FR3014695A1 - - Google Patents

Abstract

The invention relates to human targets of interest (TOI), anti-TOI ligands, kits, compositions and a method.

Description

HUMAN TARGETS II Technical Field The technology described in this document relates to ligands, e.g., antibodies for the treatment of diseases. Background It is recognized that individual human beings differ in their sequences and recently several individuals have had their sequence genome, eg James Watson and Craig Venter. A comparison of the genomic sequence of individuals revealed differences in their sequences in both the coding and non-coding portions of the genome. Some of these variations in humans are significant and contribute to phenotypic differences between individuals. In extreme cases, this will result in genetic diseases. The 1000 Genome Project aims to catalog sequences in the human genome, involving sequencing the genome of a very large sample of individuals from various populations. * human ethnics recognized in art. Proprotein convertase subtilisin / kexin type 9 (PCSK9) is a serine protease involved in the regulation of low density lipoprotein receptor (LDLR) protein levels (Horton et al., 2007, Seidah and Prat, 2007). In vitro experiments have demonstrated that the addition of PCSK9 to HepG2 cells lowers LDLR levels at the cell surface (Benjannet et al., 2004, Lagace et al., 2006, Maxwell et al., 2005; al., 2004). Experiments with mice have shown that increased PCSK9 protein levels decrease LDLR protein levels in the liver (Benjannet et al., 2004, Lagace et al., 2006, Maxwell 3014695 et al., 2005; et al., 2004), whereas knockout mice for PCSK9 have increased levels of LDLR in the liver (Rashid et al., 2005). In addition, various human PCSK9 mutations have been identified which result in either increased or decreased plasma LDL levels (Kotowski et al., 2006, Zhao et al., 2006). PCSK9 has been shown to interact strongly with LDLR proteins, is endocytosed with LDLRs, and exhibits coimmunofluorescence with LDLRs throughout the endosomal pathway (Lagace et al., 2006). PCSK9 is a prohormone-proprotein convertase of the subtilisin (S8) family of serine proteases (Seidah et al., 2003). Humans possess nine prohormoneproprotein convertases that can divide between the S8A and S8B subfamilies (Rawlings et al., 2006). Furin, PC1 / PC3, PC2, PACE4, PC4, PC5 / PC6 and PC7 / PC8 / LPC / SPC7 are classified in subfamily S8B. The crystal and NMR structures of the different domains of furin and mouse PC1 reveal pro-domains and subtilisin-like catalytic domains, and a P-domain directly at the C-terminal position with respect to the catalytic domain (Henrich et al. 2003, Tangrea et al., 2002). Based on the similarity of the amino acid sequence within this subfamily, the seven members have all been predicted to have similar structures (Henrich et al., 2005). SKI-1 / S1P and PCSK9 are classified in subfamily S8A. Sequence comparisons with these proteins also suggest the presence of pro-domains and subtilisin-like catalytic domains (Sakai et al., 1998, Seidah et al., 2003, Seidah et al., 1999). In these proteins, the sequence of C-terminal amino acids with respect to the catalytic domain is more variable and does not suggest the presence of a P domain. The prohormone-proprotein convertases are expressed as zymogens and they mature according to a multi-step process. The pro-domain's function in this process is twofold. The pro-domain acts primarily as a chaperone and is necessary for proper folding of the catalytic domain (Ikemura et al., 1987). Once the catalytic domain is folded, autocatalysis occurs between the pro domain and the catalytic domain. Following this initial cleavage reaction, the pro-domain remains bound to the catalytic domain where it then acts as an inhibitor of catalytic activity (Fu et al., 2000). When conditions are correct, maturation occurs with a second autocatalytic event at a site within the pro-domain (Anderson et al., 1997). Once this second cleavage event has occurred, the pro domain and the catalytic domain dissociate, giving rise to an active protease. Autocatalysis of the PCSK9 zymogen occurs between Gln152 and Ser153 (VFAQ1S1P) (Naureckiene et al., 2003), and has been shown to be necessary for its secretion from cells (Seidah et al., 2003). No second autocatalytic event was observed at a site within the PCSK9 pro-domain. The purified PCSK9 consists of two species that can be separated by non-reducing SDS-PAGE: the pro-domain at 17 Kd, and the more C-terminal catalytic domains at 65 Kd. PCSK9 was not isolated without its pro-inhibitory domain, and measurements of the catalytic activity of PCSK9 were variable (Naureckiene et al., 2003, Seidah et al., 2003).

In some embodiments, a PCSK9 polypeptide includes terminal residues, such as, but not limited to, residues of the leader sequence, targeting residues, amino terminal residues of methionine, residues of lysine, residues markers and / or fusion protein residues.  "PCSK9" was also named FH3, NARC1, HCHOLA3, proprotein convertase subtilisin / kexin type 9, and convertase 1 regulated by neuronal apoptosis.  The PCSK9 gene codes for a protein proprotein convertase which belongs to the subfamily of proteinases K of the family of secretory subtilases.  The term "PCSK9" indicates both the proprotein and the product generated as a result of autocatalysis of the proprotein.  When referring only to the autocatalysed product (such as for an antigen-binding protein or ligand that binds to the cleaved PCSK9), the protein can be referred to as "mature", "cleaved" PCSK9, " treated "or" active ".  When referring only to the inactive form, the protein may be termed "inactive", "pro form", or "untreated" form of PCSK9.  The term PCSK9 also encompasses PCSK9 molecules incorporating posttranslational modifications of the amino acid sequence of PCSK9, such as PCSK9 sequences that have been glycosylated, and PCSK9 sequences from which its signal sequence has been cleaved. a sequence of PCSK9 from which its pro-domain was cleaved from the catalytic domain but not separated from the catalytic domain (see, for example, Figures 1A and 1B of US20120093818A1).  Summary Through the analysis of human genetic variations and selection of rationally designed sequences, the present invention provides an improvement in the diagnosis and treatment of human patients based on variations in human PCSK9. .  Importantly, the invention promotes personalized drugs that target genotypes or phenotypes of individual human patients.  The inventor's analysis of large numbers of naturally occurring genomic sequences of human PCSK9 reveals that there is significant variation across various human populations and suggests the possibility of a correlation between individual human patients and personalized medical and diagnostic approaches that target the target.  The technical applications of these discoveries, according to the present invention, thus contribute to better treatment, better prophylaxis and better diagnosis in humans and offer patients the advantage of promoting drugs and personalized treatments.  This offers the benefits of better prescribing, less waste of drugs and improved chances of drug efficacy and better diagnosis in patients.  In addition, the inventor has surprisingly realized that certain rarer natural forms, although present in humans with frequencies much lower than the current form, are nonetheless represented in many different human populations. ethnically and usually with many human examples by represented ethnic population.  The inventor has realized that targeting of these rarer forms will provide effective treatment, prophylaxis or diagnosis across many human ethnic populations, thereby extending the utility of the present invention and serving patients better in these populations.  With this, the inventor has realized that there is a significant industrial and medical application for the invention in terms of a guide for selecting an anti-PCSK9 ligand for administration to humans for treatment and / or the prophylaxis of diseases and conditions mediated by or associated with PCSK9.  In this way, the patient receives drugs and ligands that are tailored to his needs - determined by the genetic or phenotypic constitution of the patient.  In conjunction with this, the invention provides genotyping and / or phenotyping of patients in connection with such treatment, thereby allowing the patient to be correctly matched with the drug.  This increases the chances of medical efficacy, reduces the likelihood of lower treatment using drugs or ligands that do not match the patient (eg, poor efficacy and / or side effects) and avoids poor prescriptions. pharmaceutical and waste.  To this end, the invention provides: In a first configuration an anti-human PCSK9 ligand for use in a method of treating and / or preventing a PCSK9 mediated disease or condition in a human being wherein the genome comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37, wherein the method comprises administering the ligand to the human being.  In a second configuration A ligand that binds human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27 for use in a method comprising the step of using the ligand to target said PCSK9 in a human to treat and / or prevent a PCSK9 mediated disease or condition, the method comprising administering the ligand to humans.  In a third configuration A pharmaceutical composition or kit for the treatment and / or prevention of PCSK9 mediated disease or disease.  In a fourth configuration, a method for producing a binding site of a human anti-PCSK9 antibody, the method comprising obtaining a plurality of anti-PCSK9 antibody binding sites, screening the sites of binding of the antibodies for binding to a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj and q or to a catalytic or C-terminal or peptide domain of which comprises an amino acid variation relative to the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of a binding site of an antibody which binds in the screening step and optionally producing a PCSK9-binding fragment or derivative of the form f, c, r, p, m, e, h, aj or q of the isolated antibody.  In a fifth configuration A method for producing an anti-human PCSK9 antibody, the method comprising immunizing a non-human vertebrate (e.g., a mouse or a rat) with a human PCSK9 comprising an acid sequence amino acids selected from the group consisting of amino acid sequences of the f, c, r, p, m, e, h, a, and q forms or a catalytic or C-terminal domain or a peptide thereof which comprises a amino acid variation with respect to the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of an antibody that binds a human PCSK9 selected from the group consisting of f, o, p, m, e , h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation with respect to the corresponding sequence of SEQ ID NO: 1, 2 or 3, and optionally the production of a fragment or derivative, binding PCSK9 of the f, c, r, p, e, h, aj or q form of the isolated antibody .  In a sixth configuration, a kit for genotyping PCSK9 of a human, wherein the kit comprises a nucleic acid (i) comprising a sequence of consecutive nucleotides that specifically hybridizes to a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 or at least the coding sequence for the catalytic domain or C-terminal domain thereof, or which specifically hybridizes to an antisense sequence or an RNA transcript of said sequence, wherein said consecutive nucleotide sequence hybridizes to at least one nucleotide present in said selected sequence that is not present in SEQ ID NO: 28 or that hybridizes to an antisense sequence or an RNA transcript thereof; and / or (ii) comprising a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 or comprising an antisense sequence or an RNA version of said consecutive nucleotides, wherein said consecutive nucleotide sequence comprises at least one nucleotide present in said selected sequence not present in SEQ ID NO: 28.  In seventh configuration Use of an anti-PCSK9 ligand that binds to human PCSK9 selected from the group consisting of f, c, r, m, e, h, aq and q forms in the manufacture of a medicament for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human whose genome comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37.  In an eighth configuration Use of an anti-PCSK9 ligand that binds a human PCSK9 selected from the group consisting of f, c, r, p, m, h, aq and q forms in the manufacture of a drug for the targeting of said PCSK9 in a human to treat and / or prevent a PCSK9 mediated disease or condition.  In a ninth configuration A method of targeting a PCSK9 for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human, the method comprising administering an anti-inflammatory ligand PCSK9 ligand to a human being comprising a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37, in which a PCSK9 encoded by said nucleotide sequence is targeted.  In a tenth configuration A method of treating and / or preventing a PCSK9 mediated disease or condition in a human, the method comprising targeting a human PCSK9 selected from the group consisting of , c, r, p, m, e, h, aj and q by administering to humans a ligand which binds said PCSK9, treating and / or preventing in this way said disease or condition in the To be human.  In an Eleventh Configuration A method of genotyping PCSK9 of a nucleic acid sample of a human being, the method comprising identifying in the sample the presence of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the sequence thereof coding for the catalytic domain or the C-terminal domain.  In a twelfth configuration A method of typing PCSK9 of a sample of human proteins, the method comprising identifying in the sample the presence of a human PCSK9 selected from the group consisting of f-forms, p, m, e, h, aj and q.  In a thirteenth configuration A method of treating and / or preventing in a human patient a cardiovascular disease or condition, or a disease or condition that is associated with elevated LDL-cholesterol (by for example, hypercholesterolemia), wherein the patient receives or has previously received statin therapy for said disease or condition, the method comprising typing the patient using a method of the invention and administering a ligand according to the present invention. invention, whereby the human being is treated or said disease or condition is prevented; possibly also reducing or stopping the statin treatment.  Brief description of the drawings This patent or application file contains at least one drawing executed in color.  Copies of this patent publication or patent application with one or more color drawings will be provided by the Office upon request and payment of royalties.  Figure 1 represents in silico modeling of variant residues on the surface of PCSK9.  Figure 2 illustrates the cumulative frequency distribution of alleles through the Project 1000 Genomes database of human VH3-23 alleles including SNP rs56069819 (such alleles being indicated by "C" and the most common allele). (which does not include this SNP) being indicated by 444 - "- 1.  Figure 3 illustrates the frameworks and CDRs encoded by VH3-23 * 04, as obtained from the IMGT database (available on the World Wide Web at www. IMGT. org).  Figure 4 illustrates the sequences of VH3-23 * 04.  The portion of VH3-23 * 04 comprising the residue change FW1 of 3014695 rs56069819 (SEQ ID NO: 38).  The portion of the nucleic acid sequence encoding rs56069819 is illustrated (SEQ ID NO: 39).  The FW1 encoded by VH3-23 * 04 is illustrated (SEQ ID NO: 40).  DETAILED DESCRIPTION Those skilled in the art will appreciate that SNPs or other changes that result in amino acid variation can cause variability in the conformation or activity of human targets to be targeted.  This has generated a great deal of interest in personalized medicine where genotyping and knowledge of protein and nucleotide viability are used to personalize drugs and more effective patient diagnoses.  The present invention provides pharmaceutical agents and custom assays that specifically target rarer variant forms of a human target of interest (TOI), this target being human PCSK9.  The present invention utilizes the power of analyzing human genetic variations and selecting rationally designed sequences.  The technical applications of these approaches, according to the present invention, contribute to better treatment, better prophylaxis and better diagnosis in humans and provide the patient with an advantage in providing choice and promoting personalized medicines and treatments.  This offers the advantage of better prescribing, less waste of drugs and increased chances of drug efficacy and better diagnosis in patients.  As sources of genomic sequence variation data, those skilled in the art will be informed of the basics of data and available resources (including updates thereof) provided by the following sources: HapMap (The International HapMap Consortium.  2003; http: // HapMap. ncbi. nim. nih. gov / index. html. in).  The HapMap 5 Project is an international project that aims to compare the genetic sequences of different individuals to identify chromosomal regions containing shared genetic variants.  The HapMap website offers tools for identifying chromosomal regions and variants within them, with options for accessing population level frequency data.  The 1000 Genomes Project (The 1000 Genomes Project Consortium 2010, available on the World Wide Web at http: // www. 1000genomes. org /).  This resource provides a complete genomic sequence for at least 2500 unidentified individuals from one of 25 distinct population groups.  SNP database from Japan (H.  Haga et al.  2002; available on the World Wide Web at http: // snp. ims. u-tokyo. ac. jp / index. html).  Based on an identifying study.  190,562 human genetic variants.  The present invention involves the identification and cataloging of naturally occurring human genomic target sequence variants, including those found to be relatively low frequency or rare frequency variants that distinguish specific human and human populations in many individual human beings.  One aspect of the invention is based on the rational design of a selection of sequences addressing the desirability of customizing drugs and diagnoses for rarer, but nevertheless significant, groups of human individuals who are suffering, or who are likely to suffer (ie, who is at risk) from a disease or condition that is mediated or associated with the target of interest.  In seeking this rational understanding of the present aspect of the invention, the inventor has included considerations of the distribution of the prevalence of 5 existing target sequence variants at the natural state through various multiple human populations, as well as that the importance of targeting those populations in which many individuals are likely to display a genotype and / or phenotype of one or more of the analyzed variants.  In the context of this conception, the inventor understood the importance of adopting recognized classifications in the art of human ethnic populations, and in this regard, the inventor based the analysis and design on ethnic populations This is the resource that is, and will continue to be, widely adopted by the scientific and medical community.  Figure 2 shows the cumulative frequency distribution of alleles in the Project 1000 Genomes database of human VH3-23 alleles including SNP rs56069819 (such alleles being indicated by "C" and the most common allele (which does not include this SNP) being indicated by "A").  The figure shows that VH3-23 alleles including SNP rs56069819 are present at a cumulative frequency of 11% in all human ethnic populations taken as a whole, while in some specific human ethnic subpopulations (ASW, LWK, YRI , CEU and GBR), such alleles are present at a cumulative frequency above the mean.  As shown in the figure, these variant forms of human PCSK9 (labeled "Variants") which are found in the various subpopulations with an above-average occurrence of human VH3-23 alleles including SNP rs56069819.  Thus, in this aspect of the invention, the inventor has devised the following selection criteria for variant sequences, which are criteria which, according to the inventor, will provide drugs and diagnostics useful for a personalized need in the human population.  Selection Criteria Three or four of the following: variant sequences of naturally occurring human PCSK9 exhibiting a cumulative frequency of human alleles of 35% or less; variant sequences of naturally occurring human PCSK9 exhibiting a total frequency of a human genotype of 40% or less; variant sequences of naturally occurring human PCSK9 found in many different human ethnic populations (using the conventional categorization of the 1000 Genome Project, see Table 3 below); and variant sequences of naturally occurring human PCSK9 found in many individuals distributed through these many different ethnic populations.  The selection of the inventor has included, as a consideration, the selection of a nucleotide variation which has produced a variation of amino acid in the corresponding forms of PCSK9 (i.e., variations not synonymous), as opposed to silky variations that do not alter the amino acid residues in the target protein.  Optionally, further sequence analysis and 3D in silico modeling (e.g., see Figure 1) may be used as an additional selection criterion: variants variant amino acid residues (against the most The subject of the human PCSK9) exposed to the surface on the target is desirable for selection, since the inventor has considered these as contributing to the determination of the topography of the target and as a potential contributor to how: and where Ligand binding to the target occurs.  In one embodiment, the cumulative frequency of human alleles is 30, 25, 20, 15, 10 or 5% or less, for example, in the range of 1 to 20% or 1 to 15% or 1 to 10%. %.  In one embodiment, the total frequency of a human genotype is 35, 30, 25, 20, 15, 10 or 5% or less, for example, in the range of 1 to 25%, 1 to 20%, 1 to 15%, 1 to about 15%, 1 to 10%, 1 to about 10% or 1 to 5% or 1 to about 5%.  In one embodiment, naturally occurring human variant target sequences are found in at least 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 different human ethnic populations ( using the conventional categorization of the 1000 Genomes Project).  In one embodiment, naturally occurring human target variant sequences are found in at least 20, 25, 30, 35, 40, 45, 50, 55, 60-, 65, 70, 75, 80, 85 , 90, x. 95, 100, 105, 110, 115, 120, 130, 140 or 150 individuals distributed across these many different ethnic populations.  In one example, the following criteria are applied - variant sequences of naturally occurring human PCSK9 having a cumulative frequency of human alleles of 15% or less; variant sequences of naturally occurring human PCSK9 exhibiting a total frequency of a human genotype of 20% or less; - variant sequences of naturally occurring human PCSK9 found in at least 5 different human ethnic populations (using the classical categorization of the 1000 Genomes Project); and variant sequences of naturally occurring human PCSK9 found in many individuals distributed across these many different ethnic populations.  In all aspects, configurations, examples, embodiments, clauses or concepts in this document, frequencies can be determined using bioinformatics.  In all aspects, configurations, examples, embodiments, clauses or concepts in this document, the frequencies can be determined by reference to a database comprising at least 1000 or 2000 human sequences.  In all aspects, configurations, examples, embodiments, clauses or concepts in this document, "frequency of a heterozygous human genotype" means the cumulative frequency of all genotypes in the sample or database or in humans having an occurrence of the rare variant allele and an occurrence of another allele (heterozygous state), for example, a genotype in the 1000 genome database.  In all aspects, configurations, examples, embodiments, clauses or concepts in this document, "frequency of a homozygous human genotype" means the cumulative frequency of two occurrences of the variant allele (homozygous state), for example, a genotype in the 1000 Genomes database.  In all aspects, configurations, examples, embodiments, clauses or concepts in this document, "total human genotype 3014695" means the total frequencies of a more homozygous heterozygous human genotype.  