레이트에 첨가하였다. LDLR- for detecting a binding PCSK9-b, was added to streptavidin-HRP for 40 ㎕ / well of 500 ng / ml of diluent to the analysis plate. 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. The plate was incubated at room temperature for 1 hour. 플레이트를 Titertek 플레이트 세척기를 사용하여 다시 세척하였다. Plates were washed again using the Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산으로 30분 후에 실온에서 켄칭하였다. Finally, 40 ㎕ / step 1 of the well TMB (Neogen) after the addition of the plates, and 30 minutes, and 1N hydrochloric acid in 40 ㎕ / well was quenched at room temperature. OD를 Titertek 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. The OD was read immediately at 450 nm using a Titertek plate reader. 스크리닝은 PCSK9와 LDLR 사이의 상호작용을 잘 차단한 384개의 항체를 확인하였고, 100개의 항체는 상호작용을 강하게 차단하였다 (OD<0.3). Screening was confirmed that the 384 antibody well to block the interaction between PCSK9 and LDLR, 100 of antibody was strongly blocked the interaction (OD <0.3). 이들 항체는 PCSK9 및 LDLR의 결합 상호작용을 90% 초과로 억제하였다 (90% 초과 억제). These antibodies inhibited the binding interaction of PCSK9 and LDLR as greater than 90% (greater than 90% inhibition).

차단제 하위세트에 대한 수용체 리간드 결합 분석 Receptor-ligand binding to the blocker subset analysis

이어서, 제1의 대규모 수용체 리간드 억제 분석에서 확인된 중화제의 384개 멤버 하위세트에 대해 돌연변이체 효소를 사용하여 수용체 리간드 분석을 반복하였다. Then, using the mutant enzymes was repeated with the receptor ligand and analyzed for the 384-member subsets of the neutralizing agent in a large check receptor ligand inhibition assay of claim 1. 대규모 수용체 리간드 차단 스크리닝에서 수행된 바와 같은 동일한 프로토콜을 384개 멤버 차단제 하위세트 분석 스크리닝에서 사용하였다. The same protocol, such as done in a large block receptor ligands were screened in the 384 member blockers subset analysis screening. 이러한 반복 스크리닝을 통해 초기 스크리닝 데이타를 확인하였다. Through these repeated screening it identified an initial screening data.

상기 384개 멤버 하위세트의 스크리닝을 통해, PCSK9 돌연변이체 효소와 LDLR 사이의 상호작용을 90% 초과로 차단한 85개의 항체를 확인하였다. Through screening of the 384-member subsets, interactions between the enzyme and the LDLR PCSK9 mutants was confirmed for 85 of the blocking antibody in excess of 90%.

D374Y 돌연변이체가 아니라 야생형 PCSK9에 결합하는 차단제에 대한 수용체 리간드 결합 분석 Receptor-ligand binding assay for blockers that bind to wild-type PCSK9 mutations as body D374Y

3000개의 sup의 초기 패널에서, 야생형 PCSK9에 특이적으로 결합하고 huPCSK9(D374Y) 돌연변이체에 결합하지 않는 것으로 나타난 86개의 항체가 존재하였다. From the panel of 3000 sup, specifically bind to wild-type PCSK9 and was observed the 86 antibodies appeared to be that do not bind huPCSK9 (D374Y) mutants. 상기 86개의 sup를 LDLR 수용체에 대한 야생형 PCSK9의 결합을 차단하는 능력에 대해 시험하였다. The 86 sup was tested for the ability to block the binding of wild-type PCSK9 on LDLR receptor. 다음 프로토콜을 사용하였다: 코스타 3702 배지 결합 384웰 플레이트 (코닝 라이프 사이언시스)를 스크리닝에서 사용하였다. I use the following protocol: Costa 3702 medium binding 384 well plates (Corning Life Scientific System) was used in the screening. 플레이트를 1XPBS/0.05% 아지드 중의 10 ㎍/ml의 항-His 1.2.3 (40 ㎕/웰의 부피)으로 코팅하였다. The term of the 10 ㎍ / ml in 1XPBS / 0.05% azide 1.2.3 -His plate were coated with (40 ㎕ / volume of the well). 플레이트를 4℃에서 밤새 인큐베이팅하였다. It was incubated overnight in a plate 4 ℃. 이어서, 플레이트를 타이터테크 플레이트 세척기 (Titertek, 미국 앨라배마주 헌츠빌)를 사용하여 세척하였다. Subsequently, the plate was washed using a titer plate washer Tech (Titertek, Huntsville, Alabama, United States). 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 플레이트를 90 ㎕의 1XPBS/1% 우유로 차단하고, 약 30분 동안 실온에서 인큐베이팅하였다. Block the plate with 90 ㎕ in 1XPBS / 1% milk, and the mixture was incubated at room temperature for about 30 minutes. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. LDLR (R&D 시스템즈, #2148LD/CF 또는 R&D 시스템즈, #2148LD)을 1XPBS/1% 우유/10 mM Ca 2+ 중의 5 ㎍/ml로 40 ㎕/웰의 부피로 첨가하였다. LDLR (R & D Systems, # 2148LD / CF, or R & D Systems, # 2148LD) was added to a volume of 40 ㎕ / well with 5 ㎍ / ml in 1XPBS / 1% milk / 10 mM Ca 2+. 이어서, 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. It was then incubated the plates at room temperature for 1 hour. 다음으로, 플레이트를 3-사이클 세척을 사용하여 작동되는 Titertek 플레이트 세척기를 사용하여 세척하였다. Next, the plate was washed using a Titertek plate washer operated using 3-cycle washing. 동시에, 비오티닐화된 인간 야생형 PCSK9를 Nunc 폴리프로필렌 플레이트 내에서 하이브리도마 고갈 상등액과 함께 예비-인큐베이팅하였다. At the same time, the biotinylated biotinylated human wild-type PCSK9 Nunc poly pre with hybridoma supernatants in depletion polypropylene plates were incubated. 22 ㎕의 하이브리도마 sup를 1XPBS/1% 우유/10 mM Ca 2+ 중의 583 ng/ml 농도의 33 ㎕의 b-PCSK9에 옮겨, 최종 b-PCSK9 농도 = 350 ng/ml 및 고갈 상등액을 1:2.5의 최종 희석에서 제공하였다. Moving the hybridoma sup ㎕ of 22 to b-33 of PCSK9 ㎕ of 583 ng / ml concentration in 1XPBS / 1% milk / 10 mM Ca 2+, the final b-PCSK9 concentration = 350 ng / ml and the supernatant was depleted 1 : we provide in the final dilution of 2.5. 플레이트를 약 1시간 30분 동안 실온에서 예비-인큐베이팅하였다. It was incubated About one and a half hours at room temperature for a pre-plate. 50 ㎕/웰의 예비-인큐베이팅한 혼합물을 LDLR 포획된 ELISA 플레이트 상에 옮기고, 1시간 동안 실온에서 인큐베이팅하였다. 50 ㎕ / well of pre-incubating the mixture LDLR was transferred onto a capture ELISA plate and incubated for 1 hour at room temperature. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 분석 희석제 중의 500 ng/ml의 40 ㎕/웰 스트렙타비딘 HRP를 플레이트에 첨가하였다. Analysis ㎕ 40 / well streptavidin-HRP of 500 ng / ml in diluent, was added to the plate. 플레이트를 1시간 동안 실온에서 인큐베이팅하였다. The plate was incubated at room temperature for 1 hour. 이어서, 플레이트를 Titertek 플레이트 세척기를 사용하여 세척하였다. Then, the plate was washed using a Titertek plate washer. 3-사이클 세척을 수행하였다. Washing was performed 3 cycles. 마지막으로, 40 ㎕/웰의 1단계 TMB (네오겐)를 플레이트에 첨가하고, 40 ㎕/웰의 1N 염산으로 30분 후에 실온에서 켄칭하였다. Finally, 40 ㎕ / step 1 of the well TMB (Neogen) after the addition of the plates, and 30 minutes, and 1N hydrochloric acid in 40 ㎕ / well was quenched at room temperature. OD를 Titertek 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. The OD was read immediately at 450 nm using a Titertek plate reader.

스크리닝 결과 Screening results

설명된 분석 결과에 기초하여, 몇 개의 하이브리도마 주가 PCSK9와 목적하는 상호작용을 보이는 항체를 생산하는 것으로 확인되었다. On the basis of the described results, it was confirmed that many hybridoma weeks to produce antibodies exhibit the desired interaction with PCSK9. 제한 희석을 사용하여 각각의 주로부터 관리가능한 수의 클론을 단리하였다. Using a limiting dilution to isolate a clone of the management number as possible from each mainly. 클론을 하이브리도마 주 번호 (예를 들어, 21B12) 및 클론 번호 (예를 들어, 21B12.1)로 지정하였다. The clones were designated by hybridoma week number (e.g., 21B12) and clone number (e. G., 21B12.1). 일반적으로, 본원에서 설명되는 기능성 분석에 의해 특정 주의 상이한 클론들 사이에서 어떠한 차이도 검출되지 않았다. In general, it was not detected any difference between the specific attention different clones by functional analyzes described herein. 일부 경우에, 기능성 분석에서 상이하게 거동하는 클론을 특정 주로부터 확인하였고, 예를 들어, 25A7.1은 PCSK9/LDLR을 차단하지 않는 것으로 밝혀졌지만, 25A7.3 (본원에서 25A7로서 칭함)은 중화성이었다. In some cases, clones differently behavior in functional analysis was confirmed since specific mainly, for example, 25A7.1, but it turns out that it does not block the PCSK9 / LDLR, 25A7.3 (referred to as the 25A7 herein) is neutralized It was a castle. 단리된 클론을 각각 50-100 ml의 하이브리도마 배지 내에서 팽창시키고, 고갈 상태 (즉, 약 10% 미만의 세포 생존률)로 성장시켰다. The isolated clones were each expanded in 50-100 ml of hybridoma culture medium, and grown to exhaustion (i.e., the cell survival rate of less than about 10%). 이들 배양액의 상등액 내의 PCSK9에 대한 항체의 농도 및 효력을 본원에 설명되는 바와 같이 ELISA 및 시험관 내 기능성 시험에 의해 결정하였다. The antibody concentration and the effect of PCSK9 on in the supernatants of these culture media, as described herein, was determined by the in vitro functional test and ELISA. 본원에 설명된 스크리닝의 결과로서, PCSK9에 대한 가장 높은 역가의 항체를 갖는 하이브리도마가 확인되었다. As a result of the screening described herein, the hybridoma was identified with the highest titer antibodies to PCSK9. 선택된 하이브리도마를 도 2a-3d와 표 2에 제시한다. The selected hybridomas will be presented in Figure 2a-3d in Table 2.