In all the aspects, configurations, examples, embodiments, clauses or concepts in this document, "cumulative frequency" of a human allele "refers to the total of all occurrences of the variant allele in the sample or the database or in humans, for example, in the Project 1000 Genomes database.  In one example, the criteria are applied with reference to one or more human genomic sequence databases as described herein.  For example, the criteria are those as applied in the 1000 Genomes database.  For example, in all aspects, examples, embodiments or configurations of the invention, the database of 1000 Genomes version 13.  For example, the database of 1000 Genomes in its most recent version such as that of October 1, 2013.  The following bioinformatics protocol is envisioned to identify human sequences for use in the present invention: (a) Identify a genomic region containing a target sequence of interest of PCSK9 ('target genomic region') and calculate the genomic coordinates, using the coordinates that correspond to the constructed construct of sequences used by either the 1000 Genome Project or the International HapMap Project (or other selected human gene selection database).  (b) Identify genomic variants localized in the genomic region identified previously in (a).  Collect allele frequencies for variants for each super population and preferably subpopulation where such data are available.  The VWC Tools for Project 1000 Genomes can be used for this step.  (c) Filter the list of genomic variants from the target genomic region to contain only variants classified as either 'non-synonymous' single nucleotide polymorphisms (SNPs) or genomic 'inselions' or 'deletions' .  Filter further to include those that are present only in exon sequences.  "Not synonymous" refers to a nucleotide variation that produces an amino acid change (i.e., excluding silent mutations).  (d) Correlate population frequency data for each of the identified variants for each of the superpopulations (eg 'European descent', 15 'East Asian ancestry', 'African descent' 'West', 'Ancestry of the Americas', and 'South Asian Ancestry') to identify those variants that distinguish with less than two super-populations.  Correlate further all variants identified with each of the subpopulations (for example, by 20, the 'European Ancestry' super population can be divided into groups such as 'CEU - Utah residents with ancestry from Northern Europe'. North West, TSI - Tuscany in Italy and British of England and Scotland) and produce a second score for the rarity of variants within a super population.  (e) Collecting one or more sequences that show a distinction of specific subpopulations for use in the present invention, for example, according to the selection criteria as described herein.  Human Populations Eventually, ethnic populations are selected from those identified in the 1000 Genome Project database.  In this regard, see the.  Table 3 provides details of the ethnic populations on which the 1000 Genomes Project data base is based.  A Rosenberg et al (Science 20 December 2002: vol.  298 no.  5602 2342-2343) studied the genetic structure of human populations of different geographic ancestry.  A total of 52 populations were sampled, these being populations with: African descent 10 (Mbuti pygmies, Biaka pygmies, San people, and speakers of the Nigerian-Kordofanian languages (Bantu, Yoruba or Mandenka populations), Ancestry Eurasian (European ancestry (Orcadians, Adygel, Basques, 15 French, Russians, Italians, Sardis, Tuscan), Middle Eastern (Mozabites, Bedouins, Druze, Palestinians) ancestry, Central / South Asian ancestry (Balochl, Brahul, Makrani, Sindhi, Pathan, Burusho, Hazara, Uygur, Kalash)), 20 Ancestry of East Asia (Han, Dal, Daur, Hezhen, Lahu, Miao, Orogen, She, Tujia, Tu, Xibo, Yi, Mongolians, Naxi, Cambodians, Japanese, Yakut), Oceanic ancestry (Melanesians, Papuans) or Ancestry of the Americas 25 (Karitiana, Surui, Colombian, Mayas, Pima).  The HapMap International Project, Nature, 2003 Dec 18; 426 (6968): 789-96, describes this objective of the HapMap project: to determine the common patterns of DNA sequence variations in the human genome by determining the genotypes of one million or more sequence variants, their frequencies and the degree of association between them in DNA samples from populations with ancestry from parts of Africa, Asia and Europe.  Relevant human populations of differing geographic origin include Yoruba, Japanese, Chinese, Northern European and Western European populations.  More specifically, the population of Utah with ancestry from Northern or Western Europe (samples collected in 1980 by the Center for the Study of Human Polymorphism (CEPH)), population with ancestry of the Yorubas d Ibadan, Nigeria 10 population with Japanese ancestry; and population with Han Chinese ancestry from China.  The authors, citing earlier publications, suggest that ancestral geography is a reasonable basis for sampling human populations.  An appropriate sample of human populations used in the present invention is as follows: (a) European ancestry (b) North European ancestry; ancestry of Western Europe; Tuscan ancestry; British ancestry, Finnish ancestry or Iberian descent.  (c) More specifically, the population of Utah residents with ancestry from northern and / or western Europe; the Tuscan population in Italy; the British population in England and / or Scotland; the Finnish population in Finland; or the Iberian population in Spain.  (a) East Asian ancestry (b) Japanese ancestry; Chinese descent or Vietnamese descent.  (c) More specifically, the Japanese population in Tokyo, Japan; Han Chinese population in Beijing, China; the Chinese population Dai in Xishuangbanna; the Kinh population in Ho Chi Minh City, Vietnam; or the Chinese population in Denver, Colorado, USA.  (a) West African Ancestry (b) Yoruba Ancestry; Luhya ancestry; Gambian descent; or Malawian ancestry.  (c) More specifically, the Yoruba population in Ibadan, Nigeria; > the Luhya population in Webuye, Kenya; the Gambian population in the West Division, The Gambia; or the Malawian population in Blantyre, Malawi.  (a) Population of the Americas (b) Native American Ancestry; Afro-Caribbean descent; Mexican ancestry; Puerto Rican descent; Colombian ancestry; or Peruvian descent.  (c) More specifically, the population of African descent in the southwestern United States; the population of African Americans in Jackson, MS; the population of Afro-Caribbean in Barbados; the population of Mexican descent in Los Angeles, CA; the population of Puerto Rican descent in Puerto Rico; the population of Colombian descent in Medellin, Colombia; or the population of Peruvian descent in Lima, Peru.  20 (a) South Asian ancestry (b) Ahom ancestry; Kayadtha ancestry; Reddy ancestry; Maratha; or Punjabi ancestry.  (c) More specifically, the Ahom population in Assam State, India; Kayadtha population in Calcutta, Indel; the Reddy population in Hyderabad, India; the Maratha population in Mumbai, India; or the Punjabi population in Lahore, Pakistan.  In all embodiments of the invention, in one embodiment, each human population is selected from a population marked "(a)" above.  In all configurations of the invention, in one embodiment, each human population is from a population marked "(b)" to all configurations of the invention, in each human population is selected from of a population marked "(c)" above.  In one embodiment, the ethnic populations are selected from the group consisting of an ethnic population with European ancestry, an ethnic population with ancestry from East Asia, an ethnic population with ancestry of the East. West Africa, an ethnic population with ancestry from the Americas and an ethnic population with ancestry from South Asia.  In one embodiment, the ethnic populations are selected from the group consisting of an ethnic population with ancestry from Northern Europe; or an ethnic population with a descent from Europe of selected dessua.  In mode of, fulfilling, the West with one or an ethnic population ancestry ancestry descent ancestry descent ancestry descent ancestry descent 20 Tuscan; or an ethnic population with a British; or an ethnic population with an Icelandic; or an ethnic population with Finnish; or an ethnic population with an Iberian; op an ethnic population with a Japanese 25; or an ethnic population with a Chinese; or an ethnic population with a Vietnamese; or an ethnic population with Yoruba ancestry; or an ethnic population with Luhya ancestry; or an ethnic population with 30 Gambian ancestry; or an ethnic population with Malawian ancestry; or an ethnic population with native American descent or an ethnic population with Afro-Caribbean ancestry; or an ethnic population with Mexican ancestry; or an ethnic population with Puerto Rican descent; or an ethnic population with Colombian ancestry; or an ethnic population with Peruvian descent; or an ethnic population with a 5 Ahom ancestry; or an ethnic population with ancestry Kayadtha; or an ethnic population with Reddy ancestry; or an ethnic population with Maratha ancestry; or an ethnic population with Punjabi ancestry.  Anti-Target Ligands The invention provides anti-target ligands useful for addressing humans suffering or likely to suffer from a PCSK9 mediated or associated disease or condition.  For example, the ligand specifically binds to a variant of PCSK9 according to the invention.  The ligand can inhibit or antagonize the activity of the target PCSK9, for example, the ligand neutralizes the target.  Those skilled in the art will be familiar with neutralizing ligands in general, such as antibodies or antibody fragments, and will readily be able to test ligands suitable for specific binding and / or neutralization of an in vitro target or in an in vivo test.  In one example, the ligand is (or has been determined to be) a neutralizer of PCSK9.  In one example, the determination is made in a human (for example, in a clinical trial).  In one example, the determination is carried out in a non-human being, for example, in a non-human mouse, rat, rabbit, pig, dog, sheep or primate (e.g., a Cynomolgus monkey, a monkey). 30 rhesus or baboon).  An antibody "fragment" comprises a portion of an intact antibody, preferably the antigen binding and / or variable region of the intact antibody.  Examples of antibody fragments include dAb, Fab, Fab ', F (ab') 2 and Fv fragments, diabodies; linear antibodies; single-chain antibody molecules and multispecific antibodies formed from antibody fragments.  In one embodiment, the ligand of the invention is or comprises an antibody or an antibody fragment, for example, an antibody or fragment comprising human variable regions (and possibly also human constant regions).  Antibodies and antiPCSK9 or PCSK9-binding or targeting fragments may be prepared by any known method, for example, using transgenic mice (eg, KymouseTM or VelocimouseTM, or OmnimouseTM, XenomouseTM, HuMab Mouse ™). or the MeMo MouseTm), rats (eg, OmniratTM), camelids, sharks, rabbits, chickens or other non-human animals immunized with PCSK9, this possibly followed by humanization of the constant regions and or variable regions for producing human or humanized antibodies.  In one example, presentation technologies may be used, such as yeast, phage or ribosome display, as will be apparent to those skilled in the art.  Conventional affinity processing, for example, using a display technology, can be carried out in another step after isolation of a leader antibody from a transgenic animal, a phage display library. or another bank.  Representative examples of suitable technologies are described in US20120093818 (Amgen, Inc.), which is incorporated herein by reference in its entirety, for example, the methods set forth in paragraphs [0309] to [0346].  In general, a VELOCIMMUNETm or other mouse or rat may be tested with the antigen of interest, and lymphatic cells (such as B cells) are recovered from the mice that express antibodies.  The lymphatic cells can be fused with a myeloma cell line to prepare immortal hybridoma cell lines, and such hybridoma cell lines are screened and screened for hybridoma cell lines that produce antibodies specific for the antigen of interest.  DNA encoding the variable regions of the heavy chain and the light chain can be isolated and bound to desirable isotype constant regions of the heavy chain and the light chain.  Such an antibody protein can be produced in a cell, such as a CHO cell.  Alternatively, the DNA encoding the antigen-specific chimeric antibodies or the light and heavy chain variable domains can be isolated directly from the antigen-specific lymphocytes.  Initially, high affinity chimeric antibodies are isolated which comprise a human variable region and a mouse constant region.  As described below, antibodies are characterized and selected for desirable characteristics, including affinity, selectivity, epitope, and the like.  The mouse constant regions are replaced by a desired human constant region to generate the fully human antibody of the invention, for example wild-type or modified IgG1 or IgG4 (e.g., SEQ ID NO: 751, 752, 753). in US2011 / 0065902 (which is incorporated herein by reference in its entirety), which sequences are hereby incorporated by reference for use in the ligands of the present invention).  While the selected constant region may vary according to a specific use, the binding characteristics of an antigen with high affinity and specificity for the target reside in the variable region.  In one example, the ligand of the invention is or comprises a nucleic acid, for example, RNA, for example, a siRNA which hybridizes under stringent conditions to the variant sequence of PCSK9, for example, hybridizes to a nucleotide sequence comprising one or more nucleotides that are variants (as opposed to the most common PCSK9 sequence, for example, with reference to the Project 1000 Genomes database).  For example, the nucleic acid hybridizes to a region immediately flanking a nucleotide which is a variant compared to the corresponding nucleotide of the nucleotide sequence of PCSK9 having the highest cumulative frequency of human alleles and / or the total frequency. higher of a human genotype.  In one example, the nucleic acid hybridizes to two or more of these variant nucleotides.  Specific hybridization is performed under stringent conditions, as will be apparent to those skilled in the art, for example, 5X SSC, 5X Denhardt reagent, and 0.5% SDS at 65 ° C.  The target binding capacity, specificity, and binding affinity (Kd, Kdis, and / or Kass) can be determined by any routine method in the art, for example, surface plasmon resonance (SPR).  The term "Kd" as used herein is intended to refer to the equilibrium dissociation constant of a particular antibody-antigen interaction.  In one embodiment, surface plasmon resonance (RPS) is performed at 25 ° C.  In another embodiment, the RPS is performed at 37 ° C.  In one embodiment, the SPR is performed at physiological pH, such as about pH 7 or pH 7.6 (for example, using Hepes buffered saline at pH 7.6 (also referred to as HBS-EP). )).  In one embodiment, the RPS is performed at a physiological salt concentration, for example, 150 mM NaCl.  In one embodiment, the SPR is performed at a detergent concentration that is not greater than 0.05% by volume, for example, in the presence of P20 (polysorbate 20, e.g., Tween-20TM) at 0, 05% and EDTA at 3 mM.  In one example, the SPR is performed at 25 ° C or 37 ° C in pH 7.6 buffer, 150 mM NaCl, 0.05% detergent (eg, P20) and 3 mM EDTA.  The buffer may contain 10 mM Hepes.  In one example, the RPS is performed at 25 ° C or 37 ° C in HBS-EP.  HBS-EP is available from Teknova Inc. (California, catalog number H8022).  In one example, the ligand affinity (e.g., antibody) is determined using the 1-RPS.  Coupled anti-mouse IgG (or a constant region of an antibody of another relevant human, rat or non-human vertebrate of a corresponding species) (e.g., Biacore ™ BR-1008- 38) to a biosensor chip (e.g., a GLM chip) as by primary amine coupling; 2.  Exposing the anti-mouse IgG (or an antibody of a corresponding species) to an IgG antibody of the assay to capture the test antibody on the chip; 3.  Passing the test antigen on the capture surface of the chip at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM with 0 nM (i.e., buffer alone); and 4.  Determining the binding affinity of test antibody to test antigen using surface plasmon resonance, for example, under RPS conditions discussed above (e.g., at 25 ° C in buffer Physiological).  RPS can be performed using any conventional RPS device, such as by BiacoreTM or using ProteOn XPR36TM (Bio-Rad0).  Regeneration of the capture surface can be performed with 10 mM glycine at pH 1.7.  This eliminates the captured antibody and allows the surface to be used for another interaction.  Binding data can be adjusted to a 1/1 intrinsic model using standard techniques, for example, using a model intrinsic to ProteOn XPR36TM analysis software. In one example, the ligand of the invention is contained in a medical container, for example, a vial, a syringe, an IV container or an injection device (for example, an intraocular or intravitreal injection device).  In one example, the ligand is in vitro, for example, in a sterile container.  In one example, the invention provides a kit comprising the ligand of the invention, a package and instructions for use in the treatment or prevention or diagnosis in a human of a disease or a mediated condition. by PCSK9.  In one example, the instructions indicate that the human should be genotyped for a variant sequence of the PCSK9 of the invention prior to administration of the ligand to humans.  In one example, the instructions indicate that the human must be phenotyped for a PCSK9 variant of the invention prior to administration of the ligand to humans.  In one example, the human being is of Chinese ethnicity (for example, Han or CHS) and the instructions are in Chinese (for example, in Mandarin).  In one example, the instructions include instructions for administering alirocumab or evolocumab to said human being.  The invention addresses the need to treat humans with rarer alleles, genotypes, and natural phenotypes of naturally occurring PCSK9 (rarer forms of protein).  In this regard, the invention proposes the following aspects.  In a first aspect: an anti-human PCSK9 ligand for use in a method of treating and / or preventing a PCSK9 mediated disease or condition in a human whose genome comprises a selected nucleotide sequence including the group consisting of SEQ ID NOS: 29-37, wherein the method comprises administering the ligand to humans.  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NO: 29 to 32, 34, 35 and 37.  These are naturally occurring allelic sequences (haplotype) that do not encode 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al. , 2006).  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. , 2005).  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NO: 31, 32, 34, 35, 36 and 37; or is selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37.  These are allele sequences (haplotype) that have an existing combination of the natural state of differences from SEQ ID NO: 28 (form a) and which satisfy the criteria presented above.  In one example, the nucleotide sequence is SEQ ID NO: 29.  In one example, the nucleotide sequence is SEQ ID NO: 30.  In one example, the nucleotide sequence is SEQ ID NO: 31 In one example, the nucleotide sequence is SEQ ID NO: 32.  In one example, the nucleotide sequence is SEQ ID NO: 33.  In one example, the nucleotide sequence is SEQ ID NO: 34.  In one example, the nucleotide sequence is SEQ ID NO: 35.  In one example, the nucleotide sequence is SEQ ID NO: 36.  In one example, the nucleotide sequence is SEQ ID NO: 37.  The variant of PCSK9 is not the most common.  In one embodiment of a configuration, example, embodiment or aspect in this document, the ligand, antibody, fragment or binding site of the invention is recombinant.  In a second aspect: the ligand according to aspect 1, wherein the ligand has been or is determined to be capable of binding a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h , aj and q.  In an example of any aspect, the ligand binds (or has been determined as a binder) two, three, four or more human PCSK9s selected from the group consisting of f, c, r, p, m, e, h, aj and q.  In one example of any aspect, the ligand comprises a protein domain that specifically binds to PCSK9, e.g., human PCSK9 selected from the group consisting of Forms f, c, r, p, m, e, h, aj and q.  The term "specifically binds" or the like means that a ligand, e.g., an antibody or antigen-binding fragment thereof, forms a complex with an antigen that is relatively stable under physiological conditions. .  Specific binding may be characterized by an equilibrium dissociation constant of at least about 1 x 10-6 M or less (for example, a smaller KD indicates a tighter bond).  Methods for determining whether two molecules specifically bind are well known in the art and include, for example, equilibrium dialysis, surface plasmon resonance, and the like.  However, an isolated antibody that specifically binds human PCSK9 may crossreactivity with other antigens such as a PCSK9 molecule of another species.  In addition, multispecific (e.g., bistecific) antibodies that bind to PCSK9 and one or more additional antigens are required. Nevertheless, they are considered to be antibodies that "specifically bind" PCSK9, as used herein.  In an example of any aspect, the ligand comprises or consists of a protein that mimics the LDL receptor EGFA domain and specifically binds to PCSK9, for example, a human PCSK9 selected from the group consisting of forms f, c, r, p, m, e, h, aj and q.  In an example of any aspect, the ligand antagonizes PCSK9, e.g., human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, forms. In an example of any aspect the method comprises (prior to the administration of the ligand) the step of determining that the ligand is capable of binding a human PCSK9 selected from the group consisting of f, c, r, P m, e, h, aj, and q forms. .  In an example of any aspect, the link is determined by RPS.  In an example of any aspect, binding is determined by the ELISA technique.  In an example of any aspect, said forms are mature forms.  In an example of any aspect, said forms are pro-forms.  The terms "is determined", "is genotyped" or "is phenotype" and the like in this document mean that the method comprises a step of such a determination, such genotyping or such phenotyping.  In a third aspect: a ligand that binds a human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27 for use in a method comprising the step of using the ligand to target said PCSK9 in a human to treat and / or prevent a PCSK9 mediated condition or condition, the method comprising administering the ligand to humans.  In one example, the disease or condition is mediated by human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27.  In one example, the amino acid sequence selected from the group consisting of SEQ.  ID NO: 4 to 23, 26 and 27; or selected from the group consisting of SEQ ID NOS: 4-14 and 18-27; or chosen from the grpupe consisting of SEQ ID NO: 4 to 14, 18 to 23, 26 and 27.  These are naturally occurring sequences that do not include 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the amino acid sequence is SEQ ID NO: 18, 19 or 20, which comprises 425S, which is associated with high LDL-C (Pisciotta et al. , 2006).  In one example, the amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 11, 12, 26 and 27, which include 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. . , 2005).  In one example, the amino acid sequence selected from the group consisting of SEQ ID NOS: 10-14 and 18-27; or selected from the group consisting of SEQ ID NOS: 10 to 14, 18 to 23, 26 and 27.  These are sequences that have a naturally occurring combination of differences from SEQ ID NO: 1 to 3 (form a) and that satisfy the criteria set out above. , SEQ ID NO SEQ ID N4O amines is amino is an example,: 4.  an example, 5.  an example, 6.  an example, 7.  an example, 8.  an example, 9.  an example, 10.  In the amine is In the amino acid sequence is the sequence of the acid sequence The sequence of the amino acid sequence is the amino acid sequence is the sequence of the amino acid sequence SEQ SEQ SEQ SEQ SEQ SEQ ID NO In ID NO In ID NO In ID NO In ID NO In one example, amino acid sequence is SEQ ID NO: 11.  In one example, the amino acid sequence is SEQ ID NO: 12.  In one example, the amino acid sequence is SEQ ID NO: 13.  In one example, the amino acid sequence is SEQ ID NO: 14.  In one example, the amino acid sequence is SEQ ID NO: 15.  In one example, the amino acid sequence is SEQ ID NO: 16.  In one example, the amino acid sequence is SEQ ID NO: 17.  In one example, the amino acid sequence is SEQ ID NO: 18.  In one example, the amino acid sequence is SEQ ID NO: 19.  In one example, the amino acid sequence is SEQ ID NO: 20.  In one example, the amino acid sequence is SEQ ID NO: 21.  In one example, the amino acid sequence is SEQ ID NO: 22.  In one example, the amino acid sequence is SEQ ID NO: 23.  In one example, the amino acid sequence is SEQ ID NO: 24.  In one example, the amino acid sequence is SEQ ID NO: 25.  In one example, the amino acid sequence is SEQ ID NO: 26.  In one example, the amino acid sequence is SEQ ID NO: 27.  In a fourth aspect: the ligand according to aspect 3, wherein the genome of the human comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37.  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NO: 29 10 to 32, 34, 35 and 37.  These are naturally occurring allelic sequences (haplotype) that do not encode 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al. , 2006).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. , 2005).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; or selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37.  These are allele sequences (haplotype) which have a naturally occurring combination of differences from SEQ ID NO: 28 (form a) and which satisfy the criteria set out above.  In one example, the nucleotide sequence is SEQ ID NO: 29.  In one example, the nucleotide sequence is SEQ ID NO: 30.  In SEQ ID NO In SEQ ID NO 5 In SEQ ID NO 'In SEQ ID NO In 10 SEQ ID NO In SEQ ID NO In SEQ ID NO 15 In one example, sequence: 31.  an example, the sequence: 32.  an example, the sequence 33.  an example, the sequence: 34.  an example, the sequence 35.  an example, the sequence 36.  an example, the sequence 37.  a fifth aspect: the nucleotide ligand is nucleotide is nucleotide is nucleotide is, nucleotide is nucleotide is nucleotide is any of the foregoing, wherein the human has been or is genotyped as being positive for a nucleotide sequence selected in the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof.  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of 5,, Q ID NO: 29-32 and 34-37; or selected from the group consisting of SEQ ID NO: 29 25 to 32, 34, 35 and 37.  These are naturally occurring allelic sequences (haplotype) that do not encode 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with LDL-C (Pisciotta et al. , 2006).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. , 2005).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; or selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37.  These are allele sequences (haplotype) which comprise a naturally occurring combination of 10 differences from SEQ ID NO 28 (form a) and which satisfy the criteria presented above.  In one example, SEQ ID NO: 29.  In one example, SEQ ID NO: 30.  In one example, SEQ ID NO: 31.  In one example, SEQ ID NO: 32.  In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO In SEQ ID NO  an example, 34.  an example,: 35.  an example,: 36.  an example, 37.  a sixth aspect: nucleotide is nucleotide is nucleotide is nucleotide is nucleotide is any of the above, where the human has been or is phenotyped as being positive for a human PCSK9 selected in the group consisting of the forms f, c, r, p, m, e, h, aj and q or at least the catalytic or C-terminal domain thereof.  In one example, said forms are mature forms.  In one example, said forms are pro-forms.  In a seventh aspect: the ligand of any one of the foregoing aspects, wherein the method comprises genotyping the human being as being positive for a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof.  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NO:. 29 to 32 and 34 to 37; or selected from the group consisting of SEQ ID NO: 29 15 to 32, 34, 35 and 37.  These are naturally occurring allelic sequences (haplotype) that do not encode 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al. , 2006).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. , 2005).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; or selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37.  These are allele sequences (haplotype) which have a naturally occurring combination of differences from SEQ ID NO: 28 (form a) and which satisfy the criteria set out above.  In one example, the nucleotide sequence is SEQ ID NO: 29.  In one example, the nucleotide sequence is SEQ ID NO: 30.  In one example, the nucleotide sequence is SEQ ID NO: 31.  In one example, the nucleotide sequence is SEQ ID NO: 32.  In one example, the nucleotide sequence is SEQ ID NO: 33.  In one example, the nucleotide sequence is SEQ ID NO: 34.  In one example, the nucleotide sequence is SEQ ID NO: 35.  In one example, the nucleotide sequence is SEQ ID NO: 36.  In one example, the nucleotide sequence is SEQ ID NO: 37.  In an eighth aspect: the ligand of any of the foregoing aspects, wherein the method comprises phenotyping human being as being positive for human PCSK9 selected from the group consisting of f, c, r, p , m, e, h, aj and q or at least the catalytic or C-terminal domain thereof.  In one example, said forms are mature forms.  In one example, said forms are pro-forms.  In a ninth aspect: the ligand of any of the foregoing, wherein the human has been or is genotyped as heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof; optionally where the human being has been or is genotyped as comprising the nucleotide sequence of SEQ ID NO: 28 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof and a nucleotide sequence chosen from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof.  "Heterozygote" here means that in the genotype of the human, an allele comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain of these and the other allele may be any PCSK9 (e.g., α, α 'or an allele comprising a nucleotide sequence selected from the group consisting of SEQ ID NOs: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof).  In one example, the method comprises (prior to administration of the ligand) genotyping the human being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof; optionally also genotyping the human being as comprising the nucleotide sequence of SEQ ID NO: 28 where at least the coding sequence for the catalytic domain or the Cterminal domain thereof and a nucleotide sequence selected from the group consisting of SEQ IDs NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof.

In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NOS: 29-32, 34, 35 and 37. These are naturally occurring allelic (haplotype) sequences that do not encode 46L and satisfy the submitted criteria. above. These groups include variants that are associated with high LDL-C. In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al., 2005). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; Or selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35 and 37. These are allele sequences (haplotype) that have a naturally occurring combination of differences from SEQ ID NO : 28 (form a) and which meet the criteria set out above. In one example, the nucleotide sequence is SEQ ID NO: 29. In one example, the nucleotide sequence is SEQ ID NO: 30. In one example, the nucleotide sequence is SEQ ID NO: 31. In one example, the sequence is Nucleotide sequence is SEQ ID NO: 32. In one example, the nucleotide sequence is SEQ ID NO: 33. In one example, the nucleotide sequence is SEQ ID NO ': 34. In one example, the nucleotide sequence is SEQ ID NO: 35 In one example, the nucleotide sequence is SEQ ID NO: 36. In one example, the nucleotide sequence is SEQ ID NO: 37. In a tenth aspeA: the ligand of any one of aspects 1 to 9, where the genome of the human being has been or is genotyped as being homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 or at least the coding sequence for the catalytic domain or the C-terminal domain of those this. "Homozygote" herein means that in the genotype of the human being, each allele comprises the same nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C domain -terminal of these. In one example, the method comprises genotyping the human being as being homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or C-domain. terminal of these. In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NO: 29 25 to 32, 34, 35 and 37. These are naturally occurring allelic (haplotype) sequences that do not encode 46L and satisfy the criteria presented. above. These groups include variants that are associated with high LDL-C. In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encodes 670G which is a marker of the severity of coronary atherosclerosis (Chen et al., 2005). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; or selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35 and 37. These are allele sequences (haplotype) that have a naturally occurring combination of 10 differences from SEQ ID NO : 28 (form a) and which meet the criteria set out above. In one example, the nucleotide sequence is SEQ ID NO: 29. In one example, the nucleotide sequence is SEQ ID NO: 30. In one example, the nucleotide sequence is SEQ ID NO: 31. In one example, the nucleotide sequence is SEQ ID NO: 32 In one example, the nucleotide sequence is SEQ ID NO: 33 In one example, the nucleotide sequence is SEQ ID NO: 34 In one example, the nucleotide sequence is SEQ ID NO: 35. the nucleotide sequence is SEQ ID NO: 36. In one example, the nucleotide sequence is SEQ ID NO: 37. In an eleventh aspect: The ligand of any of the foregoing aspects, wherein the ligand comprises a binding site antibody which binds a human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27 and optionally has been or is determined to be capable of such binding. In one example, the method comprises (prior to the administration of the ligand) the step of determining that the ligand is capable of binding to said human PCSK9. In one example, the link is a specific link. In one example, the ligand binds (or has been determined to bind) to PCSK9 with an affinity (Kd) of 1 mM, 100 nM, 10 nM or 1 nM or less. In one embodiment, the affinity is not less than 10, 100 or 1000 fM. In one example, the binding or affinity is determined by RPS or ELISA. In one example, the disease or condition is mediated by a human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4 to 27. In one example, the amino acid sequence selected from the group consisting of SEQ ID NOS: 4 to 23, 26 and 27; or selected from the group consisting of SEQ ID NOS: 4-14 and 18-27; or selected from the group consisting of SEQ ID NOS: 4 to 14, 18 to 23, 26 and 27. These are naturally occurring sequences that do not include 46L and satisfy the criteria set out above. These groups include variants that are associated with high LDL-C. In one example, the amino acid sequence is SEQ ID NO: 18, 19 or 20, which comprises a 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the amino acid sequence selected from the group consisting of SEQ ID NOS: 10, 11, 12, 26 and 27, which include 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. ., 2005). In one example, the amino acid sequence selected from the group consisting of SEQ ID NOS: 10 to 14 and 18 to 27, or selected from the group consisting of SEQ ID NOS: 10 to 14, 18 to, 26 and 27. These are sequences that have a naturally occurring combination of differences from SEQ ID NO: 1 to 3 (form a) and that satisfy the criteria set out above. In one example, the amino acid sequence is SEQ ID NO: 4. In one example, the amino acid sequence is SEQ ID NO: 5. In one example, the amino acid sequence is SEQ ID NO: 6. In one example, the amino acid sequence is SEQ ID NO: 7. In one example, the amino acid sequence is SEQ ID NO: 8. In one example, the amino acid sequence is SEQ ID NO: 9. In one example, the amino acid sequence is SEQ ID NO: 10. In one example, the amino acid sequence is SEQ ID NO: 11. In one example, the amino acid sequence is SEQ ID NO: 12. In one example, the amino acid sequence is SEQ ID NO: 13. In one example, the amino acid sequence is SEQ ID NO: 14. In one example, the amino acid sequence is SEQ ID NO: 15. In. an example, the amino acid sequence is SEQ ID NO: 16. In one example, the amino acid sequence is SEQ ID NO: 17.

In SEQ ID NO In SEQ ID NO Daens SEQ ID NO In SEQ ID NO an example, 18. an example, 19. an example, 20. an example, 21. In an example, 10 SEQ ID NO: 22. In an example In an example, SEQ ID NO: 24. In one example, the sequence SEQ ID NO: 25. In one example, the sequence SEQ ID NO: 26. In one example, SEQ ID SEQ ID NO. NO: 27. In a twelfth aspect: the amino acid sequence ligand is amino acid sequence is amino acid sequence is amino acid sequence is amino acid sequence is amino acid sequence is the amino acid sequence amino acid is amino acid is amino acid is amino acid is in aspect 11, where the ligand is an antibody or an antibody fragment. For example, the antibody or antibody fragment is a PCSK9 antagonist, for example, neutralizes PCSK9. Examples of such antibodies are described, for example, in WO 2008/057457, WO 2008/057458, WO 2008/057459, WO 2008/063382, WO 2008/133647, WO 2009/100297, WO 2009/100318, WO 2011/037791, WO 2011/053759, WO 2011/053783, WO 2008/125623, WO 2011/072263, WO 2009/055783, WO 2010/029513, WO 2011/111007, WO 2010/077854, descriptions and sequences of such antibodies being incorporated herein by reference in their entirety by reference. use in the invention. A specific example is AMG 145 (Amgen), LY3015014 (Eli Lilly) or alirocumab or a PCSK9-binding derivative thereof. Advantageously, the ligand is or comprises alirocumab.

Alternatively, the ligand is or comprises evolocumab. In one example, the ligand is SAR236553 / REGN727 (Sanofi Aventis / Regeneron) or a PCSK9-binding derivative thereof. In one example, the ligand comprises or consists of a neutralizing antibody that binds to PCSK9, where the antibody binds to PCSK9 and reduces the likelihood that PCSK9 binds to LDLR. The aspect ligand 11, where the ligand is a PCSK9 antagonist, for example, neutralizes PCSK9. In one example of any aspect of the invention, the ligand comprises or consists of a ligand selected from evolocumab, 1D05-IgG2 (Merck & Co.), ALN-PCS02 (Alnylam), RN316 (Pfizer- Rinat), LY3015014 (Eli Lilly) and alirocumab, or a PCSK9-binding derivative thereof. In one example, the ligand is SAR236553 / REGN727 (Sanofi Aventis / Regeneron) or a PCSK9-binding derivative thereof. In a thirteenth aspect: the ligand of any one of aspects 1 to 1t, wherein (i) the ligand comprises a sequence of consecutive nucleotides which hybridises specifically to a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or C-terminal domain thereof, or which specifically hybridizes to an antisense sequence or an RNA transcript of said sequence, wherein said sequence of consecutive nucleotides at least one nucleotide hybrid present in said selected sequence that is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence or an RNA transcript thereof, respectively; and / or (ii) the ligand comprises a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or is an antisense sequence or an RNA version of said consecutive nucleotides, wherein said sequence of consecutive nucleotides comprises at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28. In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NO: 29 to 35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NOS: 29-32, 34, 35 and 37. These are naturally occurring allelic (haplotype) sequences that do not encode 46L and satisfy the criteria set forth herein. -above. These groups include variants that are associated with high LDL-C. In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al., 2005). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; or selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35 and 37. These are allele sequences (haplotype) that have a naturally occurring combination of differences from SEQ ID NO: 28 (form a) and which satisfy the criteria set forth above. In one example, the nucleotide sequence is SEQ ID NO: 29. For example, the nucleotide sequence is In SEQ ID NO: 30. In one example, SEQ ID NO: 31. Nucleotide sequence is In one example, the nucleotide sequence is SEQ ID NO: 32. In one example, the nucleotide sequence is SEQ ID NO: 33. In one example, the nucleotide sequence is SEQ ID NO: 34. In one example, the nucleotide sequence is SEQ ID NO: 35. an example, the nucleotide sequence is SEQ ID NO: 36. In one example, the nucleotide sequence is SEQ ID NO: 37. In one embodiment, the ligand comprises at least 10, 11, 12, 13, 14, 15 , 20, 25, 30, 35, 40, 45, 50 or 100 consecutive nucleotides of said nucleotide sequence. In a fourteenth aspect: the ligand of any of the foregoing, wherein said disease or condition is hyperlipidemia, hypercholesterolemia (e.g., familial hypercholesterolemia), heart attack, stroke, coronary artery disease, Atherosclerosis or a disease or cardiovascular condition. The ligand of any of the foregoing, wherein the disease or condition is hypercholesterolemia, hyperlipidemia, hypercholesterolemia, dyslipidemia, cholestatic liver disease, nephrotic syndrome, hypothyroidism, obesity, atherosclerosis or cardiovascular disease. In one example, said disease or condition is hypercholesterolemia. The term "hypercholesterolemia" as used herein refers to a condition in which cholesterol levels are elevated above a desired level. In some embodiments, this indicates that serum cholesterol levels are elevated. In some embodiments, the desired rate takes into account various "risk factors" that are known to those skilled in the art (and are described or referenced in US20120093818). The ligand of any of the foregoing, wherein the human is identified as being heterozygous for familial hypercholesterolemia, intolerant to the stents, uncontrolled by statins, or at risk of developing hypercholesterolemia, dyslipidemia, disease Hepatic cholestasis, nephrotic syndrome, hypothyroidism, obesity, atherosclerosis or cardiovascular disease. In a fifteenth aspect: the ligand of any of the foregoing, wherein said disease or condition is associated with elevated LDL-cholesterol. Cholesterol levels are measured in milligrams (mg) of cholesterol per deciliter (dl) of blood in the United States and some other countries. Canada and most European countries measure cholesterol in millimoles (mmol) per liter (1) of blood. Below are ideal beaches and high beaches in general. Total cholesterol Total cholesterol * (United States and some (Canada and most other countries) of European countries) Less than 200 mg / dl Less than 5.2 mmol / 1 Idea 200 to 239 mg / dl 5.6 to 6, 2 mmol / 1 upper limit 240 mg / dl and higher greater than 6.2 mmol / 1 high LDL-cholesterol LDL-cholesterol * (United States and some other countries) (Canada and most European countries) 100 to 129 mg / dl 2.6 to 3.3 mmol / 1 Ideal 130 to 159 mg / dl 3.4 to 4.1 mmol / l Upper limit 160 to 189 mg / dl 4.1 to 4.9 mmol / 1 High 190 mg / dl and higher Greater than 4.9 mmol / l High * Canadian and European guidelines are slightly different from US guidelines. These conversions are based on US guidelines. Therefore, a high LDL-cholesterol level is 160 mg / dl or higher (4.1 mmol / l or higher). In a sixteenth aspect: the ligand of any of the foregoing aspects, wherein the ligand inhibits the binding of human PCSK9 to the human LDL receptor and optionally has been or is determined to be capable of such inhibition. In one example, the method comprises (prior to administration of the ligand) the determination that the ligand is capable of such inhibition. The determination of inhibition is, for example, inhibition in a blood or serum sample, at pH 7, at 37 degrees Centigrade and / or under the physiological conditions of a human body. In a seventeenth aspect: the ligand of any of the foregoing, wherein the human is resistant or substantially resistant to treatment with stents (eg, avorstatin and / or fluvastatin) of said illness or affection. In an eighteenth aspect: the ligand of any of the foregoing, wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human ( i) whose genome comprises SEQ ID NO: 29 and where the human being is of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU; or (ii) whose genome comprises SEQ ID NO: 30 and wherein the human being is of ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FIN or CEU; or (iii) whose genome comprises SEQ ID NO: 32 and wherein the human being is of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU parentage; or (iv) whose genome comprises SEQ ID NO: 33 and where the human being is of LWK, ASW, YRI or CLM ancestry; or (v) whose genome comprises SEQ ID NO: 34 and wherein the human being is of LWK, ASW or YRI descent; or (vi) whose genome comprises SEQ ID NO: 35 and wherein the human being is of PUR, TSI, FIN or CEU ancestry; or (vii) whose genome comprises SEQ ID NO: 36 and where the human being is of LWK, ASW or YRI descent; or (viii) whose genome comprises SEQ ID NO: 37 and wherein the human being is CHS, ASW, JPT, PUR or CHB. In a nineteenth aspect: the ligand of any of the foregoing, wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human being. human (i) which expresses the form f of PCSK9 and where the human being is of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU; or (ii) which expresses the form c of PCSK9 and wherein the human being is of ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FIN or CEU; or (iii) which expresses the p-form of PCSK9 and where the human being is of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU parentage; or (iv) which expresses the form m of PCSK9 and where the human being is of LWK, ASW, YRI or CLM ancestry; or (v) which expresses the e form of PCSK9 and where the human being is of LWK, ASW or YRI descent; or (vi) who expresses the form h of PCSK9 and where the human being is of PUR, TSI, FIN or CEU ancestry; or (vii) which expresses the form a1 of PCSK9 and wherein the human is of LWK, ASW or YRI descent; or (viii) which expresses the q form of PCSK9 and where the human being is CHS, ASW, JPT, PUR or CHB. In one example, said forms are mature forms. In one example, said forms are pro-forms. In a twentieth aspect: a pharmaceutical composition or a kit for the treatment and / or prevention of a PCSK9 mediated disease or disease (e.g., as cited in aspect 14 or 15), the composition or the kit comprising a ligand of any of the foregoing and optionally a statin (e.g., cerivastatin, atorvastatin, simvastatin, pitavastatin, rosuvastatin, fluvastatin, lovastatin or pravastatin); and optionally in combination with a label or instructions for use for the treatment and / or prevention of said disease or condition in a human (for example, covering the treatment of a human being as cited in the 18 or 19); possibly where the label or instructions include a marketing authorization number (for example, an FDA or EMA authorization number); optionally where the label or instructions include directions for administering alirocumab or evolocumab to said human; optionally where the kit comprises an IV device or injection which comprises the ligand (and, for example, also a statin). In a twenty-first aspect: a method for producing an anti-human PCSK9 antibody binding site, the method comprising obtaining a plurality of anti-PCSK9 antibody binding sites, screening the sites Antibody binding for binding to human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide of these which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of an antibody binding site which binds in the screening step and optionally producing a PCSK9-binding fragment or derivative of f, c, r, p, In / e, h, aj or q form of the isolated antibody. In one example, said forms are mature forms. In one example, said forms are pro-forms. In an example according to this aspect and the following aspect, the plurality of binding sites comprises or consists of a plurality of 4-chain antibodies or fragments thereof, for