실시예 4.1 Example 4.1

하이브리도마로부터 인간 31H4 IgG4 항체의 생산 Production of the human IgG4 antibody from hybridoma 31H4

본 실시예에서는 일반적으로 항원 결합 단백질 중 하나를 하이브리도마 주로부터 생산하는 방법을 설명한다. In the present embodiment, it will be described a general method of producing one of the antigen-binding protein from the hybridoma mainly. 생산 작업에서는 단백질 A 정제 후에 50 ml의 고갈 상등액 생성을 이용하였다. In production operations we were used to deplete the supernatant produced after 50 ml of protein A purified. 인테그라 생산 규모를 확대할 것이고, 나중에 수행하였다. Integra will expand the scale of production was carried out in the future. 하이브리도마 주 31H4를 T75 플라스크 내에서 20 ml의 배지 (인테그라 배지, 표 5) 내에서 성장시켰다. Hybridoma culture medium of the hybridoma 31H4 week 20 ml in T75 flasks (Integra media, Table 5) was grown in. 하이브리도마가 T75 플라스크 내에서 거의 융합성이 되었을 때, 이를 인테그라 플라스크 (인테그라 바이오사이언시스 (Integra Biosciences), 인테그라 CL1000, cat# 90 005)에 옮겼다. When the hybrid hybridoma became almost confluent in the T75 flasks were transferred to Integra flasks them (Integra bio Cyan System (Integra Biosciences), Integra CL1000, cat # 90 005).

인테그라 플라스크는 막에 의해 2개의 챔버, 즉, 작은 챔버와 큰 챔버로 나누어진 세포 배양 플라스크이다. Integra flask is a two chambers by a membrane, that is, divided into a small chamber and a large chamber binary cell culture flask. 31H4 하이브리도마 주로부터 1x10 6 세포/ml의 최소 세포 밀도의 20-30 ml의 하이브리도마 세포 부피를 인테그라 플라스크의 작은 챔버 내의 인테그라 배지에 넣었다 (인테그라 배지의 성분에 대해서는 표 5 참조). 31H4 hybridomas were placed mainly from a hybridoma cell a volume of 20-30 ml of a minimum cell density of 1x10 6 cells / ml in medium in the small chambers of the Integra flasks integrase (see for components of Integra media Table 5). 인테그라 배지 단독 (1L)을 인테그라 플라스크의 큰 챔버에 넣었다. It was placed in Integra media alone (1L) in the large chambers of the Integra flasks. 2개의 챔버를 분리시키는 막은 소분자량 영양물질에 투과성이지만, 하이브리도마 세포 및 이들 세포에 의해 생산된 항체에 대해 불투과성이다. 2 but permeable to small molecular weight nutrients membrane separating the two chambers, it is impermeable to hybridoma cells and the antibodies produced by these cells. 따라서, 하이브리도마 세포 및 이들 하이브리도마 세포에 의해 생산된 항체는 작은 챔버 내에 보유되었다. Thus, hybridoma cells and the antibodies produced by those hybridoma cells were retained in the small chamber.

1주 후에, 배지를 인테그라 플라스크의 두 챔버로부터 제거하고, 새 인테그라 배지로 교체하였다. Week later, remove the media from the two chambers of the Integra flasks and was replaced with a new medium integrase. 작은 챔버로부터 모은 배지를 따로 보유시켰다. The medium collected from the small chamber and hold it separately. 2주의 성장 후에, 작은 챔버로부터의 배지를 다시 수거하였다. After two weeks of growth, the medium was collected from the small chamber again. 하이브리도마 주로부터 제1주에 수거한 배지를 하이브리도마 주로부터 제2주에 수거한 배지와 합하였다. Hybridoma a medium mainly collected in the first weeks of the culture medium were combined and collected from the second main hybridoma mainly. 하이브리도마 주로부터 생성되는 수거된 배지 샘플을 원심분리하여 세포 및 파쇄물을 제거하고 (3000 rpm에서 15분), 생성되는 상등액을 여과하였다 (0.22 ㎛). Hybridomas the supernatant mainly centrifuging the collected media samples produced from the cells and debris are removed, and (15 min at 3000 rpm), generated and filtered (0.22 ㎛). 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 Q 세파로스 수지와 같은 음이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose agglomerated antibody protein in the pool was removed by combining ion exchange chromatography on an anion exchange resin, such as size exclusion chromatography, or Q-Sepharose resin. 31H4 단백질에 대한 특이적인 IEX 조건은 pH 7.8-8.0의 Q-세파로스 HP이다. Specific IEX conditions for the 31H4 protein is a Q- Sepharose HP of pH 7.8-8.0. 항체를 25 컬럼 부피의 10 mM-500 mM의 NaCl 구배로 용출하였다. The antibody was eluted with a NaCl gradient of 10 mM-500 mM in 25 column volumes.

Figure pat00005

실시예 4.2 Example 4.2

형질감염된 세포로부터 재조합 31H4 인간 IgG2 항체의 생산 31H4 production of recombinant human IgG2 antibody from transfected cells

본 실시예에서는 31H4 IgG2 항체를 형질감염된 세포로부터 생산하는 방법을 개략한다. In this embodiment, a schematic method of producing 31H4 IgG2 antibody from transfected cells. 일시적 발현을 위해 293 세포 및 안정한 발현을 위해 CHO 세포를 31H4 중쇄 및 경쇄를 코딩하는 플라스미드로 형질감염시켰다. CHO cells to 293 cells, and stable expression for the transient expression were transfected with the plasmid encoding the 31H4 heavy and light chains. 형질감염된 세포로부터의 조건화 배지를 세포 및 세포 파쇄물을 제거함으로써 회수하였다. The conditioned medium from the transfected cells were harvested by removing the cells and cell debris. 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 Q 세파로스 수지와 같은 음이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose agglomerated antibody protein in the pool was removed by combining ion exchange chromatography on an anion exchange resin, such as size exclusion chromatography, or Q-Sepharose resin. 31H4 단백질에 대한 특이적인 IEX 조건은 pH 7.8-8.0의 Q-세파로스 HP이다. Specific IEX conditions for the 31H4 protein is a Q- Sepharose HP of pH 7.8-8.0. 항체를 25 컬럼 부피의 10 mM-500 mM의 NaCl 구배로 용출하였다. The antibody was eluted with a NaCl gradient of 10 mM-500 mM in 25 column volumes.

실시예 5. Example 5.

하이브리도마로부터 인간 21B12 IgG4 항체의 생산 Production of the human IgG4 antibody 21B12 from a hybridoma

본 실시예에서는 21B12 IgG4 항체를 하이브리도마로부터 생산하는 방법을 개략한다. In this embodiment, a schematic method of producing 21B12 IgG4 antibody from hybridomas. 하이브리도마 주 21B12를 T75 플라스크 내에서 배지 (인테그라 배지, 표 5) 내에서 성장시켰다. Hybridoma main 21B12 was grown in the medium (Integra media, Table 5) in a T75 flask. 하이브리도마가 T75 플라스크 내에서 거의 융합성이 되었을 때, 이들을 인테그라 플라스크 (인테그라 바이오사이언시스, 인테그라 CL1000, cat# 90 005)에 옮겼다. When the hybrid hybridoma became almost confluent in the T75 flasks were transferred to Integra flasks them (Integra bio cyan system, Integra CL1000, cat # 90 005).