example, dAb, Fab fragments or scFv. Suitable methods for producing pluralities of binding sites for screening include phage display (library production, phage display of antibody binding sites), ribosome display (production of a ribosome display library of antibody binding sites), yeast presentation (production of an antibody binding site yeast display library), or immunization of a non-human vertebrate (e.g., a rodent, e.g., a mouse or a rat, e.g., a VelocimouseTM, KymouseTM, XenomousetM, Aliva MouseTM, HuMab MouseTM, OmnimouseTM, OmrliratTM or MeMo MouseTM) with an epitope of PCSK9 and isolation of a repertoire of antibody-producing cells (e.g., a repertoire of B-lymbocytes, plasma cells or plasmablasts) and / or a repertoire of isolated antibodies. In one example, the method comprises selecting one or more antibody binding sites that each specifically bind to an epitope of human PCSK9 comprising an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3. For example, the ligand specifically binds to an epitope comprising an amino acid which is a variant compared to the corresponding amino acid of PCSK9 encoded by SEQ ID NO: 1, 2 or 3. In one example, the ligand specifically binds to an epitope comprising two or more of these variant amino acids. In one example, specific binding means binding with an affinity (Kd) of 1 mM, 100 nM, 10 nM or 1 nM or less, for example, as determined by RPS. The term "epitope" is a region of an antigen that is bound by an antibody. Epitopes can be defined as structural or functional amino. Functional epitopes are generally a subset of the structural epitopes and include those residues which directly contribute to the affinity of the interaction. Epitopes can also be conformational, i.e., non-linear amino acid compounds. In some embodiments, the epitopes may include determinants that are chemically active moieties on the surface of molecules such as amino acids, sugar side chains, phosphoryl groups, or sulfonyl groups, and in certain modes of realization, they may have specific three-dimensional structural characteristics, and / or specific load characteristics. In a twenty-second aspect: a method for producing an anti-human PCSK9 antibody, the method comprising immunizing a non-human vertebrate (e.g., a mouse or a rat) with a human PCSK9 comprising a amino acid selected from the group consisting of amino acid sequences of the forms f, c, r, p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide of these which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of an antibody that binds a human PCSK9 selected from the group consisting of f, c , r, p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3, and optionally the production of a fragment or a derivative linking PCSK9 of the f, c, r, p, m, e, h, aq or q form of the isolated antibody . In one example, said forms are mature forms. In one example, said forms are pro-forms. In a twenty-third aspect: the method according to aspect 21 or 22, comprising the step of obtaining a nucleic acid, which coding for the antibody, the fragment, the derivative or the binding site and optionally inserting the nucleic acid into an expression vector. For example, the method comprises isolating a cell (e.g., a B cell, a plasmablast, a plasma cell or a memory cell) comprising the nucleic acid, wherein the cell is obtained from a vertebrate non-human that has been immunized with the epitope of PCSK9. In a twenty-fourth aspect: a kit for genotyping PCSK9 of a human, wherein the kit comprises a nucleic acid (i) comprising a sequence of 10 or more (e.g., 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more) consecutive nucleotides which specifically hybridizes to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof, or specifically hybridizes to an antisense sequence or an RNA transcript of said sequence, wherein said sequence of consecutive nucleotides hybridizes to at least one nucleotide present in said a selected sequence that is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence or an RNA transcript thereof; and / or (ii) comprising a sequence of at least 10 or more (e.g., 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more) nucleotides of a sequence nucleotide selected from the group consisting of SEQ ID NOS: 29-37 or comprising an antisense sequence or RNA version of said consecutive nucleotides, wherein said sequence of consecutive nucleotides comprises at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28. In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29 to 15 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NOs: 29 25 to 32, 34, 35 and 37. These are naturally occurring allelic (haplotype) sequences that do not encode 46L and satisfy the criteria presented. above. These groups include variants that are associated with high LDL-C. In one example, the nucleotide sequence is SEQ ID NO: 34, which codes for 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al., 2005). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37 or selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37. This are allelic sequences (haplotype) which have a naturally occurring combination of 10 differences from SEQ ID NO: 28 (form a) and which satisfy the criteria presented above. In one example, the nucleotide sequence is SEQ ID NO: 29. In one example, the nucleotide sequence is SEQ ID NO: 30. In one example, the nucleotide sequence is SEQ ID NO: 31. In one example, the nucleotide sequence is is in SEQ ID NO: 32. In one example, the nucleotide sequence is SEQ ID NO: 33. In one example, the nucleotide sequence is SEQ ID NO: 34. In one example, the nucleotide sequence is SEQ ID NO: 35 In one example, the nucleotide sequence is SEQ ID NO: 36. In one example, the nucleotide sequence is SEQ ID NO: 37. In a twenty-fifth aspect: a kit for genotyping or phenotyping PCSK9 of a human, where the kit comprises a ligand according to any one of aspects 1 to 19 or an antibody, a fragment or a derivative produced by the method according to any of the aspects 21 to 23. In a twenty-sixth aspect : use of an anti-PCSK9 ligand that binds a human PCSK9 selected in the group 5 consisting of the forms f, c, r, p, m, e, h, aj and q in the manufacture of a medicament for the treatment and / or prevention of a disease or condition mediated by PCSK9 in a human whose genome comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37, optionally for the treatment and / or prevention of a PCSK9 mediated disease or condition in one human being as cited in aspect 18 or 19. In one example, said forms are mature forms. In one example, said forms are pro-forms. In a twenty-seventh aspect: use of an anti-PCSK9 ligand that binds human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq and q forms in the manufacture of a medicament for targeting said PCSK9 in a human to treat and / or prevent a PCSK9 mediated disease or condition, possibly for targeting PCSK9 in a human as cited in aspect 18 or 19 In one example, said forms are mature forms. In one example, said forms are pro-forms. In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NOS: 29-32, 34, 35 and 37. These are naturally occurring allelic sequences (haplotype) that do not encode 46L and satisfy the submitted criteria. above. These groups include variants that are associated with high LDL-C. In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al., 2006). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al., 2005). In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; Or selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35 and 37. These are allele sequences (haplotype) that have a naturally occurring combination of differences from SEQ ID NO : 28 (form a) and who to the criteria presented above. In a SEQ ID NO: 29. In a SEQ ID NO: 30. In a SEQ ID NO: 31. In a SEQ ID NO: 32. In a SEQ ID NO: 33. In a SEQ ID NO: 34. In a SEQ ID NO: 35. In a SEQ ID NO: 36. In a SEQ ID NO: 37. example, example, example, example, example, example, example, example, example, sequence sequence la sequence the sequence the sequence the sequence the sequence the nucleotide sequence is nucleotide is nucleotide is is nucleotide is nucleotide is is nucleotide is nucleotide is is nucleotide is nucleotide is The ligand may be any ligand anti-PCSK9 described herein. In a twenty-eighth aspect: the use according to aspect 26 or 27, wherein the ligand, the human being, the disease or the affection is according to any one of the aspects 1 to 19. In a twenty-eighth aspect: ninth aspect: a method of targeting a PCSK9 for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human, the method comprising administering an anti-human ligand; PCSK9 to a human comprising a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29 to 37, whereby the PCSK9 encoded by said nucleotide sequence is targeted. The ligand may be any anti-PCSK9 ligand described herein. In a thirtieth aspect: the method according to aspect 29, wherein the method comprises targeting a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj 'and q with said ligand for treating and / or preventing said disease or condition in said human being. In one example, said forms are mature forms. In one example, the aforesaid forms are the pro-forms. In a thirty-first aspect: a method of treating and / or preventing a PCSK9 mediated disease or condition in a human, the method comprising targeting a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq and q forms by administering to humans a ligand which binds said PCSK9, thereby treating and / or preventing said disease or condition in the human being. In one example, said forms are mature forms. In one example, said forms are pro-forms.

The ligand may be any anti-PCSK9 ligand described herein.  In a thirty-second aspect: the method according to aspect 31, wherein the genome of the human comprises a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37.  In one example, the nucleotide sequence is selected from the group consisting of SEQ ID NOS: 29-35 and 37; or selected from the group consisting of SEQ ID NOS: 29-32 and 34-37; or selected from the group consisting of SEQ ID NO: 29 to 32, 34, 35 and 37.  These are naturally occurring allelic sequences (haplotype) that do not encode 46L and meet the criteria outlined above.  These groups include variants that are associated with high LDL-C.  In one example, the nucleotide sequence is SEQ ID NO: 34, which encodes a 425S, which is associated with high LDL-C (Pisciotta et al. , 2006).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31 and 37, which encode 670G which is a marker of the severity of coronary atherosclerosis (Chen et al. , 2005).  In one example, the nucleotide sequence selected from the group consisting of SEQ ID NOS: 31, 32, 34, 35, 36 and 37; Or selected from the group consisting of SEQ ID NO: 31, 32, 34, 35 and 37.  These are allele sequences (haplotype) which have a naturally occurring combination of differences from SEQ ID NO: 28 (form a) and which satisfy the criteria set out above.  In one example, the nucleotide sequence is SEQ ID NO: 29.  In one example, the nucleotide sequence is SEQ ID NO: 30.  In one example, the nucleotide sequence is SEQ ID NO: 31.  In one example, the nucleotide sequence is SEQ ID NO: 32.  In one example, the nucleotide sequence is SEQ ID NO: 33.  In one example, the nucleotide sequence is SEQ ID NO: 34.  In one example, the nucleotide sequence is SEQ ID NO: 35.  In one example, the nucleotide sequence is SEQ ID NO: 36.  In one example, the nucleotide sequence is SEQ ID NO: 37.  In a thirty-third aspect: the method of any one of aspects 29 to 32, wherein the human has been or is genotyped to be positive for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to Or the coding sequence for the catalytic or C-terminal domain thereof.  In a thirty-fourth aspect: the method according to any of AspAts 29 to 33, wherein the human being has been or is phenotyped to be positive for a human PCSK9 selected from the fc, r, p, m, e, h, aj and q.  In one example, said forms are mature forms.  In one example, said forms are pro-forms.  In a thirty-fifth aspect: the method of any one of aspects 29 to 34, wherein the method comprises genotyping the human being as being positive for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 or the coding sequence for the catalytic or C-terminal domain thereof.  In a thirty-sixth aspect: the method of any one of aspects 29 to 35, wherein the method comprises phenotyping the human being as being positive for a sequence of human PCSK9 selected from the group consisting of f forms, c, r, p, m, e, h, aj and q.  In one example, said forms are mature forms.  In one example, said forms are pro-forms.  In a thirty-seventh aspect: the method of any one of aspects 29 to 36, wherein.  the human has been or is genotyped as being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 or the coding sequence for the catalytic or C-terminal domain thereof; optionally where the human being has been or is genotyped as comprising the nucleotide sequence of SEQ ID NO: 28 or the coding sequence for the catalytic or C-terminal domain thereof and a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 or the coding sequence for the catalytic or C-terminal domain thereof.  In a thirty-eighth aspect: the method of any one of aspects 29 to 37, wherein the genome of the human being has been or is genotyped to be homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NOs : 29-37 or the coding sequence * for the catalytic or C-terminal domain thereof.  In a thirty-ninth aspect: the method according to any one of aspects 29 to 38, wherein the method comprises genotyping the human for a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 of the coding sequence for the catalytic or C-terminal domain thereof prior to administration of the ligand to the human, wherein the ligand is determined to be capable of binding to a PCSK9 encoded by said selected sequence.  In a fortieth aspect: the method according to any one of the aspects 29 to 39, wherein the ligand, the human being, the disease or the condition is according to any one of the aspects 1 to 19.  In a forty-first aspect: a method according to any one of aspects 29 to 40 for the treatment and / or prevention of a condition or disease as cited in aspect 14 or 15, the method comprising administering said ligand and a statin (e.g., cerivastatin, atorvastatin, simvastatin, pitavastatin, rosuvastatin, fluvastatin, lovastatin or pravastatin) to humans.  In a forty-second aspect: the method according to aspect 41, wherein the ligand and the statin are administered separately.  In a forty-third aspect: the method according to aspect 41, wherein the ligand and the statin are administered simultaneously.  In a forty-fourth aspect: the method of any one of aspects 29 to 43, wherein the ligand is administered by subcutaneous injection.  In a forty-fifth aspect: a method of genotyping PCSK9 of a nucleic acid sample of a human, the method comprising identifying in the sample the presence of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the coding sequence for the catalytic or C-terminal domain thereof.  In a forty-sixth aspect: a method of typing PCSK9 of a human protein sample, the method comprising identifying in the sample the presence of a human PCSK9 selected from the group consisting of forms f, c, r, p, m, e, h, aj and q.  In one example, said forms are mature forms.  In one example, said forms are pro-forms.  In one example, the method comprises obtaining a PCSK9 protein sample from the human and then performing the identification step.  In a forty-seventh aspect: the method according to aspect 45 or 46, comprising obtaining a sample of serum, blood, stool, hair, tissue, cells, urine or saliva. from a human, whereby the nucleic acid or protein sample is obtained and used in the step of identifying said sequence.  In a forty-eighth aspect: the method according to any one of the aspects 45 to 47, comprising using a ligand according to any one of aspects 1 to 19 to perform said identifying step.  In a forty-ninth aspect: a method of treatment and / or prevention in a human patient of a cardiovascular disease or condition, or a disease or condition that is associated with elevated LDL-cholesterol (E.g., hypercholesterolemia), wherein the patient receives or has previously received statin treatment for said disease or condition, the method comprising typing the patient using a method of any one of aspects 45 to 48 and administering a ligand according to any one of aspects 1 to 19, whereby the human being is treated or said disease or condition is prevented; possibly reducing or stopping treatment with a statin.  In one example, said reduction or discontinuation includes reducing the dose and / or frequency of administration of the doses of the statin.  In a fiftieth aspect: a diagnostic, therapeutic or prophylactic kit comprising a ligand that is capable of binding or has been or is determined to be capable of binding to an amino acid sequence selected from SEQ ID NO: 4 to 27 and instructions for carrying out the method according to any one of the aspects 46 to 49 and / or a label or instructions indicating or covering the administration of the ligand to a human as defined in any one aspect 1. at 19.  In a fifty-first aspect: a diagnostic, therapeutic or prophylactic kit comprising a nucleic acid probe comprising a nucleotide sequence which specifically hybridizes to a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or an antisense or RNA transcript sequence thereof and instructions for performing the method according to aspect 45, 47 or 48.  In embodiments of any of the aspects described herein, optionally, PCSK9 is a human PCSK9, eg, mature, cleaved, autocatalysed or active PCSK9.  In one example, the disease is a cardiovascular disease such as hyperlipidemia.  In examples of the present invention, the ligand specifically binds to human PCSK9, for example, one or more of the rare variants of PCSK9 described herein (e.g., one, two, three, more, or all of them). mature forms f, c, r, p, m, e, h, aj and q) and optionally also the form a and / or a '.  For example, the ligand specifically binds to mature form f and / or c as well as to form a.  The determination of such binding may be accomplished by any antibody binding assay as known in the art, for example, by surface plasmon resonance.  The binding to each of these forms takes place, for example, respectively with a Kd of at least 1 mM, 100 nM, 1 nM, 100 μM, 10 μM or 1 μM.  In one example, the ligand binds the α-form and a PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq, and q, wherein the binding of the ligand to said chosen form takes place with a Kd (determined by RPS) which is at least 60, Y 70, 80, 90 or 95% of Kd for binding to the form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the form a and the form f, where ligand binding to the form f takes place with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95 % of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds form a and form c, where ligand binding to form c takes place with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95 % of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the form a and the form where ligand binding to the r-form takes place with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95% of the Kd for the connection A to the form a.  In one embodiment, the two forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the form a and the form where ligand binding to the p-form occurs with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95% of the Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds form a and form m, where ligand binding to form m takes place with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95% of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the form a and the form e, where ligand binding to the e form takes place with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95% Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the form a and the form h, where the binding of the ligand to the form h proceeds with a Kd (determined by RPS) which is at least 60, 70, 80, 90 or 95 % of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the α-form and the α-α-form, wherein the binding of the ligand to the α-form occurs with a Kd (determined by RPS) of at least 60, 70, 80, 90 or 95 % of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In one example, the ligand binds the α-form and the q-form, wherein the q-form ligand binds with a Kd (determined by RPS) of at least 60, 70, 80, 90, or 95. % of Kd for binding to form a.  In one embodiment, both forms are mature forms.  In one embodiment, both forms are pro-forms.  In examples of the present invention, the ligand neutralizes human PCSK9, e.g., one or more of the rare variants of PCSK9 described herein (e.g., one, two, three, more or all of the mature forms f, c, r, p, m, e, h, aj and q) and possibly also the form a and / or a '.  For example, the ligand neutralizes the mature form f and / or c as well as the form a.  The determination of neutralization can be carried out, for example, by any neutralization test method described in US20120093818A1 (Amgen, Inc.) or US20110065902A1 (Regeneron Pharmaceuticals, Inc.).  The ligands of the invention that bind or target PCSK9 are useful, for example, for therapeutic and prophylactic applications described in US20120093818A1 and US20110065902A1, these specific disclosures being incorporated herein by reference in their entirety for use in the present invention and for possible inclusion in the claims herein.  In embodiments where the ligand is used for therapeutic applications, an antigen-binding protein may inhibit, interfere with, or modulate one or more biological activities of a PCSK9 (e.g., one or more of the rare variants described therein). document and possibly also the form a and / or a ').  In one embodiment, the ligand specifically binds to human PCSK9 (e.g., one or more of the rare variants described in this, kdocument and optionally also form a and / or a ') and / or substantially inhibits binding. human PCSK9 (for example, said one or more of the rare variants described herein and possibly also the form a and / or a ') to the LDLR of at least 20%, for example, 20% to 40%, 60%, 60-80%, 80-85%, or higher (e.g., by measuring binding in a competitive in vitro binding assay).  In one example, the ligand is an antibody.  In one embodiment, the ligand has a lower Kd (tighter binding) at 10-7, 10-8 10-9, 10-10, 10-11, 10-12, 10-13 M for binding to one, two or more of the rare variants described herein and possibly also to the form a and / or a '.  In one example, the Kd is determined using the RPS.  In one embodiment, the ligand has an IC50 for blocking the binding of LDLR to one or more rare variants of PCSK9 described herein (and possibly also to form a and / or a ') less than 1 microM, 1000 nM to 100 nM, 100 nM to 10 nM, 10 nM to 1 nM, 1000 μM to 500 μM, 500 μM to 200 μM, less than 200 μM, 200 μM to 150 μM, 200 μM to 100 μM, 100 μM at 10 μM, 10 μM at 1 μM.  In one embodiment, the ligand has an IC50 for blocking the binding of LDLR to form a and / or PCSK9 of not more than 1000, 100, 90, 80, 70, 60, 50, 40, 30, 20 or 10-fold (i.e., more inhibitory) at IC 50 for blocking LDLR binding to one or more of the rare variants of PCSK9 described therein. document (for example, one or more PCSK9 proteins comprising a sequence selected from SEQ ID NO: 4 to 27).  In addition or alternatively, for example, the ligand has an IC50 for blocking LDLR binding to (i) α and / or less than 1 microM, 1000 nM to 100 nM, 100 μM to 10 nM 10 nM to 1 nM, 1000 μM at 500 μM, 500 μM at 200 μM, less than 200 μM, 200 μM at 150 μM, 200 μM at 100 μM, 100 μM at 10 μM, 10 μM at 1 μM, for example, in the range of 1 mM to 1 μM (for example, 1 mM to 100 μM, 10 nM to 100 μM, 1 nM to 10 μM, or 100 μM to 1 μM) and (ii) one or more PCSK9 proteins. comprising a sequence selected from SEQ ID Nos. 4 to 27 of less than 1 microM, 1000 nM to 100 nM, 100 nM to 10 nM, 10 nM to 1 nM, 1000 μM to 500 μM, 500 μM to 200 μM, less than 200 μM, 200 μM at 150 μM, 200 μM 100 μM, 100 μM at 10 μM, 10 μM at 1 μM, for example, in the range of 1 mM to 1 μM (for example, 1 mM to 100 μM, 10 nM at 100 μM, 1 nM at 10 μM, or 100 μM at 1 μM) In one embodiment, the ligand binds to the form a and / or to PCSK9 with an affinity of bond (Kd) which is higher up to 10%, higher up to 20%, higher up to 40%, higher up to 50%, higher up to 55%, higher up to 60%, higher up to 65%, higher up to 70%, higher up to 75%, up to 80% higher, up to 85% higher, up to 90% higher, up to 95% higher or higher 100% (i.e., double) with respect to a PCSK9 binding comprising a sequence selected from SEQ ID NOS: 4-27.  