인테그라 플라스크는 막에 의해 2개의 챔버, 즉, 작은 챔버와 큰 챔버로 나누어진 세포 배양 플라스크이다. Integra flask is a two chambers by a membrane, that is, divided into a small chamber and a large chamber binary cell culture flask. 21B12 하이브리도마 주로부터 1x10 6 세포/ml의 최소 세포 밀도의 20-30 ml의 하이브리도마 세포 부피를 인테그라 플라스크의 작은 챔버 내의 인테그라 배지에 넣었다 (인테그라 배지의 성분에 대해서는 표 5 참조). 21B12 hybridomas were placed mainly from a hybridoma cell a volume of 20-30 ml of a minimum cell density of 1x10 6 cells / ml in medium in the small chambers of the Integra flasks integrase (see for components of Integra media Table 5). 인테그라 배지 단독 (1L)을 인테그라 플라스크의 큰 챔버에 넣었다. It was placed in Integra media alone (1L) in the large chambers of the Integra flasks. 2개의 챔버를 분리시키는 막은 소분자량 영양물질에 투과성이지만, 하이브리도마 세포 및 이들 세포에 의해 생산된 항체에 대해 불투과성이다. 2 but permeable to small molecular weight nutrients membrane separating the two chambers, it is impermeable to hybridoma cells and the antibodies produced by these cells. 따라서, 하이브리도마 세포 및 이들 하이브리도마 세포에 의해 생산된 항체는 작은 챔버 내에 보유되었다. Thus, hybridoma cells and the antibodies produced by those hybridoma cells were retained in the small chamber. 1주 후에, 배지를 인테그라 플라스크의 두 챔버로부터 제거하고, 새 인테그라 배지로 교체하였다. Week later, remove the media from the two chambers of the Integra flasks and was replaced with a new medium integrase. 작은 챔버로부터 모은 배지를 따로 보유시켰다. The medium collected from the small chamber and hold it separately. 2주의 성장 후에, 작은 챔버로부터의 배지를 다시 수거하였다. After two weeks of growth, the medium was collected from the small chamber again. 하이브리도마 주로부터 제1주에 수거한 배지를 하이브리도마 주로부터 제2주에 수거한 배지와 합하였다. Hybridoma a medium mainly collected in the first weeks of the culture medium were combined and collected from the second main hybridoma mainly. 하이브리도마 주로부터 생성되는 수거된 배지 샘플을 원심분리하여 세포 및 파쇄물을 제거하고 (3000 rpm에서 15분), 생성되는 상등액을 여과하였다 (0.22 ㎛). Hybridomas the supernatant mainly centrifuging the collected media samples produced from the cells and debris are removed, and (15 min at 3000 rpm), generated and filtered (0.22 ㎛). 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 Q 세파로스 수지와 같은 음이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose agglomerated antibody protein in the pool was removed by combining ion exchange chromatography on an anion exchange resin, such as size exclusion chromatography, or Q-Sepharose resin. 21B12 단백질에 대한 특이적인 IEX 조건은 pH 7.8-8.0의 Q-세파로스 HP이다. Specific IEX conditions for the 21B12 protein is a Q- Sepharose HP of pH 7.8-8.0. 항체를 25 컬럼 부피의 10 mM-500 mM의 NaCl 구배로 용출하였다. The antibody was eluted with a NaCl gradient of 10 mM-500 mM in 25 column volumes.

실시예 6 Example 6

형질감염된 세포로부터 인간 21B12 IgG2 항체의 생산 Transformants producing human IgG2 antibody 21B12 from infected cells

본 실시예에서는 21B12 IgG2 항체를 형질감염된 세포로부터 생산하는 방법을 개략한다. In this embodiment, a schematic method of producing 21B12 IgG2 antibody from transfected cells. 세포 (일시적 발현을 위해 293 세포 및 안정한 발현을 위해 CHO 세포)를 21B12 중쇄 및 경쇄를 코딩하는 플라스미드로 형질감염시켰다. Cells (CHO cells to 293 cells, and stable expression for transient expression) were transfected with the plasmid encoding the 21B12 heavy chain and light chain. 하이브리도마 세포로부터의 조건화 배지를 세포 및 세포 파쇄물을 제거함으로써 회수하였다. The conditioned media from hybridoma cells were recovered by removing the cells and cell debris. 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 SP-세파로스 수지와 같은 양이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose pool in the three aggregated antibody protein was removed by a combined ion exchange chromatography on a cation exchange resin, such as size exclusion chromatography, or SP- Sepharose resin. 21B12 단백질에 대한 특이적인 IEX 조건은 pH 5.2의 SP-세파로스 HP이었다. Specific IEX conditions for the 21B12 protein was SP- Sepharose HP of pH 5.2. 항체를 20 mM 아세트산나트륨 버퍼 중에 10 mM-500 mM의 NaCl 구배를 함유하는 버퍼 25 컬럼 부피로 용출하였다. Antibody was eluted with 25 column volumes of a buffer containing a NaCl gradient of 10 mM-500 mM in 20 mM sodium acetate buffer.

실시예 7. Example 7.

하이브리도마로부터 인간 16F12 IgG4 항체의 생산 Production of the human IgG4 antibody from hybridoma 16F12

본 실시예에서는 항체 16F12 IgG4를 하이브리도마로부터 생산하는 방법을 개략한다. In this embodiment, schematically a method for producing an antibody from a hybridoma 16F12 IgG4. 하이브리도마 주 16F12를 T75 플라스크 내에서 배지 (표 5 참조) 내에서 성장시켰다. Hybridoma weeks 16F12 was grown in the medium (see Table 5) in a T75 flask. 하이브리도마가 T75 플라스크 내에서 거의 융합성이 되었을 때, 이들을 인테그라 플라스크 (인테그라 바이오사이언시스, 인테그라 CL1000, cat# 90 005)에 옮겼다. When the hybrid hybridoma became almost confluent in the T75 flasks were transferred to Integra flasks them (Integra bio cyan system, Integra CL1000, cat # 90 005).

인테그라 플라스크는 막에 의해 2개의 챔버, 즉, 작은 챔버와 큰 챔버로 나누어진 세포 배양 플라스크이다. Integra flask is a two chambers by a membrane, that is, divided into a small chamber and a large chamber binary cell culture flask. 16F12 하이브리도마 주로부터 1x10 6 세포/ml의 최소 세포 밀도의 20-30 ml의 하이브리도마 세포 부피를 인테그라 플라스크의 작은 챔버 내의 인테그라 배지에 넣었다 (인테그라 배지의 성분에 대해서는 표 5 참조). 16F12 hybridomas were placed mainly from a hybridoma cell a volume of 20-30 ml of a minimum cell density of 1x10 6 cells / ml in medium in the small chambers of the Integra flasks integrase (see for components of Integra media Table 5). 인테그라 배지 단독 (1L)을 인테그라 플라스크의 큰 챔버에 넣었다. It was placed in Integra media alone (1L) in the large chambers of the Integra flasks. 2개의 챔버를 분리시키는 막은 소분자량 영양물질에 투과성이지만, 하이브리도마 세포 및 이들 세포에 의해 생산된 항체에 대해 불투과성이다. 2 but permeable to small molecular weight nutrients membrane separating the two chambers, it is impermeable to hybridoma cells and the antibodies produced by these cells. 따라서, 하이브리도마 세포 및 이들 하이브리도마 세포에 의해 생산된 항체는 작은 챔버 내에 보유되었다. Thus, hybridoma cells and the antibodies produced by those hybridoma cells were retained in the small chamber.

1주 후에, 배지를 인테그라 플라스크의 두 챔버로부터 제거하고, 새 인테그라 배지로 교체하였다. Week later, remove the media from the two chambers of the Integra flasks and was replaced with a new medium integrase. 작은 챔버로부터 모은 배지를 따로 보유시켰다. The medium collected from the small chamber and hold it separately. 2주의 성장 후에, 작은 챔버로부터의 배지를 다시 수거하였다. After two weeks of growth, the medium was collected from the small chamber again. 하이브리도마 주로부터 제1주에 수거한 배지를 하이브리도마 주로부터 제2주에 수거한 배지와 합하였다. Hybridoma a medium mainly collected in the first weeks of the culture medium were combined and collected from the second main hybridoma mainly. 하이브리도마 주로부터 생성되는 수거된 배지 샘플을 원심분리하여 세포 및 파쇄물을 제거하고 (3000 rpm에서 15분), 생성되는 상등액을 여과하였다 (0.22 ㎛). Hybridomas the supernatant mainly centrifuging the collected media samples produced from the cells and debris are removed, and (15 min at 3000 rpm), generated and filtered (0.22 ㎛). 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 Q 세파로스 수지와 같은 음이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose agglomerated antibody protein in the pool was removed by combining ion exchange chromatography on an anion exchange resin, such as size exclusion chromatography, or Q-Sepharose resin. 16F12 단백질에 대한 특이적인 IEX 조건은 pH 7.8-8.0의 Q 세파로스 HP이다. Specific IEX conditions for the 16F12 protein is Q Sepharose HP of pH 7.8-8.0. 항체를 25 컬럼 부피의 10 mM-500 mM의 NaCl 구배로 용출하였다. The antibody was eluted with a NaCl gradient of 10 mM-500 mM in 25 column volumes.