Such binding measurements can be made using various binding assays known in the art, for example, using surface plasmon resonance (RPS), such as by BiacoreTN or using ProteOn XPR36TM (Bio-Rad®). ), or using KinExA® (Sapidyne Instruments, Inc.).  In one embodiment, surface plasmon resonance (RPS) is performed at 25 ° C.  In another embodiment, laleRPS is performed at 37 ° C.  In one embodiment, the SPR is performed at physiological pH, such as about pH 7 or pH 7.6 (for example, using Hepes buffered saline at pH 7.6 (also referred to as HBS-EP). )).  In one embodiment, the RPS is performed at a physiological salt concentration, for example, 150 mM NaCl.  In one embodiment, the SPR is performed at a detergent concentration of not more than 0.05% by volume, for example, in the presence of P2 (polysorbate 20, eg, Tween-20Tm) at 0. , 05% and EDTA at 3 mM.  In one example, the SPR is performed at 25 ° C or 37 ° C in pH 7, 6, 150 mM NaCl, 0.05% detergent (e.g., P20) and 3 mM EDTA.  The buffer can contain 10 mM of. Hepes.  In one example, the SPR is performed at 25 ° C or 37 ° C in HBS-EP.  HBS-EP is available from Teknova Inc. (California, catalog number H8022).  In one example, the affinity of the ligand which is an antibody is determined using the RPS in 1.  Coupled anti-mouse IgG (or other relevant vertebrate) (e.g., Biacore BR-1008-38) to a biosensor chip (e.g., a GLM chip) as per primary amine coupling; 2.  Exposing the anti-mouse IgG (a vertebrate antibody) to a test IgG antibody to capture the test antibody on the chip; 3.  Passing the test antigen on the capture surface of the chip at 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM with O nM (i.e., buffer alone); and 4.  Determining the binding affinity of the test antibody to the test antigen using surface plasmon resonance, for example, under RPS conditions discussed above (e.g., at 25 ° C in physiological buffer).  SPR can be performed using any conventional RPS device, such as BiagoreTM or using ProteOn XPR301 (Bio-Rad0).  Regeneration of the capture surface can be performed with 10 mM glycine at pH 1.7.  This eliminates the captured antibody and allows the surface to be used for another interaction.  The binding data can be adjusted to a 1/1 intrinsic model using standard techniques, for example using an intrinsic model of ProteOn XPR36 analysis software. In one embodiment, the assay of the analysis of a ligand of the invention is performed at or substantially at pH. 7 (eg, for in vitro assays and assays) and at or near t. at.  An example of a constant IgG2 heavy chain domain of an anti-PCSK9 antibody of the present invention is the amino acid sequence as shown in SEQ ID NO: 154, FIG. 3KK of US20120093818A1, which sequence is incorporated herein by reference.  An example of an IgG4 heavy chain constant domain of an anti-PCSK9 antibody of the present invention has the amino acid sequence as shown in SEQ ID NO: 155, FIG. 3KK of US20120093818A1, which sequence and which description are incorporated herein by reference in their entirety.  An example of a kappa light chain constant domain of an anti-PCSK9 antibody has the amino acid sequence as shown in SEQ ID NO: 157, FIG. 3KK of US20120093818A1, which sequence and which description are incorporated herein by reference. this document with reference in their entirety.  An example of a lambda light chain constant domain of an anti-PCSK9 antibody has the amino acid sequence as shown in SEQ ID NO: 156, FIG. 3KK of US20120093818A1, which sequence and which description are incorporated herein by reference. this document with reference in their entirety.  In examples of the present invention, the ligand binds mature PCSK9, e.g., a mature form of one or more of the rare variants described herein, and optionally also the form a and / or a '.  In examples of the present invention, the ligand binds the catalytic domain of PCSK9, for example, a mature form of one or more of the rare variants described herein and optionally also of the form a and / or at'.  In examples of the present invention, the ligand binds the PCSK9 prodomain, for example, to a mature form of one or more of the rare variants described herein and optionally also of the form a and / or a '.  In some embodiments, the ligand binds to the V domain of PCSK9, for example, a mature form of one or more of the rare variants described herein and optionally also of the form a and / or .  In some embodiments, the ligand binds to the V domain of PCSK9 (eg, from a mature form of one or more of the rare variants described herein and optionally also of the form a and / or ') and prevents (or reduces, for example, at least 10%) the binding of PCSK9 to LDLR.  In some embodiments, the ligand binds to the V domain of PCSK9 (e.g., a mature form of one or more of the rare variants described herein and optionally also of the form a and / or '), and while it does not prevent (or reduce) the binding of the.  PCSK9 at LDLR, the ligand prevents or reduces (for example, by at least 10%) the undesirable activities mediated via PCSK9 on LDLR.  In examples of the present invention, the ligand is or comprises a fully human antibody.  In one example, the ligand comprises human variable regions or humanized variable regions.  In one example, the ligand of the invention specifically binds to an epitope of a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, a, and g, where epitope comprises at least one amino acid that is not found in the form a.  For example, the amino acid is selected from the group consisting of 46L, 53V, 425S, 443T, 474V, 619P and 670G (numbering as used in SEQ ID NO: 1).  For example, the amino acid is selected from the group consisting of 425S, 443T, 1474V, 619P and 670G (numbering as used in SEQ ID NO: 1).  For example, the amino acid is selected from the group consisting of 425S and 443T (numbering as used in SEQ ID NO: 1).  For example, the amino acid is selected from the group consisting of 474V, 619P and 670G (numbering as used in SEQ ID NO: 1).  In one example, the form of PCSK9 is the mature form.  In one example, the form of PCSK9 is the pro form.  In one example, the ligand also specifically binds to the form a and / or a '.  In one embodiment, the ligand specifically binds to a f-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a c-type PCSK9 epitope, where the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a r-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a p-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a m-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to an e-form epitope of PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a h-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to an β-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to a q-form PCSK9 epitope, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj, and q forms.  In one example, the ligand also binds specifically to the pro-domain of the form a and / or a '.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form f, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form c, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form r, wherein the epitope comprises at least one amino acid that is not found in the form.  In one embodiment, the ligand specifically binds to the pro-domain of p-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form m, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form e, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of h-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of PCSK9 of form α1, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the pro-domain of q-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj, and q forms.  In one example, the ligand also specifically binds to the catalytic domain of the form a and / or a '.  In one embodiment, the ligand specifically binds to the catalytic domain of PCSK9 of form f, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of PCSK9 of form c, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of PCSK9 of the r-form, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of p-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of m-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of PCSK9 of form e, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of h-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of PCSK9 of form α1, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the catalytic domain of q-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq, and q forms.  In one example, the ligand also specifically binds to the C-terminal domain of the form a and / or a '.  In one embodiment, the ligand specifically binds to the C-terminal domain of PCSK9 of f-form, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of PCSK9 of form c, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of the r-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of p-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of m-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of PCSK9 of form e, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of h-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of PCSK9 of form α1, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the C-terminal domain of q-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the substrate-binding groove of a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj and q (see Cunningham et al. , Nat Struct Mol Biol.  2007 May; 14 (5): 413-9.  Epub 2007 Apr 15, "Structural and Biophysical Studies of PCSK9 and Its Mutants Linked to Familial Hypercholesterolemia", incorporated herein by reference in its entirety.  In one example, the ligand also binds specifically to the substrate binding groove of the form a and / or a '.  In one embodiment, the ligand specifically binds to the f-type PCSK9 substrate binding groove, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the substrate binding groove of g-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the substrate binding groove of the r-form PCSK9, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the p-form PCSK9 substrate binding groove, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the m-form PCSK9 substrate binding groove, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the PCSK9 substrate binding groove of e-form, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the h-shaped PCSK9 substrate binding groove, wherein the epitope comprises at least one amino acid that is not found in the a-form.  In one embodiment, the ligand specifically binds to the substrate binding groove of PCSK9 of form α1, wherein the epitope comprises at least one amino acid that is not found in the α-form.  In one embodiment, the ligand specifically binds to the q-form PCSK9 substrate binding groove, wherein the epitope comprises at least one amino acid that is not found in the α-form.  Reference is made to US20120093818A1 (Amgen, Inc.), the entire disclosure of which is incorporated herein by reference.  This patent application discloses ligands relevant for use in the present invention, as well as examples and methods of producing and analyzing ligands that can be used with reference to the present invention.  In one example, the ligand is or comprises an antibody described in Table 2 of DS20120093818A1 (Arrigen, Inc.) or is a PCSK9-binding derivative thereof.  In one embodiment, the PCSK9 binding ligand of the invention is selected from the antigen-binding proteins described in US20120093818A1 (Amgen, Inc.), for example, in paragraphs [0009] to [0014] and [0014]. 0058] [0063] of US20120093818A1; all of these descriptions (including sequences of these proteins) are incorporated herein by reference as if they were explicitly mentioned herein and for possible inclusion in one or more claims or for use in the present invention.  In this paragraph, SEQ ID NOs are those which appear in US20120093818A1 (Amgen, Inc.) and these sequences are incorporated herein by reference as if they were explicitly mentioned in this document and for possible inclusion in one or more claims or for use in the present invention.  In some aspects, the ligand of the invention comprises an isolated antigen-binding protein that binds PCSK9 comprising: A) one or more heavy chain complementarity determining regions (CDRH) selected from the group consisting of: (i) a CDRH1 from a CDRH1 in a sequence selected from the group consisting of SEQ ID NOS: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57 , 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60; (ii) CDRH2 from a CDRH2 in a sequence selected from the group consisting of SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60; (iii) CDRH3 from a CDRH3 in a sequence selected from the group consisting of SEQ ID NOs: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55 , 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60; and (iv) a CDRH of (i), (ii), and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 4 amino acids; B) one or more light chain complementarity determining (CDRL) regions selected from the group consisting of: (i) a CDRL1 from a CDRL1. in a sequence selected from the group consisting of SEQ ID NOS: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30 , 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46; (ii) a CDRL2 from a CDRL2 in a sequence selected from the group consisting of SEQ ID NOS: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46; (iii) a CDRL3 from a CDRL3 in a sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46; and (iv) a CDRL of (i), (ii) and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 4 amino acids; or C) one or more heavy chain CDRHs of A) and one or more light chain CDRLs of B).  In some embodiments, the isolated antigen-binding protein comprises at least one CDRH of A) and at least one CDRL of B).  In some embodiments, the isolated antigen-binding protein comprises at least two CDRHs of A) and at least two CDRLs of B).  In some embodiments, the isolated antigen-binding protein comprises said CDRH1, CDRH2, CDRH3, CDRL1, CDRL2 and CDRL3.  In some embodiments, the CDRH of A) is selected from at least one of the group consisting of: (1) an amino acid sequence of CDRH1 selected from CDRH1 in a sequence selected from the group consisting of SEQ ID NO: 67, 79, 89, and 49; (ii) an amino acid sequence of CDRH2 selected from CDRH2 in a sequence selected from the group consisting of SEQ ID NOS: 67, 79, 89, and 49; (iii) an amino acid sequence of CDRH3 selected from CDRH3 in a sequence selected from the group consisting of SEQ ID NOS: 67, 79, 89, and 49; and (iv) a CDRH of (i), (ii) and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 2 amino acids.  Further, the CDRL of B) is selected from at least one of the group consisting of: (i) an amino acid sequence of CDRL1 selected from CDRL1 in a sequence selected from the group consisting of SEQ ID NO: 12, 35, 32, and 23; (ii) an amino acid sequence of CDRL2 selected from CDRL2 in a sequence selected from the group consisting of SEQ ID NO: 12, 35, 32, and 23; (iii) an amino acid sequence of CDRL3 selected from CDRL3 in a sequence selected from the group consisting of SEQ ID NO: 12, 35, 32, and 23; and (iv) a CDRL of (i), (ii) and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 2 amino acids; or C) one or more heavy chain CDRH of A) and one or more CDRL of B light chain.  In some embodiments, the CDRH of A) is selected from at least one of the group consisting of: (i) an amino acid sequence of CDRH1 of the amino acid sequence of CDRH1 in SEQ ID NO: 67; (ii) an amino acid sequence of CDRH2 of the amino acid sequence of CDRH2 in SEQ ID NO: 67; (iii) an amino acid sequence of CDRH3 of the amino acid sequence of CDRH3 in SEQ ID NO: 67; and (iv) a CDRH of (i), (ii) and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 2 amino acids; said CDRL of B) is selected from at least one of the group consisting of: (i) a CDRL1 amino acid sequence of the amino acid sequence of CDRL1 in SEQ ID NO: 12; (ii) an amino acid sequence of CDRL2 of the amino acid sequence of CDRL2 in SEQ ID NO: 12; (iii) an amino acid sequence of CDRL3 of the amino acid sequence of CDRL3 in SEQ ID NO: 12; and (iv) a CDRL of (i), (ii) and (iii) which contains one or more amino acid substitutions, deletions or insertions of not more than 2 amino acids; or C) one or more heavy chain CDRHs of A) and one or more light chain CDRLs 3014695 of B).  In some embodiments, the antigen-binding protein comprises A) a CDRH1 of the CDRH1 sequence in SEQ ID NO: 67, a CDRH2 of the CDRH2 sequence in SEQ ID NO: 67, and a CDRH3 of the CDRH3 sequence in SEQ ID NO: 67; and B) a CDRL1 of the CDRL1 sequence in SEQ ID NO: 12, a CDRL2 of the CDRL2 sequence in SEQ ID NO: 12, and a CDRL3 of the CDRL3 sequence in SEQ ID NO: 12.  In some embodiments, the antigen-binding protein comprises a heavy chain variable region (VH) having at least 80% sequence identity with an amino acid sequence selected from the group consisting of SEQ ID NO: 74 , 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77 , 78, 83, 69, 81, and 60, and / or a light chain variable (VL) region having at least 80% sequence identity with an amino acid sequence selected from the group consisting of SEQ IDs NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46.  In some embodiments, the VH has at least 90% sequence identity with an amino acid sequence selected from the group consisting of SEQ ID NOS: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60, and wherein the VL has at least 90% sequence identity with an amino acid sequence selected from the group consisting of SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17 , 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, and 46.  In some embodiments, the VH is selected from the group consisting of SEQ ID NO: 74, 85, 71, 72, 67, 87, 58, 52, 51, 53, 48, 54, 55, 56, 49, 57, 50, 91, 64, 62, 89, 65, 79, 80, 76, 77, 78, 83, 69, 81, and 60, and / or the VL is selected from the group consisting of SEQ ID NO: 5 , 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38 , 39, 40, 42, 44, and 46.  In one example of any aspect of the invention, the targeting or binding ligand of PCSK9 comprises or consists of AMG145 or 31H4, 16F12, 11F1, 8A3 or 21B12 disclosed in US20120093818A1 (Amgen, Inc) or an antibody comprising the variable domains of AMG145, 31H4, 16F12, 11F1, 8A3 or 21B12, whose descriptions (including sequences) are incorporated herein by reference as if they were explicitly mentioned in this document and for possible inclusion in one or more claims or for use in the present invention.  Preferably, the targeting or binding ligand of PCSK9 comprises or consists of AMG145.  In one example, AMG145 or another ligand of the invention is glycosylated, for example, exhibits human glycosylation (eg, produced by a CHO, Cos or Hek293 cell).  In one example, the ligand of the invention is produced in CHO cells.  Reference is made to US20110065902A1 (Regeneron Pharmaceuticals, Inc.), the entire disclosure of which is incorporated herein by reference.  This patent application discloses ligands relevant for use in the present invention, as well as examples and methods for producing and analyzing ligands and determining medical efficacy that can be used with reference to the present invention. .  Reference is made to the following PCT applications, the entire descriptions of which are incorporated in this referenced document.  These describe ligands relevant for use in the present invention, as well as examples and methods of producing and analyzing ligands and determining medical efficacy that can be used with reference to the present invention.  WO 2008057457 WO 2008057458 WO 2008057459 WO 2009103909 WO 200910390 WO 200910399 WO 2011053759 WO 2011053759 WO 2011053783 WO 2011053783 WO 2011053783 WO 2011073863 WO 2010017590 WO 2010011080 WO 2010077854 Antibody ligands directed against PCSK9 are described, for example, in WO 2008/057457, WO 2008/057458, WO 2008/057459, WO 2008/063382, WO 2008/125623, and US 2008/0008697.  In one example, the ligand is or comprises an antibody described in the examples of US20110065-02A1 (e.g., 316P or 300N) or is a PCSK9-binding derivative thereof.  All of these disclosures (including the sequences of these proteins and the corresponding nucleotide sequences) are incorporated herein by reference as if they are explicitly mentioned herein and for possible inclusion in one or more claims or for use in the art. present invention.  In one embodiment, the ligand is or comprises the variable domains of the 316P or 300N antibody, described in US20110065902A1 or is (or includes) such an antibody or a PCSK9-binding derivative thereof.  The above reference is incorporated by reference in this document in its entirety.  In one embodiment, the ligand is or comprises the variable domains of the alirocumab or SAR236553 / REGN727 antibody (Sanofi Aventis / Regeneron) or is (or comprises) such an antibody or a PCSK9-binding derivative thereof.  In one example, the antibody is glycosylated, for example, exhibits human glycosylation (e.g., produced by a CHO, Cos or Hek293 cell).  Preferably, the ligand is alirocumab or SAR236553 / REGN727.  In one embodiment, the ligand is or comprises the variable domains of the evolocumab antibody or is (or comprises) such an antibody or a PCSK9-binding derivative thereof.  In one example, the antibody is glycosylated, for example, exhibits human glycosylation (eg, produced by a CHO, Cos or Hek293 cell).  Preferably, the ligand is evolocumab.  In one embodiment, the ligand is selected from evolocumab, 1D05-IgG2 (Merck & Co. ), ALN-PCS02 (Alnylam), RN316 (Pfizer-Rinat) and alirocumab.  In one embodiment, the ligand is selected from the following (sequences and definitions according to US2011 / 065652, incorporated herein by reference in its entirety):  An antibody or an antigen-binding fragment thereof that specifically binds hPCSK9, wherein the antibody or antigen-binding fragment comprises the heavy and light chain CDRs of a pair of antigen-binding sequences. amino acids of HCVR / LCVR having SEQ ID NO: 218/226.  2.  The antibody or binding fragment of a concept 1 antigen comprising CDR amino acid sequences of heavy and light chains having SEQ ID NO: 220, 222, 224, 228, 230 and 232.  3.  The antibody or binding fragment of a concept 2 antigen comprising HCVR having the amino acid sequence of SEQ ID NO: 218 and an LCVR having the amino acid sequence of SEQ ID NO: 226.  4.  An antibody or an antigen-binding fragment thereof that binds to the same epitope on hPCSK9 as an antibody comprising the amino acid sequences of heavy and light chain CDRs having SEQ ID NO: 220 , 222, 224, 228, 230 and 232.  5.  An antibody or antigen binding fragment thereof that competes for binding to hPCSK9 with an antibody comprising the amino acid sequences of heavy and light chain CDRs having SEQ ID NO: 220 , 222, 224, 228, 230 and 232.  In one embodiment, the ligand is selected from the following (sequences and definitions according to US2012 / 0093818, incorporated herein by reference in its entirety).  An isolated neutralizing antigen binding protein which binds to a PCSK9 protein comprising the amino acid sequence of SEQ ID NO: 1, wherein the neutralizing antigen binding protein decreases the lowering effpt of the LDLR of PCSK9 on LDLR, wherein the antigen binding protein comprises a light chain comprising an amino acid sequence of SEQ ID NO: 46, and wherein the antigen binding protein comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 60.  30 2.  The neutralizing antigen binding protein isolated according to concept 2, wherein the antigen-binding protein is a binding protein of a noncompetitive neutralizing antigen of LDLR.  3014695 3.  The neutralizing antigen binding protein isolated according to concept 2, wherein the antigen-binding protein is a binding protein of a noncompetitive neutralizing antigen of LDLR.  5 4.  An antigen-binding protein that selectively binds to PCSK9, wherein said antigen-binding protein binds to PCSK9 with a Kd that is less than 100 μM.  5.  An antigen binding protein that binds to a PCSK9 protein of SEQ ID NO: 303 in a first manner, wherein the antigen binding protein binds to a variant of PCSK9 in a second way. wherein said variant of PCSK9 comprises at least one point mutation at a position selected from the group consisting of: 207, 208, 185, 181, 439, 513, 538, 539, 132, 351, 390, 413 , 582, 162, 164, 167, 123, 129, 311, 313, 337, 519, 521, and 554 of SEQ ID NO: 303, wherein the first way comprises a first EC50, a first Bmax, or a first EC50, and a first Bmax, where the second way comprises a second EC50, a second Bmax, or a second EC50 and a second Bmax, and where a value for the first way is different from a value for the second way, and where the protein antigen binding comprises a light chain comprising an amino acid sequence of SEQ ID NO: 46, and wherein the protein of An antigen comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 60.  6.  The antigen-binding protein according to concept 6, wherein the first way comprises a first Bmax, wherein the second way comprises a second Bmax which is different from the first Bmax; and wherein said variant of PCSK9 comprises at least one point mutation selected from the group consisting of: D162R, R164E, E167R, S123R, E129R, A311R, D313R, D337R, R519E, H521R, and Q554R.  91 3014695 7.  The antigen binding protein according to concept 6, wherein the antigen binding protein binds to PCSK9 at a overlapping site with a location that the LDLR binds to PCSK9.  5 8.  A method of making an antigen-binding protein that binds to a PCSK9 protein comprising the amino acid sequence of SEQ ID NO: 1, wherein the antigen binding protein decreases the effect of lowering the LDLR of PCSK9 to LDLR, said method comprising providing a host cell comprising a nucleic acid sequence that encodes the antigen-binding protein; and now the host cell under conditions in which the antigen-binding protein is expressed, wherein the antigen-binding protein comprises a light chain comprising an amino acid sequence of SEQ ID NO: 46, and wherein the antigen binding protein comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 60.  9.  A method of treating or preventing a condition associated with high levels of serum cholesterol in a subject, said method comprising administering to a subject in need of an effective amount of a binding protein of a neutralizing antigen isolated simultaneously or sequentially with an agent which increases the availability of the protein.  LDLR, wherein the isolated antigen-binding protein binds to a PCSK9 protein comprising the amino acid sequence of SEQ ID NO: 1, wherein the neutralizing antigen binding protein decreases the lowering effect LDLR of PCSK9 on LDLR, wherein the antigen binding protein comprises a light chain comprising an amino acid sequence of SEQ ID NO: 46, and wherein the antigen binding protein comprises a chain heavy protein comprising an amino acid sequence of SEQ ID NO: 60.  3014695 10.  The method according to concept 9, wherein the agent that increases the availability of LDLR protein comprises a statin.  11.  An antigen-binding protein that binds to PCSK9, where when the antigen binding protein is bound to PCSK9, the antibody is positioned at 8 angstroms or less of at least one of the following residues of PCSK9: S153, S188, 1189, Q190, 5191, D192, R194, E197, G198, R199, V200, D224, R237, D238, K243, 5373, D374, 5376, T377, F379, 1154, T187; , H193, E195, 1196, M201, V202, C223, T228, 5235, G236, A239, G244, M247, 1369, 5372, C375, or C378, wherein the antigen-binding protein comprises a light chain comprising a sequence amino acid sequence of SEQ ID NO: 46, and wherein the antigen-binding protein comprises a heavy chain comprising an amino acid sequence of SEQ ID NO: 60.  The ligand may be used for the treatment, therapy, prophylaxis and / or diagnosis of, or susceptibility to, one or more diseases or conditions where such diseases or conditions include those described in the documents. US20120093818A1 (Amgen, Inc.) and US20110065902A1 (Regeneron Pharmaceuticals, Inc.), for example, a disease or condition described in paragraphs [0375] to [0383] of US20120093818A1, the disclosure of which is incorporated herein by reference in its completeness for inclusion in one or more of the claims in this document.  The ligand can be administered to a human characterized as described in US20120093818A1 (Amgen, Inc.) or US20110065902A1; each of which is incorporated by reference in this document in its entirety.  The ligand may be administered in a form or combination described in US20120093818A1 (Amgen, Inc.) or US20110065902A1, the disclosure of which is incorporated herein by reference.  For example, the ligand with a drug, excipient, diluent or carrier as described in US20120093818A1 (Amgen, Inc.) or US20110065902A1 (e.g., as described in paragraphs [0384] to [0412] of US20120093818A} 1), the disclosure of which is incorporated herein by reference, and the present invention also relates to the corresponding pharmaceutical compositions comprising the combination of a ligand of the invention and such other agent.  Each of the foregoing references is incorporated herein by reference in its entirety.  The ligand may be used in a diagnostic method as disclosed in US20120093818A1 (Amgen, Inc.) or US20110065902A1, for example, in [0413] to [0415] of US20120093818A1, the disclosure of which is incorporated herein. in reference.  Each of the foregoing references is incorporated by reference in this document in its entirety.  Diagnostic Applications In some embodiments, the ligand of the invention is a diagnostic tool.  The ligand can be read used to assay the amount of PCSK9 present in a sample and / or in a subject.  As will be understood by those skilled in the art, such ligands do not need to be neutralizing ligands.  In some embodiments, the diagnostic ligand is not a neutralizing ligand.  In some embodiments, the diagnostic ligand binds to an epitope different from that to which a neutralizing ligand binds.  In some embodiments, the two ligands do not compete with each other.  In some embodiments, the ligands of the invention are used or provided in a kit and / or assay method for the detection of PCSK9 in mammalian tissues or cells to screen / diagnose a disease or condition. disorder associated with changes in PCSK9 levels.  The kit includes a ligand that binds PCSK9 and a means for indicating ligand binding to PCSK9, if present, and possibly PCSK9 protein concentrations.  Various means for indicating the presence of a ligand may be used.  For example, fluorophores, other molecular probes, or enzymes may be ligand-bound and the presence of the ligand may be observed in a variety of ways.  The screening method for such disorders may involve the use of the kit, or simply the use of one of the described ligands and the determination of whether the ligand binds to PCSK9 in a sample.  As will be understood by those skilled in the art, high or high levels of PCSK9 will result in greater amounts of ligand binding to PCSK9 in the sample.  Thus, the degree of ligand binding can be used to determine how much PCSK9 is in a sample.  Subjects or samples with an amount of PCSK9 that is greater than a predetermined amount (for example, an amount or range that a person without PCSK9-associated disorder will exhibit) may be characterized as suffering from a disorder associated with PCSK9. the PCSK9.  In some embodiments, the invention provides a method in which the ligand is administered to a statin-taking subject to determine if the statin has increased the amount of PCSK9 in the subject.  In some embodiments, the ligand is a non-neutralizing ligand and is used to determine the amount of PCSK9 in a subject receiving ABP and / or statin therapy.  In some embodiments, the ligand of the invention can specifically bind the. Human PCSK9 (e.g., one, two or more rare variant forms described herein) and is characterized by at least one of the following characters: (i) capable of reducing total cholesterol in serum from minus about 25 to 35% and prolong the reduction over at least a 24-day period compared to a pre-dose rate; (ii) capable of reducing serum LDL-cholesterol by at least about 65 to 80% and prolonging the reduction over at least a 24-day period from a pre-dose rate; (iii) capable of reducing serum LDL-cholesterol by at least about 40 to 70% and prolonging the reduction over at least 60 or 90 days from a pre-dose rate; (iv) capable of reducing triglycerides in serum by at least about 25-40% from a pre-dose level; (v) does not reduce serum HDL-cholesterol or reduce serum HDL-cholesterol by more than 5% from a pre-dose level.  In some embodiments, an isolated nucleic acid molecule is provided and codes for the ligand.  In some embodiments, an expression vector is provided and includes the nucleic acid molecule.  In some embodiments, a pharmaceutical composition is provided and may include the ligand and a pharmaceutically acceptable carrier.  In some embodiments, the method is provided for the treatment of a disease or condition that is enhanced, inhibited, or prevented with a PCSK9 antagonist ligand of the invention.  The method may include administering a therapeutic amount of the pharmaceutical composition or ligand to a subject in need thereof.  In some embodiments, the subject is a human subject suffering from hypercholesterolemia, hyperlipidemia, indicated for LDL apheresis, identified as being heterozygous for familial statin-intolerant, statin-controlled hypercholesterolemia, risk of developing hypercholesterolemia, dyslipidemia, cholestatic liver disease, nephrotic syndrome, hypothyroidism, obesity, atherosclerosis and cardiovascular diseases.  In some embodiments, a method providing a treatment or therapy is provided to a subject.  In some embodiments, the method comprises reducing serum cholesterol by at least about 40 to 70% over at least 60 to 90 days.  In some embodiments, there is provided a method for receiving a treatment or therapy, the method may include receiving a ligand thereof at a frequency of once every 60 to 60 minutes. 90 days.  In one aspect, the invention provides a ligand of the invention which is or comprises a human antibody or an antigen-binding fragment of a human antibody that specifically binds and inhibits proprotein convertase subtilisin / kexin type 9 (hPCSK9, for example, one, two, or more rare variant forms described herein, and optionally the α-form and / or the α-form), characterized by the ability to reduce LDL-cholesterol in serum. 40 to 80% over a period of 24, 60 or 90 days relative to pre-dose levels, with little or no reduction in HDL cholesterol in the serum and / or little or no measurable effect on hepatic function, as determined by the ALT and AST assays.  In one embodiment, the ligand of the invention comprises an antibody or an antigen binding fragment of an antibody that specifically binds hPCSK9 and is characterized by at least one of the following characters (i) - capable of reducing total serum cholesterol by at least about 25-35% and prolonging the reduction over at least 24 days from a pre-dose level, preferably reducing total cholesterol in the serum. serum is at least about 30 to 40%; (ii) capable of reducing serum LDL-cholesterol by at least about 65 to 80% and prolonging the reduction by at least 24 days from a pre-dose rate; (iii) capable of reducing triglycerides in serum by at least about 25 to 40% from a pre-dose level; (iv) does not reduce serum HDL-cholesterol or reduce serum HDL-cholesterol by more than 5% from a pre-dose level.  See US2011 / 0065902 for definitions of these terms and possible characters, the description of which is incorporated herein by reference in its entirety.  In one embodiment, the invention comprises an antibody or an antigen binding fragment of an antibody that specifically binds hPCSK9 and is characterized by at least one of the following characters: (i) capable of reducing serum LDL-cholesterol by at least about 40-70% and prolong the reduction over at least 60 or 90 days from a pre-dose level; there.  (ii) capable of reducing triglycerides in serum by at least about 25-40% from a pre-dose level; (iii) does not reduce serum HDL-cholesterol or reduce serum HDL-cholesterol by no more than 5% compared to a pre-dose rate.  In one embodiment, the antibody or antigen-binding fragment is characterized as having an enhancement of binding affinity (KD) for hPCSK9 at pH 5.5 relative to KD at pH 7, 4, as measured by surface plasmon resonance.  In a specific embodiment, the antibody or fragment thereof has an amplification of at least 20-fold, at least 40-fold or at least 50-fold affinity for PCSK9 at pH acid relative to a neutral pH, as measured by surface plasmon resonance.  In one embodiment, the antibody or antigen-binding fragment is characterized as having no enhancement of the binding affinity for PCSK9 at an acid pH relative to a neutral pH, as is measured by surface plasmon resonance.  In a specific embodiment, the antibody or fragment thereof exhibits a decrease in binding affinity at an acidic pH.  In another embodiment, the antibody or antigen-binding fragment binds human PCSK9, human with the GOF mutation D374Y, cynomolgus monkey, rhesus monkey, mouse, rat and hamster.  In one embodiment, the antigen or binding fragment of an antigen binds human and monkey PCSK9, but does not bind PCSK9 of mouse, rat or hamster.  In one embodiment, the invention comprises an antibody or an antigen binding fragment of an antibody comprising one or more of a heavy chain variable region (HCVR), a light chain variable region. (LCVR), HCDR1, HCDR2, HCDR3 described in any one of [023] to [037] of US2011 / 0065902, the disclosure of which is incorporated herein by reference in its entirety.  In a related embodiment, the invention comprises an antibody or an antigen binding fragment of an antibody that specifically binds hPCSK9, where the antibody or fragment, comprises heavy chain CDR domains and light contained within the light and heavy chain sequence pairs selected from the group consisting of SEQ ID NO (using the sequence numbering of US2011 / 0065902): 2/10, 18/20, 22/24, 26 / 34, 42/44, 46/48, 50/58, 66/68, 70/72, 74/82, 90/92, 94/96, 98/106, 114/116, 118/120, 122/130 , 138/140, 142/144, 146/154, 162/164, 166/168, 170/178, 186/188, 190/192, 194/202, 210/212, 214/216, 218/226, 234 / 236, 238/240, 242/250, 258/260, 262/264, 266/274, 282/284, 286/288, 290/298, 306/308, 310/312, 314/322, 330/332 , 334/336, 338/346, 354/356, 358/360, 362/370, 378/380, 382/384, 386/394, 402/404, 406/408, 410/418, 426/428, 430/432, 434/442, 450/452, 454/456, 458/466, 474/476, 478/480, 482/490, 498/50 0, 502/504, 506/514, 522/524, 526/528, 530/538, 546/548, 550/552, 554/562, 570/572, 574/576, 578/586, 594/596, 598/600, 602/610, 618/620, 622/624, 626/634, 642/644, 646/648, 650/658, 666/668, 670/672, 674/682, 690/692, 694 / 696, 698/706, 714/716, 718/720, 722/730, 738/740 and 742/744.  In one embodiment, the CDR sequences are contained within the HCVRs and LCVRs selected from the amino acid sequence pairs of SEQ ID NO: 50/58, 66/68, 70/72, 74/82, 90 / 92, 94/96, 122/130, 138/140, 142/144, 218/226, 234/236, 238/240, 242/250, 258/260, 262/264, 314/322, 330 / 332 and 334/336.  In more specific embodiments, the CDR sequences are included within the sequences of.  HCVR / LCVR selected from SEQ ID NO: 90/92 or 218/2126.  Each of the foregoing references is incorporated herein by reference in its entirety.  In one example, the invention relates to a pharmaceutical composition comprising a ligand of the invention, wherein the ligand comprises or consists of a recombinant human antibody or a fragment thereof that specifically binds hPCSK9 and a carrier. pharmaceutically acceptable.  In one embodiment, the invention relates to a composition which is a combination of a ligand of the invention (e.g., antibody or antigen binding fragment of an antibody), and a second therapeutic agent.  The second therapeutic agent may be any agent which is advantageously combined with the ligand of the invention, for example, an agent capable of inducing cellular depletion in cholesterol synthesis by inhibition of 3-hydroxy-3-methylglutaryl ( HMG) -coenzyme A (CoA) reductase, such as, for example, cerivastatin, atorvastatin, simvastatin, pitavastatin, rosuvastatin, fluvastatin, lovastatin, pravastatin, etc.  ; capable of inhibiting the absorption of cholesterol or the reabsorption of bile acids; capable of increasing the catabolism of lipoproteins (such as niacin); and / or activators of the transcription factor LXR which plays a role in the removal of cholesterol such as 22-hydroxycholesterol.  In one example, the invention provides a method of inhibiting the activity of hPCSK9 using the anti-PCSK9 ligand of the invention (e.g., an antibody or antigen-binding portion of the antibody of the invention). invention), wherein the therapeutic methods comprise administering a therapeutically effective amount of a pharmaceutical composition comprising an antibody or an antigen binding fragment of an antibody of the invention.  The disorder treated is any disease or condition that is improved, inhibited or prevented by the elimination, inhibition or reduction of PCSK9 activity.  The populations which can be treated by the therapeutic methods of the invention include subjects indicated for apheresis of LDL, subjects with activating mutations of PCSK9 (gaining function mutations, "GOF"), subjects suffering from hypercholesterolemia. heterozygous family (heFH); subjects with primary hypercholesterolemia who are statin intolerant or statin-intolerant; and subjects at risk of developing hypercholesterolemia that can be treated preventively.  Other indications include dyslipidemia associated with secondary causes such as diabetes mellitus type 2, cholestatic liver disease (primary biliary cirrhosis), nephrotic syndrome, hypothyroidism, obesity; and the prevention and treatment of atherosclerosis and cardiovascular diseases.  In specific embodiments of the method of the invention, the ligand of the invention (e.g., an antibody or anti-hPCSK9 antibody fragment of the invention) is useful for reducing high levels of total cholesterol. , non-HDL cholesterol, LDL-cholesterol, and / or apolipoprotein B (apolipoprotein B100).  The ligand (e.g., an antibody or an antigen binding fragment) of the invention may be used alone or in combination with a second agent, for example, an HMG-CoA reductase inhibitor and / or a another lipid-lowering drug.  The term "isolated" with reference to a ligand, an antibody or a protein, for example in any aspect, configuration, example or embodiment, means a ligand, an antibody, a protein, etc. .  subject (1) is devoid of at least some other proteins with which it would normally be found, (2) is substantially free of other proteins from the same source, e.g., of the same species, (3) is expressed by a cell from a different species, (4) has been separated by at least about 50 percent of the polynucleotides, lipids, carbohydrates, or other materials with which it is associated in nature, (5) is associated with Functional (by a covalent or non-covalent interaction) with a polypeptide with which it is not associated in nature, or (6) does not exist in nature.  In general, a ligand, antibody, protein, etc.  "isolated" is at least about 5%, at least about 10%, at least about 25%, or at least about 50% of a given sample.  Genomic DNA, cDNA, mRNA or other RNA of synthetic origin, or any combination thereof, which can encode such a ligand, antibody, protein, etc.  isolated.  Preferably, the ligand, antibody, protein, etc.  isolated is substantially free of proteins or polypeptides or other contaminants that are in its natural environment that will interfere with its therapeutic, diagnostic, prophylactic, research, or other use.  For example, an "isolated" antibody is an antibody that has been identified, separated and / or recovered from a component of its production environment (e.g., naturally or recombinantly).  Preferably, the isolated polypeptide is devoid of association with all other components from its production environment, for example, such that the antibody has been isolated from a standard that can be approved or approved by the FDA. .  Contaminant components of its production environment, such as those resulting from recombinant transfected cells, are materials that will generally interfere with research, diagnostic, or therapeutic uses for the antibody, and may include enzymes, hormones, and the like. other protein or non-protein solutes.  In preferred embodiments, the polypeptide will be purified: (1) greater than 95% by weight of antibody as determined, for example, by the method of Lowry, and in certain embodiments, more than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of the N-terminal or internal amino acid sequence by use of a rotary cup sequencer, or (3) to SDS-homogeneity. PAGE under non-reducing or reducing conditions using Coomassie blue or, preferably, silver staining.  The isolated antibody comprises the antibody in situ within the recombinant cells since at least one component of the natural environment of the antibody will not be present.  However, usually an isolated polypeptide or antibody will be prepared by at least one purification step.  Immunoconjugates The invention encompasses the ligand (e.g., an antibody) conjugated to a therapeutic ("immunoconjugate") moiety, such as a cytotoxin, a chemotherapeutic drug, an immunosuppressant or a radioisotope.  Cytotoxin agents include any agent that is harmful to cells.  Examples of cytotoxic agents and chemotherapeutic agents suitable for the formation of immunoconjugates are known.  in the art, see for example, WO 05/103081, which is incorporated by reference in this document in its entirety.  Specific Bi The antibodies of the present invention may be monospecific, bispecific, or multispecific.  The multispecific mAbs may be specific for different epitopes of a target polypeptide or they may contain antigen binding domains specific for more than one target polypeptide.  See, for example, Tutt et al.  (1991) J.  Immunol.  147: 60-69.  Anti-PCSK9 human mAbs (e.g., anti-PCSK9) may be linked to or coexpressed with another functional molecule, for example, another peptide or another. protein.  For example, an antibody or fragment thereof may be operably linked (e.g., by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as another antibody or fragment thereof. antibody, to produce a bispecific antibody or a multispecific antibody with a second binding specificity.  An example of a bispecific antibody format that can be used in the context of the present invention involves the use of a first CH3 domain of immunoglobulin (Ig) and a second CH3 domain of Ig, where the first and second Ig CH3 domains differ from each other by at least one amino acid, and wherein at least one amino acid difference reduces binding of the bispecific antibody to protein A as compared to a bispecific antibody lacking the amino acid difference.  In one embodiment, the first CH3 domain of Ig binds A protein and the second Ig CH3 domain contains a mutation that reduces or abolishes binding to protein A as a H95R modification (by IMGT exon numbering; H435R by EU numbering).  The second CH3 may further comprise a modification andF (by IMGT; Y436F by UE).  Other modifications that may be within the second CH3 include: p16E, L18M, N44S, K52N, V57M, and V821 (by IMGT, D356E, L358M, N384S, K392N, V397M, and V422I by UE) in the case IgG1 antibodies; N44S, K52N, and V82I (IMGT; N384S, K392N, and V422I by UE) in the case of IgG2 antibodies; and Q15R, N44S, K52N, V57M, R69K, E79Q, and V82I (para.  IMGT; Q355R, N3845, K392N, V397M, R409K, E419Q, and V4221 by UE) in the case of IgG4 antibodies.  Variations on the bispecific antibody format described above are contemplated within the scope of the present invention.  Target population of the treatment The invention provides therapeutic methods for the treatment of a human patient in need of a composition or ligand of the invention.  While lifestyle changes and traditional drug therapy often reduce cholesterol levels, not all patients can achieve the target cholesterol levels recommended with such approaches.  Various conditions, such as familial hypercholesterolemia (FH), appear to be resistant to lower LDL-C levels despite aggressive use of traditional therapy.  Homozygous and heterozygous familial hypercholesterolemia (hoFH, heFH) is a condition associated with premature atherosclerotic vascular disease.