실시예 8 Example 8

형질감염된 세포로부터 인간 16F12 IgG2 항체의 생산 Production of 16F12 transfected human IgG2 antibody from infected cells

본 실시예에서는 16F12 IgG2 항체를 형질감염된 세포로부터 생산하는 방법을 개략한다. In this embodiment, a schematic method of producing 16F12 IgG2 antibody from transfected cells. 세포 (일시적 발현을 위해 293 세포 및 안정한 발현을 위해 CHO 세포)를 16F12 중쇄 및 경쇄를 코딩하는 플라스미드로 형질감염시켰다. Cells (CHO cells to 293 cells, and stable expression for transient expression) were transfected with the plasmid encoding the heavy and light chain 16F12. 하이브리도마 세포로부터의 조건화 배지를 세포 및 세포 파쇄물을 제거함으로써 회수하였다. The conditioned media from hybridoma cells were recovered by removing the cells and cell debris. 투명해진 조건화 배지를 단백질 A 세파로스 컬럼 상에 로딩하였다. The conditioned medium was made transparent loaded onto a protein A Sepharose column. 임의로, 배지를 먼저 농축한 후 단백질 A 세파로스 컬럼 상에 로딩할 수 있다. Optionally, after concentrating the culture medium first it can be loaded on a protein A Sepharose column. 비특이적 결합은 광범한 PBS 세척에 의해 제거하였다. Non-specific binding was removed by extensive PBS washing. 단백질 A 컬럼 상의 결합된 항체 단백질은 단백질 A 컬럼으로부터 표준 산성 항체 용출 (예를 들어 50 mM 시트레이트, pH 3.0)에 의해 회수하였다. Protein antigen binding protein A on the column was recovered by standard acidic antibody elution (for example, 50 mM citrate, pH 3.0) from the protein A column. 단백질 A 세파로스 풀 내의 응집된 항체 단백질은 크기 배제 크로마토그래피, 또는 SP 세파로스 수지와 같은 양이온 교환 수지 상의 결합 이온 교환 크로마토그래피에 의해 제거하였다. Protein A Sepharose agglomerated antibody protein in the pool was removed by combining ion exchange chromatography on a cation exchange resin, such as size exclusion chromatography, or SP-Sepharose resin. 16F12 단백질에 대한 특이적인 IEX 조건은 pH 5.2의 SP 세파로스 HP이다. Specific IEX conditions for the 16F12 proteins is Sepharose HP of pH 5.2 SP. 항체를 20 mM 아세트산나트륨 버퍼 중에 10 mM-500 mM의 NaCl 구배를 함유하는 버퍼 25 컬럼 부피로 용출하였다. Antibody was eluted with 25 column volumes of a buffer containing a NaCl gradient of 10 mM-500 mM in 20 mM sodium acetate buffer.

실시예 9 Example 9

항체 중쇄 및 경쇄의 서열 분석 Antibody heavy and light chain sequence analysis of the

이어서, 상기 항체의 경쇄 및 중쇄의 핵산 및 아미노산 서열을 Sanger (디데옥시) 뉴클레오티드 서열결정에 의해 결정하였다. It was then determine the nucleic acid and amino acid sequences of light and heavy chains of the antibody by the Sanger (dideoxy) nucleotide sequencing. 이어서, 아미노산 서열을 핵산 서열에 대해 추정하였다. It was then estimated for the amino acid sequence for a nucleic acid sequence. 가변 도메인의 핵산 서열을 도 3e-3jj에 제시한다. It presents the nucleic acid sequence of the variable domain in Figure 3e-3jj.

31H4, 21B12 및 16F12의 람다 경쇄 가변 구역에 대한 cDNA 서열을 결정하였고, 각각 서열 153, 95 및 105로 제시한다. It was determined the cDNA sequence for the lambda light chain variable region of 31H4, 21B12 and 16F12, respectively presented in SEQ ID NO: 153, 95 and 105.

31H4, 21B12 및 16F12의 중쇄 가변 구역에 대한 cDNA 서열을 결정하였고, 각각 서열 152, 94 및 104로 제시한다. Was determined the cDNA sequence for the heavy chain variable region of 31H4, 21B12 and 16F12, respectively presented in SEQ ID NO: 152, 94 and 104.

람다 경쇄 불변 구역 (서열 156), 및 IgG2 및 IgG4 중쇄 불변 구역 (서열 154 및 155)을 도 3kk에 제시한다. A lambda light chain constant region (SEQ ID NO: 156), and the IgG2 and IgG4 heavy chain constant region (SEQ ID NO: 154 and 155) also presents the 3kk.

각각의 cDNA 서열로부터 예측된 폴리펩티드 서열을 결정하였다. The polypeptide sequences predicted from each of the cDNA sequence was determined. 31H4, 21B12 및 16F12의 람다 경쇄 가변 구역에 대한 예측된 폴리펩티드 서열을 예측하고, 각각 서열 12, 23, 및 35로 제시하고, 31H4, 21B12 및 16F12의 람다 경쇄 불변 구역 (서열 156), 중쇄 가변 구역을 예측하고, 각각 서열 67, 49 및 79로 제시한다. 31H4, 21B12 and predicts the predicted polypeptide sequence for the lambda light chain variable regions of 16F12, each sequence a lambda light chain constant region of 12, 23, and presented to 35, and 31H4, 21B12 and 16F12 (SEQ ID NO: 156), heavy chain variable regions the prediction, and each presented as SEQ ID NO: 67, 49 and 79. IgG2 및 IgG4 중쇄 불변 구역 (서열 154 및 155). IgG2 and IgG4 heavy chain constant region (SEQ ID NO: 154 and 155).

FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 분할을 도 2a-3d에 제시한다. FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 proposes a division in Fig 2a-3d.

서열 데이타에 기초하여, 그로부터 각각의 중쇄 또는 경쇄 가변 구역이 유도되는 생식계열 유전자를 결정하였다. Based on the sequence data, it was determined for each of the heavy chain germline genes or light chain variable region is derived therefrom. 생식계열 유전자의 동일성은 도 2a-3d 내의 대응하는 하이브리도마 주 다음에 표시하고, 각각 특유한 서열에 의해 표시된다. Identity of the germline genes are indicated by the response and displays the hybridoma week, then each specific sequence in Figure 2a-3d. 또한, 도 2a-3d에서는 특성 결정된 추가의 항체에 대한 결정된 아미노산 서열을 제시한다. Further, FIG. 2a-3d presents the amino acid sequence determined for the addition of antibody as determined characteristic.

실시예 8 Example 8

3개의 항체의 등전점의 결정 Determination of the isoelectric point of the three antibodies

아미노산 서열에 기초한 항체의 이론적 pI는 16F12에 대해 7.36; Theoretical pI of the antibody, based on the amino acid sequence is for the 16F12 7.36; 21B12에 대해 8.47; For 21B12 8.47; 31H4에 대해 6.84인 것으로 결정되었다. For 31H4 was determined to be 6.84.

실시예 9 Example 9

PCSK9에 대한 항체의 결합의 특성결정 Determination of properties of binding of antibody to PCSK9

PCSK9에 결합하는 많은 항체를 확인한 후에, 결합을 정량하고 결합 특성을 추가로 결정하기 위해 여러 방법을 사용하였다. After checking the number of antibody binding to PCSK9, a number of different methods were used to quantify the binding and to determine further binding properties. 연구의 한 측면에서, 비아코어 친화도 분석을 수행하였다. In one aspect of the study, Biacore affinity analysis was performed. 연구의 다른 측면에서, KinExA® 친화도 분석을 수행하였다. On the other side of the study, KinExA® affinity analysis was performed. 이들 연구에 사용된 샘플 및 버퍼를 하기 표 6에 제시한다. To the sample and buffer used in these studies it is shown in Table 6.

Figure pat00006

비아코어® 친화도 측정 Biacore affinity measurements ®

본 실시예에서 설명되는 PCSK9에 대한 21B12 항체의 비아코어® (표면 플라스몬 공명 장치, 비아코어, 인크. (Biacore, Inc., 미국 뉴저지주 피스카타웨이)) 친화도 분석을 제조자의 지시에 따라 수행하였다. Biacore ® (surface plasmon resonance device, BIAcore Inc.. (Biacore, Inc., Piscataway, NJ, USA)), the 21B12 antibody to PCSK9 described in this embodiment in accordance with the analysis to the manufacturer's instructions affinity It was performed.

간단히 설명하면, 표면 플라스몬 공명 실험은 비아코어 2000 광학 바이오센서 (비아코어, 지이 헬쓰케어 (GE Healthcare), 미국 뉴저지주 피스카타웨이)를 사용하여 수행하였다. Simply put, was carried out using a surface plasmon resonance experiment BIAcore 2000 optical biosensor (Biacore, GE Healthcare (GE Healthcare), NJ Piscataway). 각각의 개별 항-PCSK9 항체를 200 이하의 공명 단위 (RU)의 최대 분석물 결합 반응 (Rmax)을 제시하는 수준으로 아민-커플링에 의해 연구 등급 CM5 바이오센서 칩에 고정하였다. And fixed to a research grade CM5 biosensor chip by coupling, each of the amine to a level state the analyte binding reaction (Rmax) of the individual wherein the antibody -PCSK9 200 or less 0 people units (RU) of. PCSK9 단백질의 농도는 2배 간격으로 상이하였고 (분석물), 고정된 항체 표면 위로 (100 ㎕/min의 유속으로 1.5분 동안) 주입하였다. The concentration of PCSK9 protein was different for the two-fold distance (analyte) were injected (for 1.5 minutes at a flow rate of 100 ㎕ / min) immobilized antibodies over the surface. 0.01% BSA를 보충한 새로운 HBS-P 버퍼 (pH 7.4, 0.01 M Hepes, 0.15 M NaCl, 0.005% 계면활성제 P-20, 비아코어)를 결합 버퍼로서 사용하였다. New HBS-P buffer supplemented to 0.01% BSA (pH 7.4, 0.01 M Hepes, 0.15 M NaCl, 0.005% surfactant P-20, Biacore) was used as the binding buffer. 각각의 항-PCSK9 항체의 결합 친화도는 pH 7.4에서 각각의 인간, 마우스, 및 사이노몰거스 원숭이 PCSK9 단백질에 대해 별개의 실험으로 측정하였다 (사용된 농도는 100, 50, 25, 12.5, 6.25, 3.125, 및 0 nM이었다). Wherein each -PCSK9 binding affinity of the antibody is a human individual at pH 7.4, mouse, and cynomolgus monkey was measured in a separate experiment for the PCSK9 protein (the concentration used was 100, 50, 25, 12.5, 6.25, It was 3.125, and 0 nM).

또한, 인간 PCSK9에 대한 항체의 결합 친화도는 0.01% BSA를 보충한 pH 6.0의 HBS-P 버퍼 (pH 6.0, 0.01 M Hepes, 0.15 M NaCl, 0.005% 계면활성제 P-20, 비아코어)로 pH 6.0에서 측정하였다. Further, in HBS-P buffer for the binding affinity of the antibody pH 6.0 supplemented to 0.01% BSA (pH 6.0, 0.01 M Hepes, 0.15 M NaCl, 0.005% surfactant P-20, Biacore) on human PCSK9 pH It was measured at 6.0. 수득한 결합 신호는 용액 내의 유리 PCSK9에 비례하였다. A combined signal obtained was proportional to free PCSK9 in solution. 해리 평형 상수 (K D )는 이중-곡선 단일 부위 균질 결합 모델 (KinExA® 소프트웨어, 사피다인 인스트루먼츠 인크. (Sapidyne Instruments Inc., 미국 아이다호주 보이스)) (6.0 pH 실시에 대해 n=1)을 사용하여 경쟁 곡선의 비선형 회귀 분석으로부터 얻었다. Dissociation equilibrium constant (K D) is a dual-curve one site homogeneous binding model (. KinExA® software, Shapiro dynes Instruments Inc. (Sapidyne Instruments Inc., Idaho, USA Voice)) using the (6.0 n = 1 for a pH embodiment) It was obtained from nonlinear regression of the competition curves. 흥미롭게도, 항체는 보다 낮은 pH에서 더 강한 결합 친화도를 보이는 것으로 나타났다 (Kd는 31H4, 21B12 및 16F12에 대해 각각 12.5, 7.3, 및 29 pM이었다). Interestingly, the antibody appeared to be more visible to a stronger binding affinity at low pH (Kd was 31H4, 21B12 and 12.5, 7.3, and 29 pM for the 16F12).

k a (회합 속도 상수), k d (해리 속도 상수), 및 K D (해리 평형 상수)를 포함한 항체 결합 운동학 파라미터는 BIA 평가 3.1 컴퓨터 프로그램 (비아코어, 인크.)을 사용하여 결정하였다. Antibody binding kinetic parameters including k a (association rate constant), k d (dissociation rate constant) and K D (dissociation equilibrium constant) were determined using the BIA evaluation 3.1 computer program (Biacore, Inc.). 보다 낮은 해리 평형 상수는 PCSK9에 대한 항체의 친화도가 더 큼을 나타낸다. Lower than the dissociation equilibrium constants indicate that the antibodies affinity for the PCSK9 even more is great. 비아코어® 친화도 분석에 의해 결정된 K D 값을 하기 표 7.1에 제시한다. Biacore ® affinity to the K D values determined by the analysis is shown in Table 7.1.

<표 7.1> <Table 7.1>

Figure pat00007

표 7.2에서는 k on 및 k off 율을 제시한다. Table 7.2 presents the k on and k off rate.

<표 7.2> <Table 7.2>

Figure pat00008

KinExA® 친화도 측정 KinExA® affinity measurement

16F12 및 31H4의 KinExA® (사피딘 인스트루먼츠 인크.) 친화도 분석을 제조자의 지시에 따라 수행하였다. 16F12 and KinExA® (Shapiro Dean Instruments Inc.) of the 31H4 affinity analysis was performed according to the manufacturer's instructions. 간단히 설명하면, Reacti-Gel™ (6x) (피어스 (Pierce))을 인간, V5-태깅된 (tagged) 사이노 PCSK9 단백질 또는 His-태깅된 마우스 PCSK9 단백질 중 하나로 예비코팅하고, BSA로 차단하였다. Briefly, Reacti-Gel ™ (6x) (Pierce (Pierce)), human, V5- precoated in one of between the tagged (tagged) protein or PCSK9 furnace His- tagged mouse PCSK9 protein, and were blocked with BSA. 이어서, 10 또는 100 pM의 항체 16F12 또는 항체 31H4 및 하나의 PCSK9 단백질을 다양한 농도 (0.1 pM - 25 nM)의 PCSK9 단백질과 함께 실온에서 8시간 동안 인큐베이팅한 후, PCSK9-코팅된 비드를 통해 통과시켰다. Next, 10 of 100 pM or antibody or antibody 16F12 and 31H4 to a PCSK9 protein with various concentrations-were at room temperature with PCSK9 protein (0.1 pM 25 nM) for 8 h and then incubated, passed through a PCSK9- coated beads . 비드-결합된 16F12 또는 31H4의 양은 형광 (Cy5) 표지된 염소 항-인간 IgG (H+L) 항체 (잭슨 이뮤노 리서치 (Jackson Immuno Research))에 의해 정량하였다. Bead-bound 16F12 or 31H4 amount of fluorescent (Cy5) labeled goat anti-(H + L) human IgG antibody (Jackson Research immunometric (Jackson Immuno Research)) was quantified by. 결합 신호는 결합 평형에서 유리 16F12 또는 31H4의 농도에 비례한다. Binding signal is proportional to the concentration of free 16F12 or 31H4 in the binding equilibrium. 평형 해리 상수 (K D )는 단일 부위 균질 결합 모델을 사용하여 2개의 세트의 경쟁 곡선의 비선형 회귀로부터 얻었다. The equilibrium dissociation constant (K D) was obtained from nonlinear regression of the competition curves of the two sets by using the single site homogeneous binding model. KinExA® Pro 소프트웨어를 분석에서 사용하였다. The KinExA® Pro software was used in the analysis. 본 분석에서 생성된 결합 곡선을 도 4a-4f에 제시한다. It proposes a combined curve generated by the analysis in Figure 4a-4f.

16F12 및 31H4 항체는 인간 및 사이노 PCSK9에 유사한 친화도를 보였지만, 마우스 PCSK9에 약 10-250배 더 낮은 친화도를 보였다. 16F12 and 31H4 antibodies showed a similar affinity to the furnace PCSK9 between humans and showed an about 10-250 fold lower affinity for mouse PCSK9. KinExA® 시스템을 이용하여 시험한 2개의 항체 중에서, 항체 31H4는 인간 및 사이노 PCSK9 모두에 대해 각각 3 및 2 pM K D 로 보다 높은 친화도를 보였다. Of the two antibodies tested using the KinExA® system, the antibody 31H4 showed a higher affinity to the respective third and 2 pM K D for both human and between the furnace PCSK9. 16F12는 인간 PCSK9에 대해 15 pM K D 및 사이노 PCSK9에 대해 16 pM K D 로 근소하게 더 약한 친화도를 보였다. 16F12 showed a slightly weaker affinity to 16 pM K D is also about 15 pM, and K D between the furnace PCSK9 for human PCSK9.

KinExA® 친화도 분석의 결과를 하기 표 8.1에 요약한다. KinExA® affinity to summarize the results of the analysis in Table 8.1.

<표 8.1> <Table 8.1>

Figure pat00009

또한, 샘플의 품질 및 양을 검토하기 위해 SDS PAGE를 실행하였고, 도 5a에 제시한다. In addition, SDS PAGE was run to examine the quality and quantity of the sample, given in Figure 5a. cPCSK9는 겔 상에서 또한 KinExA® 분석으로부터 계산된 활성 결합 농도로부터 약 50% 더 적은 것으로 나타났다. cPCSK9 also appeared to be about 50% less active from a combined concentration calculated from KinExA® analysis on gels. 따라서, cPCSK9에 대한 mAb의 K D 를 본 발명의 활성 cPCSK9의 50%로서 조정하였다. Therefore, to adjust the K D of mAb for cPCSK9 as 50% of the active cPCSK9 of the present invention.