However, patients diagnosed with hoFH are largely unreactive to traditional drug therapy and have limited treatment options.  Specifically, treatment with statins, which reduce LDL-C by inhibition of cholesterol synthesis and upregulation of hepatic LDL receptor, may have little effect in patients with LDL receptors. are non-existent or defective.  An average reduction in LDL-C of only less than about 20% has recently been reported in patients with genotype-confirmed hoFH treated with the maximum dose of statins.  The addition of ezetimibe at 10 mg / day to this regimen resulted in a total reduction in LDL-C levels of 27%, which is still far from optimal.  Likewise, many patients are statin-unreactive, poorly controlled by statin therapy, or can not tolerate statin therapy; in general, these patients are unable to achieve cholesterol control with alternative treatments.  There is a great unmet medical need for new treatments that can address the shortcomings of current treatment options.  Specific populations that may be treated by the therapeutic methods of the invention include patients indicated for LDL apheresis, subjects with PCSK9-activating mutations (GOFs), with heterozygous familial hypercholesterolemia (heFH); subjects with primary hypercholesterolemia who are statin intolerant or statin-unstable; and subjects at risk of developing hypercholesterolemia that can be treated preventively.  Therapeutic Administration and Formulations The invention provides therapeutic compositions comprising the anti-PCSK9 antigen-binding ligands, antibodies, or fragments thereof of the present invention.  Therapeutic compositions according to the invention will be administered with suitable carriers, excipients, and other agents that are incorporated into the formulations to provide improved transfer, delivery, tolerance, and the like.  A multitude of suitable formulations can be found in the known form of all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, Pa.  Such formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid-containing vesicles (cationic or anionic) (such as LIPOFECTIN ™ ™), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, carbowax emulsions (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax.  See also Powell et al.  "Compendium of excipients for parenteral formulations" PDA (1998) J Pharm Sci Technol 52: 238-311.  The dose may vary depending on the age and size of the subject concerned by the administration, the target disease, the conditions, the route of administration, and the like.  When the ligand, for example, an antibody, of the present invention is used to treat a variety of conditions and diseases associated with PCSK9, including hypercholesterolemia, LDL and apolipoprotein B related disorders, and metabolic disorders. lipids, and the like, in an adult patient, it is advantageous to intravenously administer the ligand or antibody of the present invention normally at a single dose of from about 0.01 to about 20 mg / kg of body weight. body, more preferably about 0.02 to about 7, about 0.03 to about 5, or about 0.05 to about 3 mg / kg body weight.  Depending on the severity of the condition, the frequency and duration of treatment may be adjusted.  Various delivery systems are known and can be used to administer the pharmaceutical composition of the invention, thus the composition of the invention provides the ligand, for example, by encapsulation in liposomes, microparticles, microcapsules, recombinant cells Capable of expressing mutant viruses, receptor-mediated endocytosis (see, for example, Wu et al.  (1987) J.  Biol.  Chem.  262: 4429-4432).  The methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.  The composition may be administered by any convenient route, for example, by infusion or bolus injection, absorption through epithelial and mucocutaneous membranes (e.g., oral mucosa, rectal and intestinal mucosa, etc.). ) and can be administered together with other biologically active agents.  Administration may be systemic or local The pharmaceutical composition may also be delivered into a vesicle, particularly a liposome (see Langer (1990) Science 249: 1527-1533, Treat et al.  (1989) in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez Berestein and Fidler (eds. ), Liss, New York, pp. 353-365; Lopez-Berestein, ibid. , pp.  317-327; see generally Ibid. ).  In some situations, the pharmaceutical composition may be delivered in a controlled release system.  In one embodiment, a pump may be used (see Langer, above; Sefton (1987) CRC Crit.  Ref.  Biomed.  Eng.  14: 201).  In another embodiment, polymeric materials may be used; see, Medical Applications of Controlled Release, Langer and Wise (eds. ), CRC Pres. , Boca Raton, Fla.  (1974).  In yet another embodiment, a controlled release system may be placed near the target of the composition, thus requiring only a fraction of the systemic dose (see, for example, Goodson, in Medical Applications of Controlled Release, above, vol.  2, pp.  115-138, 1984).  Injection preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, and the like.  These injectable preparations can be prepared by methods known to the public.  For example, the injectable preparations may be prepared, for example, by dissolving, suspending or emulsifying the antibody or salt thereof described above in an aqueous medium or a sterile oily medium traditionally used for injections. .  As an aqueous medium for the injections, there is, for example, physiological saline, isotonic solution containing glucose and other auxiliary agents, etc. which may be used in combination with a suitable solubilising agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant [e.g. polysorbate 80, HCO-50 (a polyoxyethylene (50 mol) adduct of a hydrogenated castor oil)], etc.  As the oily medium, it is used, for example, sesame oil, soybean oil and the like. which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, and the like.  The injection thus prepared is preferably poured into a suitable ampoule.  A pharmaceutical composition of the present invention can be delivered subcutaneously or intravenously with a needle and a standard syringe.  In addition, with respect to subcutaneous delivery, a pen-like delivery device easily has applications in delivering a pharmaceutical composition of the present invention.  Such a pen-like delivery device may be reusable or disposable.  A reusable pen delivery device generally uses a replaceable cartridge that contains. a pharmaceutical composition.  Once the entire pharmaceutical composition within the cartridge has been administered and the cartridge is empty, the empty cartridge can be easily discarded and replaced with a new cartridge which contains the pharmaceutical composition.  The pen delivery device can then be reused.  In a dispensing device in the form of a disposable pen, there is no replaceable cartridge.  Instead, the dispensing device in the form of a disposable pen arrives pre-filled with the pharmaceutical composition contained in a reservoir within the device.  Once the reservoir is emptied of the pharmaceutical composition, the entire device is discarded.  Many reusable pen delivery devices and auto-injectors have applications in the subcutaneous delivery of a pharmaceutical composition of the present invention.  Examples include, but are certainly not limited to, AUTOPENrm (Owen Mumford, Inc. , Woodstock, UK), DISETRONIC ™ pen (Disetronic Medical Systems, Burghdorf, Switzerland), HUMALOG MIX 75 / 25TM pen, HUMALOG ™ pen, HUMALIN 70/30 ™ Pen (Eli Lilly and Co.) , Indianapolis, Ind. ), NOVOPENTMI, II and III (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIORTM (Novo Nordisk, Copenhagen, Denmark), BDTM pen (Becton Dickinson, 15 Franklin Lakes, N. J. ), OPTIPENT111, OPTIPEN PROTM, OPTIPEN STARLETTM, and OPTICLIKTTM (Sanofi-Aventis, Frankfurt, Germany), to name a few.  Examples of disposable pen delivery devices having applications in the subcutaneous delivery of a pharmaceutical composition of the present invention include, but are certainly not limited to the SOLOSTART ™ pen (Sanofi-Aventis), the FLEXPENTM. (Novo Nordisk), and KWIKPENTM (Eli Lilly).  Advantageously, the pharmaceutical compositions for oral or parenteral use described above are prepared in unit dose dosage forms adjusted to fit a dose of the active ingredients.  Such dosage unit dosage forms include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc.  The amount of the aforementioned antibody contained is generally from about 5 to about 500 mg per dosage unit dosage form; especially in the form of an injection, it is preferred that the above-mentioned antibody be contained in about 5 to about 100 mg and in about 10 to about 250 mg for the other galenic forms.  The invention provides therapeutic methods in which the ligand, for example, an antibody or an antibody fragment, of the invention is useful for treating hypercholesterolemia associated with various conditions involving hPCSK9.  Anti-PCSK9 ligands, e.g., antibodies or antibody fragments, of the invention are particularly useful for the treatment of hypercholesterolemia and the like.  Combination therapies may include the anti-PCSK9 ligand of the invention with, for example, one or more of any agent that (1) induces cellular depletion of cholesterol synthesis by inhibition of 3-hydroxy-3-methylglutaryl ( HMG) -coenzyme A (CoA) reductase, such as cerivastatin, atorvastatin, simvastatin, pitavastatin, rosuvastatin, fluvastatin, lovastatin, pravastatin; (2) inhibits the absorption of cholesterol and / or the reabsorption of bile acids; (3) increases the catabolism of lipoproteins (such as niacin); and LXR transcription factor activators that play a role in eliminating cholesterol such as 22-hydroxycholesterol or fixed combinations of ezetimibe plus simvastatin; a statin with a bile resin (e.g., cholestyramine, colestipol, colesevelam), a fixed combination of niacin plus a statin (e.g., niacin with lovastatin); or with other lipid-lowering agents such as ethyl esters of omega 3 fatty acids (e.g., omacor).  The ligands of the invention are useful, for example, in specific binding assays, for human genotyping or phenotyping, affinity purification of PCSK9 and in screening assays to identify other 3014695 antagonists of the activity of PCSK9.  Certain ligands of the invention are useful for inhibiting the binding of PCSK9 to a human cognate receptor or protein, or inhibiting PCSK9 mediated activities.  The invention encompasses anti-PCSK9 (e.g., PCSK9) antibody ligands having a modified glycosylation profile.  In some applications, modification to remove undesirable glycosylation sites may be useful, or for example, removal of a fucose radical to enhance the antibody-dependent cellular cytotoxicity (ADCC) function.  (see Shield et al.  (2002) JBC 277: 26733).  In other applications, modification of galactosylation can be performed to modify complement-dependent cytotoxicity (CDC).  In one example, the invention relates to a pharmaceutical composition comprising a ligand of the invention, wherein the ligand is or comprises a recombinant human antibody or a fragment thereof that specifically binds PCSK9 (e.g., a rare variant as described herein) and a pharmaceutically acceptable carrier.  In one embodiment, the invention relates to a composition which is a combination of an antibody ligand or an antigen binding fragment of an antibody of the invention, and a second agentitherapeutique.  The second therapeutic agent may be any of an anti-inflammatory agent, an anti-angiogenesis agent, an analgesic, a diuretic, a chemotherapeutic agent, an antineoplastic agent, a vasodilator, vasoconstrictor, stative, beta-blocker, nutrient, adjuvant, anti-obesity agent and antidiabetic agent.  "Pharmaceutically Acceptable" means approved or may be approved by a regulatory agency of the United States Federal Government or a state government or listed in the United States Pharmacopoeia or other pharmacopoeia generally recognized for use in animals , including human beings.  A pharmaceutically acceptable carrier, excipient, or adjuvant "refers to a carrier, excipient, or adjuvant that may be administered to a subject, together with an agent, for example, any antibody or antibody chain described in This document, which does not destroy the pharmacological activity thereof and is not toxic when administered in doses sufficient to deliver a therapeutic amount of the agent.  In one example, the invention relates to a method of inhibiting the activity of PCSK9 using the anti-PCSK9 ligand of the invention (e.g., an antibody or antigen-binding portion of the invention), wherein the therapeutic method comprises administering a therapeutically effective amount of a pharmaceutical composition comprising the ligand.  The disorder treated is any disease or condition that is improved, inhibited or prevented by the elimination, inhibition or reduction of PCSK9 activity.  By the phrase "therapeutically effective amount" is meant an amount that produces the desired effect for which it is administered.  The amount available will depend on the purpose of the treatment and may be determined by those skilled in the art using known techniques (see, for example, Lloyd (1999) The Art, Science and Technology of Pharmaceutical Compounding).  Genotyping and Phenotyping Those skilled in the art will be familiar with the techniques that can be used for accurate genotyping and application to the invention.  These include the following.  3014695 1.  Hybridization-based methods 1. 1 Allele-specific dynamic hybridization 1. 2 Molecular Beacons 1. 3 Microchips with SNP 5 2.  Processes based on en2ymes 2. 1 Polymorphism of restriction fragment length 2. 2 Method based on PCR 2. 3 Flap endonuclease 2. 4 Primer extension 10 2. 5'-Nuclease 2. 6 Test based on oligonucleotide ligation 3.  Other post-amplification methods based on the physical properties of DNA 3. 1 Single strand conformation polymorphism 15 3. 2 Temperature gradient gel electrophoresis 3. 3 Denaturing High Performance Liquid Chromatography 3. 4 High resolution fusion of the entire amplicon 3. Use of Mismatched DNA Binding Proteins 3. 6 SNPlex (SNPlexTM is a proprietary genotyping platform sold by Applied Biosystems).  Next-generation sequencing technologies such as pyrosequencing are also useful.  Reference is also made to GB2444410A and the genotyping method described therein, which is incorporated herein by reference in its entirety.  Miniaturized assays, such as microarrays with oligonucleotide reagents immobilized on small areas, are frequently proposed for large scale mutation analysis and high throughput genotyping (large-scale identification, mapping, and genotyping of polymorphisms of a single nucleotide in the human genome (Wang DG, Fan JB, Siao CJ, Berno A, Young P, Sapolsky R, Ghandour G, Perkins N, Winchester E, Spencer J, Kruglyak L, Stein L, Hsie L, Topaloglou T, Hubbell E, Robinson E, Mittmann M, Morris MS, Shen N, Kilburn D, Rioux J, Nusbaum C, Rozen S, Hudson TJ, Lipshutz R, Chee M, Lander ES, Science.  1998 May 5 15; 280 (5366): 1077-82).  Other high throughput methods discriminate alleles by differential hybridization, primer extension, ligation and cleavage of an allele-specific probe (Review Accessing Genetic Variation (genotyping single nucleotide polymorphisms), Syvanen AC, Nat Rev Genet.  2001 Dec; 2 (12): 930-42; Technical Review patents for SNP genotyping, RM Twyman, Primrose SB, Pharmacogenomics.  2003 Jan; 4 (1): 67-79).  One approach for a fully automated, large scale SNP assay is the 'homogeneous' assay, i.e., a single phase assay with no separation steps, allowing continuous control during amplification.  The TaqManTm (Applied Biosystems) test, originally designed for real-time quantitative PCR, is a homogeneous assay, also used in the determination of the status of DNA mutations (see, for example, A . AT.  Komar (ed. ), Single Nucleotide Polymorphisms, Methods in Molecular Biology 578, DOT 10. 1007 / 978-1-60327-411-1_19, Humana Press, part of Springer Science + Business Media, LLC; and Single Nucleotide Polymorphisms, Methods-in Molecular B4ology ™ Volume 578, 2009, pp. 293-306, The TagMan Method for SNP Genotyping, Gong-Qing Shen et al).  The TaqMan SNP Genotyping Test exploits the 5'-exonuclease activity of ampliTaq GoldTM polymerized DNA to cleave a doubly labeled probe hybridized to the sequence containing the dsDNA SNP.  Cleavage separates a 5 'fluorophore from a 3' quencher leading to a detectable fluorescent signal.  The use of two allele-specific probes carrying different fluorophores allows the determination of SNPs in the same tube without any 3014695 post-PCR treatment.  The genotype is determined from the ratio of the intensities of the two fluorescent probes at the end of the amplification.  Thus, rather than taking advantage of the full set of real-time PCR data as in the quantitative studies, only the endpoint data is used.  The genotyping of TaqMan SNPs in a high throughput automated system is facilitated by the use of prefabricated TagMan® genotyping assays, but custom TaqMan® 10 assays can also be used (High-thr. oughput genotyping with single nucleotide polymorphisms, Ranade K, Chang MS, Ting CT, Pei D, Hsiao CF, Olivier M, Pesich R, Hebert J, Chen YD, Dzau VJ, Curb D, Olshen R, Risch N, Cox DR, Botstein D, Genome Res.  2001 Jul; 11 (7): 1262-8; Assessment 15 of two flexible and compatible SNP genotyping platforms: TaqMan SNP Genotyping Assays and the SNPlex Genotyping System, Vega FM, Lazaruk KD, Rhodes MD, Wenz MH, Mutat Res.  2005 Jun 3; 573 (1-2): 111-35).  The test results can be determined automatically by genotyping software provided with real-time thermocyclers (eg Bio-Rad's IQ software, Sequence Detection software from Applied Biosystems).  Single nucleotide polymorphisms (SNPs) can be determined using real-time TaqManTn PCR assays (Applied Biosystems) and commercial software that assigns genotypes based on reporter probe signals at the end of the test. 'amplification.  An algorithm for automatically naming genotypes of SNPs using the full set of TaqMan data in real time is available for use (A.  Callegaro et al. , Nucleic Acids Res.  2006; 34 (7): e56, published online 14 April 2006.  doi: 10. 1093 / nar / gk1185, PMCID: PMC1440877).  The algorithm is unique in that it classifies the samples according to the behavior of the whites (no DNA sample), which cluster with the heterozygous samples.  This method of classification eliminates the need for positive controls and allows accurate genotyping even in the absence of a genotype class, for example, when an allele is rare.  Those skilled in the art will be familiar with techniques that can be used for precise phenotyping and application to the invention.  These include the use of amino acid sequencing of an isolated target protein and comparison of sequences from different variants (e.g., with the most common variant).  An antibody that specifically and selectively binds to the area of an SNP under stringent conditions may also be used to identify a particular variant.  In another method, the genotype is determined and a corresponding amino acid sequence (phenotype) is determined, for example, by in silico translation.  For convenience, the meaning of certain terms and phrases used in the description, examples, and appended claims is provided below.  Unless otherwise stated, or implied from the context, the following terms and phrasA include the meanings provided below.  The definitions are provided to assist in describing particular embodiments, and are not meant to limit the claimed invention, because the scope of the invention is limited only by the claims.  Unless otherwise defined, all technical and scientific terms used in this document have the same meaning as commonly understood by a person of average skill in the field to which this invention belongs.  If there is an obvious discrepancy between the use of a term in the art and its definition given in this document, the definition provided in the memoir will prevail.  For convenience, certain terms used in this document, the specification, the examples, and the appended claims are here grouped together.  The terms "decrease", "reduce", or "decrease" are all used herein to mean a decrease in a statistically significant amount.  