비아코어 용액 평형 결합 분석을 사용하여 ABP 21B12에 대한 Kd 값을 측정하였다. Using Biacore solution equilibrium binding assays to measure the Kd values ​​for the ABP 21B12. 21B12.1은 KinExA 분석을 사용할 때 신호를 거의 보이지 않았고, 따라서, 비아코어 용액 평형 분석을 적용하였다. 21B12.1 did not show any signal substantially when using the KinExA analysis, therefore, was applied to BIAcore solution equilibrium analysis. 고정된 PCSK9 표면에 대한 항체의 결합에 대해 유의한 결합이 관찰되지 않았으므로, 약 7000 RU의 밀도로 아민 커플링을 사용하여 21B12 항체를 CM5 칩의 유동 셀 4에 고정시켰다. Since a significant binding to the binding of antibodies to fixed PCSK9 surface it was observed, using the amine coupling to a density of approximately 7000 RU was fixed on the 21B12 antibody four flow cells of a CM5 chip. 유동 셀 3을 배경 대조군으로서 사용하였다. Flow cell 3 was used as a background control. 0.3, 1, 및 3 nM의 인간 PCSK9 또는 사이노 PCSK9를 PBS + 0.1 mg/ml BSA, 0.005% P20 중의 21B12.1 항체 샘플의 계열 희석액 (0.001~25 nM 범위)과 혼합하였다. 0.3, was mixed with 1, and 3 nM of human PCSK9 or PCSK9 furnace between the PBS + 0.1 mg / ml BSA, 0.005% P20 series diluted solution (0.001 ~ 25 nM range) of a sample of the antibody 21B12.1. 혼합 용액 내의 유리 PCSK9의 결합은 21B12.1 항체 표면 위로 주입함으로써 측정하였다. The combination of glass PCSK9 in the mixed solution was measured by injection over the antibody surface 21B12.1. 21B12.1 표면 상의 100% PCSK9 결합 신호를 용액 내에 mAb의 부재 하에 결정하였다. A 100% coupling PCSK9 21B12.1 signal on the surface were determined in the absence of a mAb in the solution. 증가하는 농도의 mAb에서 감소된 PCSK9 결합 반응은 PCSK9가 고정된 펩티바디 표면에 결합하는 것을 차단한 용액 내의 mAb에 대한 PCSK9 결합을 나타냈다. The reduction of the increase in the mAb concentration at which PCSK9 binding reaction exhibited a PCSK9 binding to the mAb in a block binding to peptibody surfaces PCSK9 the fixing solution. PCSK9 결합 신호 대 mAb 농도를 플로팅하여, K D 를 KinExA Pro™ 소프트웨어에서 단일 부위 균질 결합 모델을 사용하여 3 세트의 곡선 (0.3, 1 및 3 nM의 고정된 PCSK9 농도)로부터 계산하였다. By plotting the PCSK9 binding signal-to-mAb concentrations, the K D using a single site homogeneous binding model in a KinExA ™ Pro software was calculated from the curve (0.3, a fixed concentration of PCSK9. 1 and 3 nM) of the third set. cPCSK9는 KinExA 분석 및 SDS-겔로부터 관찰된 보다 낮은 단백질 농도를 갖지만, cPCSK9의 농도는 K D 의 계산에 사용되지 않으므로 여기서 그의 농도를 조정하지 않았다. cPCSK9 gatjiman is a lower protein concentrations than observed from the KinExA analysis and SDS- gel, the concentration of cPCSK9 is not used in the calculation of the K D where not adjust its concentration. 결과를 하기 표 8.2와 도 5b-5d에 제시한다. The results are presented in Fig. 5b-5d and Table 8.2. 도 5b에서는 hPCSK9에 대한 3개의 상이한 hPCSK9 농도에서 용액 평형 분석으로부터의 결과를 제시한다. In Figure 5b presents the result from a solution equilibrium analysis at three different concentrations for hPCSK9 hPCSK9. 도 5c에서는 mPCSK9에 대한 유사한 세트의 결과를 제시한다. In Figure 5c presents the results of a similar set for mPCSK9. 도 5d에서는 상기 비아코어 포획 분석으로부터의 결과를 제시한다. In Figure 5d presents the results from the BIAcore analysis capture.

<표 8.2> <Table 8.2>

Figure pat00010

실시예 10 Example 10

에피토프 비닝 Epitope binning

항-PCSK9 항체 비닝을 위해 경쟁 ELISA를 사용하였다. Competitive ELISA was used for anti -PCSK9 antibody binning. 간단히 설명하면, 2개의 항체가 동일한 에피토프 빈 (bin)에 속하는지 결정하기 위해, 하나의 항체 (mAb1)를 먼저 ELISA 플레이트 (NUNC) 상에 2 ㎍/ml로 철야 인큐베이션에 의해 코팅하였다. Briefly, was coated by the two antibodies are incubated overnight with 2 ㎍ / ml to, one antibody (mAb1) to determine if it is in the same epitope bin (bin) first onto an ELISA plate (NUNC). 이어서, 플레이트를 3% BSA로 세척하고 차단하였다. Then washed the plates with 3% BSA blocking. 한편, 30 ng/ml의 비오티닐화된 hPCSK9를 제2 항체 (mAb2)와 함께 2시간 동안 실온에서 인큐베이팅하였다. On the other hand, it was incubated for 30 ng / ml biotinylated hPCSK9 at room temperature for 2 hours with a second antibody (mAb2). 혼합물을 코팅된 mAb1에 적용하고 1시간 동안 실온에서 인큐베이팅하였다. MAb1 applied to the coating and the mixture was incubated at room temperature for 1 hour. 이어서, ELISA 플레이트를 세척하고, 뉴트라비딘-HRP (피어스)와 함께 1:5000 희석으로 1시간 동안 인큐베이팅하였다. Then, washing the ELISA plate, along with 1 Nutra neutravidin -HRP (Pierce) were incubated for 1 hour in 5000 dilution. 추가로 세척한 후, 플레이트를 TMB 기질과 함께 인큐베이팅하고, 신호를 Titertek 플레이트 판독기를 사용하여 650 nm에서 검출하였다. After further washing with, for incubating the plates with the TMB substrate, and the signal was detected at 650 nm using a Titertek plate reader. 동일한 결합 프로필을 갖는 항체들을 동일한 에피토프 빈으로 함께 모았다. Collected with the antibody having the same binding profile to the same epitope bin. 항체 비닝 연구의 결과를 표 8.3에 제시한다. The results of the antibody binning studies shown in Table 8.3.

<표 8.3> <Table 8.3>

Figure pat00011

에피토프 비닝의 추가 검사는 비아코어를 사용하여 수행하였다. Further inspection of the epitope binning was performed using the BIAcore. 3개의 mAb, 즉 16F12, 21B12 및 31H4를 유동 셀 2, 3 및 4 상에 약 8000 RU의 밀도로 고정시켰다. Three mAb, i.e. were fixed for 16F12, 21B12 and 31H4 at a density of approximately 8000 RU on flow cell 2, 3 and 4. 인간, 마우스 및 사이노로부터의 5 nM PCSK9를 mAb 표면 위로 주입하여 약 100 내지 500 RU에 도달시켰다. By injecting a 5 nM PCSK9 from human, mouse, and between the furnace top surface mAb was reached about 100 to 500 RU. 이어서, 10 nM mAb를 PCSK9 표면 위로 주입하였다. It was then injected with 10 nM mAb PCSK9 top surface. 이어서, 3개의 mAb 위의 3개의 상이한 PCSK9 단백질에 대한 3개의 mAb의 결합을 기록하였다. It was then records the combination of the three mAb on three different PCSK9 protein above three mAb.

2개의 mAb가 항원 상의 유사한 에피토프를 갖는다면, mAb1은 mAb2에 이미 결합된 항원에 대한 결합을 보이지 않을 것이다. If the two mAb with similar epitopes on the antigen, mAb1 will not be seen binding to the already bound antigen to mAb2. 2개의 mAb가 항원 상의 상이한 에피토프를 갖는다면, mAb1은 mAb2에 결합된 항원에 대한 결합을 보일 것이다. If the two mAb with different epitopes on the antigen, mAb1 will exhibit binding to the antigen coupled to a mAb2. 도 5e에서는 이들 에피토프 비닝 결과를 인간 PCSK9 상의 3개의 mAb에 대한 그래프 형태로 도시한다. In Figure 5e shows an epitope binning these results in graphical form for three mAb on human PCSK9. mPCSK9 및 cPCSK9에 대해 유사한 패턴이 관찰되었다. A similar pattern was observed for mPCSK9 and cPCSK9. 그래프에 제시된 바와 같이, 16F12 및 31H4는 유사한 에피토프를 공유하는 것으로 보이고, 21B12는 상이한 에피토프를 갖는 것으로 보인다. As shown in the graph, 16F12 and 31H4 are shown that share the similar epitope, 21B12 seem to have different epitopes.

실시예 11 Example 11

D374Y PCSK9/LDLR 결합을 차단하기 위한 31H4 및 21B12의 효능 The efficacy of 31H4 and 21B12 to block PCSK9 D374Y / LDLR binding

본 실시예에서는 LDLR에 결합하는 PCSK9 D374Y의 능력을 차단하는데 있어서 2개의 항체에 대한 IC50 값을 제공한다. According to the present embodiment blocks the ability of the PCSK9 binding to the LDLR D374Y provides the IC50 values ​​for the two antibodies. 투명한 384웰 플레이트 (Costar)를 버퍼 A (100 mM 나트륨 카코딜레이트, pH 7.4) 내에 희석시킨 2 ㎍/ml의 염소 항-LDL 수용체 항체 (R&D 시스템즈)로 코팅하였다. In which the transparent 2 ㎍ / ml was diluted to 384-well plates (Costar) in buffer A (100 mM sodium Kakogawa delay agent, pH 7.4) were coated with goat anti -LDL receptor antibody (R & D Systems). 플레이트를 버퍼 A로 철저히 세척한 후, 2시간 동안 버퍼 B (버퍼 A 중의 1% 우유)로 차단하였다. After thoroughly washing the plate with Buffer A, it was blocked (1% milk in buffer A) B buffer for 2 hours. 세척 후에, 플레이트를 1.5시간 동안 버퍼 C (10 mM CaCl 2 를 보충한 버퍼 B) 내에 희석시킨 0.4 ㎍/ml의 LDL 수용체 (R&D 시스템즈)와 함께 인큐베이팅하였다. After washing, plates were incubated for 1.5 hours with buffer C (10 mM CaCl 2 buffer B supplement) was 0.4 ㎍ / ml of the LDL receptor (R & D Systems) diluted in. 상기 인큐베이션과 동시에, 20 ng/ml의 비오티닐화된 D374Y PCSK9를 버퍼 A 내에 희석한 다양한 농도의 31H4 IgG2, 31H4 IgG4, 21B12 IgG2 또는 21B12 IgG4 항체, 또는 버퍼 A 단독 (대조군)과 함께 인큐베이팅하였다. The incubation and at the same time, were incubated with 20 ng / ml of biotinylated of different concentrations diluted D374Y PCSK9 in the buffer A 31H4 IgG2, 31H4 IgG4, 21B12 IgG2 or 21B12 IgG4 antibody, or buffer A alone (control). LDL 수용체 함유 플레이트를 세척하고, 비오티닐화된 D374Y PCSK9/항체 혼합물을 플레이트에 옮기고, 1시간 동안 실온에서 인큐베이팅하였다. Washing the LDL receptor-containing plates, and biotinylated transferred to the carbonylation D374Y PCSK9 / antibody mixture to the plate and incubated for 1 hour at room temperature. LDL 수용체에 대한 비오티닐화된 D374Y의 결합은 버퍼 C 중의 500 ng/ml의 스트렙타비딘-HRP (바이오소스 (Biosource)), 이어서 TMB 기질 (KPL)과 함께 인큐베이팅하여 검출하였다. Biotage binding of the biotinylated D374Y for the LDL receptor was detected by incubating with streptavidin buffer C of 500 ng / ml of -HRP (Bio Source (Biosource)), followed by TMB substrate (KPL). 신호를 1N HCl로 켄칭하고, 흡광도를 450 nm에서 판독하였다. Quench the signal with 1N HCl, and the absorbance was read at 450 nm.

상기 결합 연구의 결과를 도 6a-6d에 도시한다. The results of the binding studies are shown in Figure 6a-6d. 요약하여 설명하면, 각각의 항체에 대해 IC 50 값을 결정하였고, 31H4 IgG2에 대해 199 pM (도 6a), 31H4 IgG4에 대해 156 pM (도 6b), 21B12 IgG2에 대해 170 pM (도 6c), 및 21B12 IgG4에 대해 169 pM (도 6d)인 것으로 밝혀졌다. To summarize the description, were determined the IC 50 value for each antibody, 199 pM (Fig. 6a), 156 pM (Fig. 6b) for 31H4 IgG4, 170 pM (Fig. 6c) for 21B12 IgG2 for 31H4 IgG2, and for 21B12 IgG4 was found to be 169 pM (Fig. 6d).

또한, 항체는 상기 분석에서 LDLR에 대한 야생형 PCSK9의 결합을 차단하였다. In addition, the antibody inhibited the binding of the wild-type PCSK9 for LDLR in the assay.

실시예 12 Example 12

세포 LDL 흡수 분석 Cellular LDL uptake analysis

본 실시예는 세포에 의한 LDL 흡수를 감소시키는 다양한 항원 결합 단백질의 능력을 입증한다. This example demonstrates the ability of the various antigen-binding protein to reduce the LDL absorption by the cell. 인간 HepG2 세포를 흑색의 투명한 바닥의 96-웰 플레이트 (코스타) 내에 5x10 5 세포/웰의 농도로 10% FBS를 보충한 DMEM 배지 (미디아테크, 인크 (Mediatech, Inc)) 내에 접종하고, 37℃ (5% CO 2 )에서 밤새 인큐베이팅하였다. Inoculated with human HepG2 cells in 5x10 5 cells / well one supplemented with 10% FBS at a concentration of the DMEM medium (Media Tech, Inc. (Mediatech, Inc)) in a 96-well plate (Costa) of the transparent bottom of the black and, 37 ℃ in (5% CO 2) was incubated overnight. PCSK9 및 항체 복합체를 형성하기 위해, 2 ㎍/ml의 D374Y 인간 PCSK9를 흡수 버퍼 (1% FBS가 존재하는 DMEM) 내에 희석한 다양한 농도의 항체, 또는 흡수 버퍼 단독 (대조군)과 함께 1시간 동안 실온에서 인큐베이팅하였다. Room temperature for 1 hour with PCSK9 and to form an antibody conjugate, 2 ㎍ / ml of D374Y human PCSK9 absorbing buffer antibodies of different concentrations diluted in the (1% FBS is present DMEM to), or absorption buffer alone (control) It was incubated in. 세포를 PBS로 세척한 후, D374Y PCSK9/항체 혼합물을 세포에, 이어서 6 ㎍/ml의 최종 농도로 흡수 버퍼 내에 희석한 LDL-BODIPY (인비트로겐)에 옮겼다. After washing the cells with PBS, D374Y PCSK9 / antibody mixture to the cells, then transferred to the LDL-BODIPY (Invitrogen) diluted in uptake buffer to a final concentration of 6 ㎍ / ml. 3시간 동안 37℃ (5% CO 2 )에서 인큐베이팅한 후, 세포를 PBS로 철저히 세척하고, 세포 형광 신호를 480-520 nm (여기) 및 520-600 nm (방출)에서 Safire™ (TECAN)에 의해 검출하였다. For 3 hours and then incubated at 37 ℃ (5% CO 2) , the cells were washed thoroughly with PBS, and cell fluorescence signal in ™ Safire (TECAN) at 480-520 nm (here) and 520-600 nm (emission) It was detected by.

세포 흡수 분석의 결과를 도 7a-7d에 도시한다. The results of the cellular uptake analysis is shown in Figure 7a-7d. 요약하여 설명하면, 각각의 항체에 대해 IC 50 값을 결정하였고, 31H4 IgG2에 대해 16.7 nM (도 7a), 31H4 IgG4에 대해 13.3 nM (도 7b), 21B12 IgG2에 대해 13.3 nM (도 7c), 21B12 IgG4에 대해 18 nM (도 7d)인 것으로 밝혀졌다. To summarize the description, were determined the IC 50 value for each antibody, 31H4 IgG2 16.7 nM (Fig. 7a), 13.3 nM (Fig. 7b) for 31H4 IgG4, for 21B12 IgG2 13.3 nM (Fig. 7c) for, for 21B12 IgG4 were found to be 18 nM (Fig. 7d). 이 결과는 적용된 항원 결합 단백질이 세포에 의한 LDL 흡수를 차단하는 PCSK9 (D374Y)의 효과를 감소시킬 수 있음을 입증한다. These results demonstrate that the applied antigen-binding protein is able to reduce the effect of PCSK9 (D374Y) to block LDL uptake by the cell. 항체는 또한 상기 분석에서 야생형 PCSK9의 효과를 차단하였다. Antibodies were also blocked the effect of wild-type PCSK9 in the assay.

실시예 13 Example 13

6일 연구에서 31H4 항체의 혈청 콜레스테롤 저하 효과 Serum cholesterol-lowering effect of the 31H4 antibody at six days study

PCSK9 단백질에 대한 항체 요법을 통해 야생형 (WT) 마우스에서 총 혈청 콜레스테롤 (TC) 저하를 평가하기 위해, 다음 절차를 수행하였다. Through an antibody therapy for PCSK9 protein to assess the total serum cholesterol (TC) decreased in wild type (WT) mice, was performed the following procedures:

잭슨 래보러토리 (Jackson Laboratory, 미국 메인주 바 하버)로부터 입수한 수컷 WT 마우스 (C57BL/6 주, 9-10주령, 17-27 g)에게 실험 기간 내내 표준 먹이 (할랜드-테클라드 (Harland-Teklad), Diet 2918)를 먹였다. See Jackson Laboratories Tory (Jackson Laboratory, Bar Harbor, Maine) obtained from male WT mice (C57BL / 6 weeks, 9-10 weeks old, 17-27 g) to a standard food (to land throughout the experimental period tekeul rod (Harland -Teklad), Diet 2918) and fed to. 마우스에게 T=0에서 마우스의 꼬리 정맥을 통해 항-PCSK9 항체 31H4 (PBS 중의 2 mg/ml) 또는 대조군 IgG (PBS 중의 2 mg/ml)를 10 mg/kg의 수준으로 투여하였다. To the mouse T = 0 wherein -PCSK9 antibody 31H4 (2 mg / ml in PBS) or control IgG (2 mg / ml in PBS) through the tail vein of mice was administered at a level of 10 mg / kg. 나이브 마우스를 또한 나이브 대조군으로서 따로 준비하였다. The naive mice were also separately prepared as the naive control group. 투여군 및 희생 시간을 표 9에 제시한다. It presents a group of time and expense in Table 9.

Figure pat00012

마우스를 표 9에 제시된 소정의 시점에 CO 2 질식에 의해 희생시켰다. At a predetermined point in time indicated the mice are shown in Table 9 were sacrificed by CO 2 asphyxiation. 혈액을 대정맥을 통해 에펜도르프관 내로 모으고, 실온에서 30분 동안 응고시켰다. Collecting the blood into the Eppendorf tube through the vena cava was solidified at room temperature for 30 minutes. 이어서, 샘플을 10분 동안 12,000xg에서 탁상형 원심분리기로 원심분리시켜 혈청을 분리하였다. Then, by centrifuging samples in table-top centrifuge at 12,000xg for 10 minutes to separate the serum. 혈청 총 콜레스테롤 및 HDL-C를 히다찌 (Hitachi) 912 임상 분석기 및 로슈 (Roche)/히다찌 TC 및 HDL-C 키트를 사용하여 측정하였다. Serum total cholesterol and HDL-C was determined using a Hitachi (Hitachi) 912 clinical analyzer and Roche (Roche) / Hitachi TC and HDL-C kit.

실험 결과를 도 8a-8d에 도시한다. The experimental results are shown in Figure 8a-8d. 요약하여 설명하면, 항체 31H4를 투여한 마우스는 실험 과정에 걸쳐 감소된 혈청 콜레스테롤 수준을 보여주었다 (도 8a 및 도 8b). To summarize the description, the mice administered with the antibody 31H4 showed that the serum cholesterol level decreased over the course of the experiment (Fig. 8a and 8b). 또한, 마우스가 또한 감소된 HDL 수준을 보였음에 주목한다 (도 8c 및 도 8d). Also, attention is directed to the boyeoteum the mice also decreased the HDL level (Fig. 8c and 8d). 도 8a 및 도 8c에 대해, 변화 백분율은 동일한 시점에서 대조군 IgG와 비교한 값이다 ( * P<0.01, #P<0.05). For the Figure 8a and Figure 8c, the percentage change is a value compared to control IgG from the same time point (* P <0.01, #P < 0.05). 도 8b 및 도 8d에 대해, 변화 백분율은 t=0 hr에 나이브 동물에서 측정된 총 혈청 콜레스테롤 및 HDL 수준과 비교한 값이다 ( * P<0.01, #P<0.05). For 8b and 8d, it is a value compared to the percentage change in total serum cholesterol in t = 0 hr measured in naive animals and HDL levels (* P <0.01, #P < 0.05).

저하된 HDL 수준에 관하여, 당업자는 마우스에서 HDL의 감소가, HDL 감소가 인간에서 일어날 것임을 표시하는 것이 아니라 단지 유기체 내의 혈청 콜레스테롤 수준이 감소되었음을 추가로 반영함을 알 것이다. About lowered HDL levels, those skilled in the art will recognize that reflect further that the reduction of HDL in mice, reduced HDL, rather than simply indicating that occur in human serum cholesterol level in the organism decreases. 대부분의 혈청 콜레스테롤을 LDL 입자 상에 운반하는 인간과는 상이하게, 마우스는 대부분의 혈청 콜레스테롤을 고밀도 지단백질 (HDL) 입자 내에 운송함에 주목한다. To the majority of serum cholesterol is different from humans and which carries on the LDL particle, the mouse is noted as transport most of the serum cholesterol in high density lipoprotein (HDL) particles. 마우스에서, 총 혈청 콜레스테롤의 측정은 혈청 HDL-C 수준과 가장 밀접하게 유사하다. In mice, the measurement of total serum cholesterol is similar to most closely with serum HDL-C levels. 마우스 HDL은 LDL 수용체 (LDLR)에 대한 리간드인 아포지단백질 E (apoE)를 함유하고, LDLR에 의해 청소되도록 한다. Mouse HDL is such that containing the apolipoprotein E (apoE) ligand for the LDL receptor (LDLR), and cleaning by the LDLR. 따라서, HDL 검사는 마우스에서 본 실시예에 대한 적절한 지표이다 (HDL의 감소가 인간에 대해서는 예상되지 않음을 알면서). Thus, HDL test (not knowing the expected decrease in HDL for humans) is an appropriate indicator of the present embodiment in the mouse. 이와 대조적으로, 예를 들어, 인간 HDL은 apoE를 함유하지 않고 LDLR에 대한 리간드가 아니다. In contrast, for example, human HDL are without containing apoE is not a ligand to the LDLR. PCSK9 항체는 마우스에서 LDLR 발현을 증가시키므로, 간은 보다 많은 HDL을 청소하여 혈청 HDL-C 수준을 저하시킬 수 있다. PCSK9 antibody increases the expression of LDLR in mice, the liver can clean the more HDL decreased serum HDL-C levels.

실시예 14 Example 14

6일 연구에서 LDLR 수준에 대한 항체 31H4의 효과 The effect of antibody 31H4 on LDLR levels in the 6th Research

본 실시예는 항원 결합 단백질이 예측된 바와 같이 시간 경과에 따라 대상에서 LDLR 수준을 변경함을 입증한다. This embodiment demonstrates that the change in the target level of LDLR with the lapse of time as the antigen-binding protein prediction. LDLR 수준에 대한 항체 31H4의 효과를 확인하기 위해 웨스턴 블롯 분석을 수행하였다. To determine the effect of antibody 31H4 on LDLR levels it was performed by Western blot analysis. 실시예 13에 설명된 바와 같이 희생시킨 마우스로부터 얻은 50-100 mg의 간 조직을 완전 프로테아제 억제제 (로슈)를 함유하는 0.3 ml의 RIPA 버퍼 (산타 크루즈 바이오테크놀로지 인크.) 내에 균질화시켰다. Conducting tissue between 50-100 mg of Example 13 obtained from the mice sacrificed as described in the homogenized in complete protease inhibitors (Roche), 0.3 ml of RIPA buffer (Santa Cruz Biotechnology Inc.) containing. 균질물을 얼음 상에서 30분 동안 인큐베이팅하고, 원심분리하여 세포 파쇄물을 펠렛화하였다. The homogenate was incubated for 30 min on ice and Chemistry, pellet the cell debris by centrifugation. 상등액 내의 단백질 농도는 BioRad 단백질 분석 시약 (바이오라드 래보러토리스 (BioRad laboratories))을 사용하여 측정하였다. Protein concentration in the supernatant was determined using the BioRad protein assay reagent (Bio-Rad Laboratories see below (BioRad laboratories)). 100 ㎍의 단백질을 70℃에서 10분 동안 변성시키고, 4-12% Bis-Tris SDS 구배 겔 (인비트로겐) 상에서 분리시켰다. A protein of 100 ㎍ was denatured at 70 ℃ for 10 minutes, it was separated on a 4-12% Bis-Tris SDS gradient gel (Invitrogen). 단백질을 0.45 ㎛ PVDF 막 (인비트로겐)에 옮기고, 5% 무지방 우유를 함유하는 세척 버퍼 (50 mM Tris PH 7.5, 150 mM NaCl, 2mM CaCl 2 및 0.05% Tween 20) 내에서 1시간 동안 실온에서 차단하였다. Protein to 0.45 ㎛ PVDF transferred to a membrane (Invitrogen), 5% in the fat-free wash buffer containing milk (50 mM Tris PH 7.5, 150 mM NaCl, 2mM CaCl 2 and 0.05% Tween 20) for 1 hour at room temperature It was blocked. 이어서, 블롯 (blot)을 염소 항-마우스 LDLR 항체 (R&D 시스템) 1:2000 또는 항-β 액틴 (시그마 (sigma)) 1:2000으로 1시간 동안 실온에서 프로빙하였다. Subsequently, wherein the blot (blot), goat-mouse LDLR antibody (R & D systems) 1: 2000 or anti -β-actin (Sigma (sigma)) 1 were probed for 1 hour at room temperature in 2000. 블롯을 잠깐 동안 세척하고, 소 항-염소 IgG-HRP (산타 크루즈 바이오테크놀로지 인크.) 1:2000 또는 염소 항-마우스 IgG-HRP (업스테이트 (Upstate)) 1:2000과 함께 인큐베이팅하였다. Wash the blot for a while, and bovine anti-goat IgG-HRP (Santa Cruz Biotechnology Inc.,) 1: 2000 or goat anti-mouse IgG-HRP (Upstate (Upstate)) 1: 2000 were incubated with. 실온에서 1시간의 인큐베이션 후에, 블롯을 철저히 세척하고, ECL 플러스 키트 (아머샴 바이오사이언시즈 (Amersham biosciences))를 사용하여 면역반응성 밴드를 검출하였다. After incubation of one hour at room temperature, thoroughly washing the blot and using the ECL plus kit (Amersham Biosciences (Amersham biosciences)) was detected in the immunoreactive band. 웨스턴 블롯에서는 도 9에 도시된 바와 같이 항체 31H4의 존재 하에 LDLR 단백질 수준의 증가를 보여주었다. The Western blot showed an increase in LDLR protein levels in the presence of antibodies 31H4, as shown in Fig.

실시예 15 Example 15

13일 연구에서 항체 31H4의 혈청 콜레스테롤 저하 효과 Serum cholesterol-lowering effect of the antibody in the 13 days study 31H4

13일 연구에서 PCSK9 단백질에 대한 항체 요법을 통한 야생형 (WT) 마우스에서 총 혈청 콜레스테롤 (TC) 저하를 평가하기 위해, 다음 절차를 수행하였다. To evaluate serum total cholesterol (TC) decreased in wild type (WT) mice with an antibody to PCSK9 protein therapies from 13 days study, carried out the following procedure.

잭슨 래보러토리로부터 입수한 수컷 WT 마우스 (C57BL/6 주, 9-10주령, 17-27 g)에게 수컷 WT 마우스 (C57BL/6 주, 9-10주령, 17-27 g)에게 실험 기간 내내 표준 먹이 (할랜드-테클라드, Diet 2918)를 먹였다. Jackson below to see a male WT mice obtained from Tori (C57BL / 6 weeks, 9-10 weeks old, 17-27 g) for male WT mice (C57BL / 6 weeks, 9-10 weeks old, 17-27 g) throughout the experimental period to the fed - (tekeul lard, Diet 2918 to land) standard food. 마우스에게 T=0에서 마우스의 꼬리 정맥을 통해 항-PCSK9 항체 31H4 (PBS 중의 2 mg/ml) 또는 대조군 IgG (PBS 중의 2 mg/ml)를 10 mg/kg의 수준으로 투여하였다. To the mouse T = 0 wherein -PCSK9 antibody 31H4 (2 mg / ml in PBS) or control IgG (2 mg / ml in PBS) through the tail vein of mice was administered at a level of 10 mg / kg. 나이브 마우스를 또한 나이브 대조군으로서 따로 준비하였다. The naive mice were also separately prepared as the naive control group.

투여군 및 희생 시간을 표 10에 제시한다. It presents a group of time and expense in Table 10. 동물을 희생시키고, 실시예 13에서와 같이 간을 추출하고 준비하였다. The liver, as in Example 13 to sacrifice the animal, and extracted and prepared.