In some embodiments, "reduce", "reduce" or "decrease" generally means a decrease of at least 10% compared to a reference rate (e.g., the absence of a given treatment) and may include for example, a decrease of at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%. %, at least about 50%, at least about 55%, at least about 60%, at least about 65 at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about about 90%, at least about 95%, at least about 98%, at least about 99%, or more.  As used in this document, "reduction" does not encompass a complete reduction compared to a reference rate.  A decrease may preferably be up to an accepted rate within the range of normal for an individual without a given disorder.  However, for example, for cholesterol lowering or lowering purposes, for example, a reduction of about 5 points may be considered a "decrease" or a "reduction". In some aspects of all embodiments of the invention, the term "inhibition" is used.  Inhibition refers to a decrease of at least 10% compared to a reference level (e.g., the absence of a given treatment) and may include, for example, a decrease of at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40 at least about 45%, at least about 50%, at least about 55%, at least about 60% %, at least about 65%, at least about 70% at least about 75%, at least about 80 at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about about 99% or more including 100% inhibition compared to a reference rate.  "Complete inhibition" refers to 100% inhibition compared to a reference rate.  The terms "augmented," "augmented," "amplified," or "activated" are all used herein to mean an increase in a statistically significant amount.  In some embodiments, the terms "increased", "augmented", "amplified", or "activated" may mean an increase of at least 10% compared to a reference rate, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about about 90% or up to and including a 100% increase or any increase between 10% and 100% compared to a reference rate, or an increase of at least about 2 times, 25 or at least about 3 times, or at least about 4 times, or at least about 5 times or at least about 10 times, or any increase between 2 times and 10 times or more compared to a reference rate.  In the context of a marker or symptom, an "increase" is a statistically significant increase in such a rate.  As used herein, the term "substantially" refers to the qualitative condition of presenting a total or nearly total extent or degree of a characteristic or property of interest.  A person of average competence in the field will understand that the biological and chemical phenomena seldom, if ever, reach completion and / or proceed to compaction or attain or avoid an absolute result.  Therefore, the term "substantially" is used in this document to capture the potential lack of completion inherent in many biological and chemical phenomena.  For the avoidance of doubt, "substantially" may refer to a range or degree of at least 90% of a characteristic or property of interest, for example at least 90%, at least 92%, at least 95%, at least 98%, at least 99% or higher.  As used herein, a "subject" means a human being or an animal.  Usually, the animal is a vertebrate such as a primate, a rodent, a pet or a game.  Primates include chimpanzees, cynomolgus monkeys, spider monkeys, and macaques, for example, Rhesus.  Rodents include mice, rats, marmots, ferrets, rabbits and hamsters.  In some embodiments, the subject is a mammal, for example, a primate, for example, a human being.  The terms "individual," "patient" and "subject" are used interchangeably in this document.  In some embodiments, the subject may be a non-human vertebrate, for example, a primate, a rodent, a mouse, a rat, a pig, a sheep, a zebrafish, a frog, etc.  Preferably, the subject is a mammal. .  The mammal may be a human, a non-human primate, a mouse, a rat, a dog, a cat, a horse, or a cow, but is not limited to these examples.  Mammals other than humans may be advantageously used as subjects who represent animal models of a disease or condition, for example, a cardiovascular condition.  A subject can be male or female.  A subject may be one who has been previously diagnosed as having or identified as suffering from or having a condition in need of treatment or one or more complications associated with such condition, and possibly, who has already undergone treatment for the condition or one or more complications associated with the condition.  Alternatively, a subject may also be a subject who has not been previously diagnosed with the condition or one or more complications associated with the condition.  For example, a subject may be one who has one or more risk factors for the condition or one or more complications associated with the condition or a subject that does not have risk factors.  A "subject in need" or a "human being in need" of a treatment for a particular condition may be a subject suffering from such affliction, such as an increase in cholesterol levels, diagnosed as suffering from this condition, or at risk. to develop this affection.  As used herein, the terms "protein" and "polypeptide" are used interchangeably herein to refer to a series of amino acid residues connected to one another by peptide bonds between alpha groups. amino and carboxy adjacent residues.  The terms "protein" and "polypeptide" refer to a polymer of amino acids with natural amino acids.  When reference is made to "modified polypeptides", it refers to polypeptides that include modified amino acids (eg, phosphorylated, glycated, glycosylated, etc.). ) and amino acid analogues, regardless of size or function.  "Protein" and "polypeptide" are often used in reference to relatively large polypeptides, while the term "peptide" is often used in reference to small polypeptides, but the use of these terms in the art overlaps.  The terms "protein" and "polypeptide" are used interchangeably herein when reference is made to a gene product and fragments thereof.  Thus, examples of polypeptides or proteins include gene products, naturally occurring proteins with the specified sequence.  Peptide homologs, peptide orthologues, peptide paralogs, peptide fragments, and other equivalents, variants, fragments, and analogs of the peptides may also be used as these terms are understood by a person of average skill. in the field.  As used herein, the term "nucleic acid" or "nucleic acid sequence" refers to any molecule, preferably a polymeric molecule, incorporating ribonucleic acid units, deoxyribonucleic acid.  The nucleic acid can be either single-stranded or double-stranded.  A single-stranded nucleic acid may be a nucleic acid strand of a denatured double-stranded DNA.  Alternatively, it may be a single-stranded nucleic acid not derived from any double-stranded DNA.  In one aspect, the nucleic acid may be DNA.  In another aspect, the nucleic acid may be RNA.  Suitable nucleic acid molecules are DNA, including genomic DNA or cDNA.  Other suitable nucleic acid molecules are RNA, including mRNA.  In some aspects, nucleic acid analogues can also be used.  As used herein, the term "nucleic acid probe" refers to an isolated oligonucleotide molecule having a nucleic acid sequence that can hybridize to a target nucleic acid sequence, for example which specifically hybridizes to the target sequence.  In some embodiments, a nucleic acid probe may further comprise a detectable label.  In some embodiments, a nucleic acid probe may be attached to a solid surface.  In some embodiments, a nucleic acid has a length of about 5 nt to about 100 nt.  As used herein, the term "siRNA" refers to a nucleic acid that forms an RNA molecule comprising two individual RNA strands that are substantially complementary to one another.  In general, the siRNA is at least about 15 to 40 nucleotides in length (for example, each complementary sequence of the double-stranded siRNA is about 15 to 40 nucleotides in length, and the double-stranded siRNA has a length of a length of about 15 to 40 base pairs, preferably about 19 to 25 nucleotides in length, for example, 19, 20, 21, 22, 23, 24, or 25 nucleotides).  In some embodiments, siRNA can have blunt ends.  In some embodiments, siRNA may comprise a 3 'and / or 5' outgoing end on each strand having a length of about 0, 1, 2, 3, 4, or 5 nucleotides.  The length of the outgoing end is independent between the two strands, i.e. the length of the outgoing end on one strand is not dependent on the length of the outgoing end on the second strand.  The siRNA molecules may also include a 3 'hydroxyl group.  In some embodiments, the siRNA may comprise a 5 'phosphate group.  SiRNA has the ability to reduce or inhibit the expression of a target gene or RNA when the siRNA is present or expressed in the same cell as the target gene, for example the target RNA.  Posttranscriptional siRNA-dependent silencing of gene expression involves cleavage of the target RNA molecule at a siRNA-guided site as used herein, "PCSK9" or "proprotein convertase" 9 "subtilisin / kexin refers to a serine protease involved in the regulation of low density lipoprotein receptor protein (LDLR) levels (Horton et al. , 2007; Seidah and Prat, 2007).  It has been shown that PCSK9 interacts directly with LDLR protein, can be endocytosed with LDLR, and exhibits co-immunofluorescence with LDLR all along the endosomal pathway (Lagace et al. , 2006).  PCSK9 is a prohormone-proprotein convertase of the subtilisin (S8) family of serine proteases (Seidah et al. , 2003).  The sequence of PCSK9 is known for various species, for example, human PCSK9 (NCBI Gene ID No: 255738).  The nucleotide and polypeptide sequences for a number of PCSK9 isoforms are provided herein, for example, SEQ ID NO: 1 to 37.  PCSK9 exists in both pro form and mature form.  Autocatalysis of the PCSK9 pro-form occurs between Gln152 and Ser153 (VFAQIS1P) (Naureckiene et al. 2003) and has been shown to require secretion from cells (Seidah et al. , 2003).  The inactive form prior to this cleavage may be named "inactive", "pro form", or "untreated" form of PCSK9.  The C-terminal fragment generated by the autocatalysis event can be named in this PCSK9 document "mature," "cleaved", "processed" or "active".  Examples of isoforms of the pro form and the mature form of PCSK9 are provided herein, see SEQ ID Nos. 1 to 27.  As used herein, the "catalytic domain" of PCSK9 refers to that portion of a PCSK9 polypeptide corresponding to positions 153 to 449 of PCSK9, e.g., SEQ ID NO: 1.  As used herein, the "C-terminal domain" of PCSK9 refers to that portion of a PCSK9 polypeptide corresponding to positions 450 to 692 of PCSK9, e.g., SEQ ID NO: 1.

As used herein, a "PCSK9 mediated" disease or condition refers to a disease or condition that is caused or characterized by a change in PCSK9, e.g., a change in the level of expression, a change in activity, and / or the presence of a variant or mutation of PCSK9.  Non-limiting examples of such diseases or conditions may include, for example, lipid disorder, hyperlipoproteinemia, hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition.  In one example, the disease or condition is an inflammatory or autoimmune disease or condition.  The methods of identifying and / or diagnosing these diseases and conditions are well known to medical practitioners of average competence in the field.  A subject at risk of developing or suffering from a PCSK9-mediated disease or condition may be a subject having one or more signs or symptoms of such a disease or condition or having one or more risk factors for such a disease or condition. for example, having an overweight, elevated cholesterol level, comprising one or more genetic polymorphisms known to predispose to the disease or condition, for example, a high cholesterol level, such as having a mutation in the gene of the LDLR (encoding the low-density lipoprotein receptor 3014695) or APOB (encoding apolipoprotein B) or PCSK9 and / or having a family history of such a disease or condition.  As used herein, "ligand" refers to a molecule that can bind, for example, specifically bind to a second molecule or receptor.  In some embodiments, a ligand may be, for example, an antibody, an antibody fragment, an antibody portion and / or an affibody.  The term "variant" as used herein refers to a peptide or nucleic acid that differs from the polypeptide or nucleic acid (for example, the most common in humans, for example, the most frequent in a database as described in this document, such as the Project 1000 Genomes database) of one or more deletions, amino acid or nucleic acid additions, but which retains a or more specific biological functions or activities of the naturally occurring molecule.  Amino acid substitutions include modifications in which an amino acid is replaced by a different naturally occurring amino acid residue.  Such substitutions may be classified as "conservative", in which case an amino acid residue contained in a polypeptide is replaced by another naturally occurring amino acid of similar character in relation to either the polarity or the feature or the size of the side chain.  Such conservative substitutions are well known in the art.  The substitutions encompassed by the present invention may also be "non-conservative", i.e., wherein an amino acid residue that is present in a peptide is substituted with an amino acid having different properties, such as a amino acids naturally occurring in a different group (for example, by replacing a charged or hydrophobic amino acid with alanine), or alternatively, in which a naturally occurring amino acid is substituted by a non-traditional amino acid.  In some embodiments, the amino acid substitutions are conservative.  Also encompassed within the term variant, when used in reference to a polynucleotide or a polypeptide, a polynucleotide or a polypeptide that wants to vary in its primary, secondary or tertiary structure, as compared to a polynucleotide or polypeptide reference, respectively (for example, compared to a polynucleotide or a wild-type polypeptide).  Variants of PCSK9 are provided elsewhere in this document.  Variants of PCSK9 may include the forms described herein such as a, f, c, r, p, m, e, h, aj, and q.  The sequences of these variants are provided in this document, see, for example, SEQ ID NO: 1 to 27 and in Table 1.  In some aspects, "synthetic variants", "recombinant variants", or polynucleotide variants or "chemically modified" polypeptide variants isolated or generated can be used using methods well known in the art.  "Modified variants" can include conservative or non-conservative amino acid changes, as described below.  Polynucleotide changes may result in amino acid substitutions, additions, deletions, fusions, and truncations in the polypeptide encoded by the reference sequence.  Some aspects include insertion variants, deletional variants or variants substituted with amino acid substitutions, including insertions and substitutions of amino acids and other molecules that do not occur, normally in the peptide sequence which is the base of the variant, for example, but not limited to an ornithine insertion which does not normally exist in human proteins.  The term "conservative substitution" in the description of a polypeptide refers to a change in the amino acid composition of the polypeptide that does not substantially alter the activity of the polypeptide.  For example, a conservative substitution refers to the substitution of an amino acid residue for a different amino acid residue that has similar chemical properties.  Conservative amino acid substitutions include replacement of leucine with isoleucine or valine, aspartate with glutamate, or threonine with serine.  "Conservative amino acid substitutions" result from the replacement of one amino acid with another having similar structural and / or chemical properties, such as the replacement of leucine by isoleucine or valine, an aspartate by glutamate, or threonine by a serine.  Thus, a "conservative substitution" of a particular amino acid sequence refers to a substitution of those amino acids which are not critical to the activity of the polypeptide or to a substitution of amino acids by other amino acids Having similar properties (eg, acidic, basic, positively or negatively charged, polar or non-polar, etc.). ) such that the substitution of even critical amino acids does not reduce the activity of the peptide, (i.e., the ability of the peptide to penetrate the blood-brain barrier (BBB)).  Conservative substitution tables providing functionally similar amino acids are well known in the art.  For example, the following six groups each contain amino acids that are conservative substitutions for each other: 1) Alanine (A), Serine (S), Threonine (T); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine 5 (I), Leucine (L), Methionine (M), Valine (V); and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).  (See also Creighton, Proteins, W.  H.  Freeman and Company (1984), incorporated by reference in its entirety. In certain embodiments, individual substitutions, deletions, or additions that modify, add, or delete a single amino acid or a small percentage of amino acids may also be considered "conservative substitutions" if the change does not reduce not the activity of the peptide.  Insertions or deletions are generally in the range of about 1 to 5 amino acids.  The conservative amino acids can be selected based on the location of the amino acid to be substituted in the peptide, for example, whether the amino acid is on the outside of the peptide and exposed to the solvents, or on the inside and not exposed to solvents.  In alternative embodiments, the amino acid that will substitute an existing amino acid may be selected based on the location of the existing amino acid, i.e., its exposure to the solvents (e.g. that is, whether the amino acid is exposed to solvents or is present on the external surface of the peptide or polypeptide as compared to internally located amino acids not exposed to the solvents).  The choice of such conservative amino acid substitutions is well known in the art, for example as described in Dordo et al, J.  Mol Biol, 1999, 217, 721739 and Taylor et al. , J.  Theor.  Biol.  119 (1986); 205-218 and S.  French and B.  Robson, J.  Mol.  Evol.  19 (1983) 171.  Therefore, conservative amino acid substitutions suitable for amino acids on the outside of a protein or peptide (i.e., amino acids exposed to a solvent) can be selected. For example, but without limitation, the following substitutions may be used: substitution of Y by F, T by S or K, P by A, E by D or Q, N by D or G, R by K, G by N or A, T by S or K, D by N or E, I by L or V, F by Y, S by T or A, R by K, G by N or A, K by R, A by S, K or P.  In alternative embodiments, conservative amino acid substitutions may also be selected suitable for amino acids on the inside of a protein or peptide, for example, suitable conservative substitutions may be used. for amino acids on the inside of a protein or peptide (i.e. the amino acids are not exposed to a solvent), for example, but without limitation, the following conservative substitutions: where Y is substituted by F, T by A or S, I by L or V, W by Y, M by L, N by D, G by A, T by A or S, D by N, I by L or V, 20 F by Y or L, S by A or T and A by S, G, T or V.  In some embodiments, non-conservative amino acid substitutions are also encompassed within the term variants.  As used herein, an "antibody" refers to IgG, IgM, IgA, IgM1 or IgE molecules or antibody fragments specific for a human antigen. these (including, but not limited to, Fab, F (ab ') 2, Fv, disulfide bonded Fv, scFv, single domain antibody, closed conformation multispecific antibody, disulfide bonded scfv, diabody), it is derived from any species that naturally produces an antibody or is created by recombinant DNA technology; it is isolated from serum, B-lymphocytes, hybridomas, transfectomas, yeasts or bacteria.  Antibodies can be humanized using routine technology.  As described herein, an "antigen" is a molecule that is linked by a binding site to an antibody agent.  In general, the antigens are linked by antibody ligands and are capable of raising an antibody response in vivo.  An antigen may be a polypeptide, protein, nucleic acid or other molecule or part thereof.  The term "antigenic determinant" refers to an epitope on the antigen recognized by an antigen binding molecule, and more particularly, by the antigen binding site of said molecule.  As used herein, the term "antibody fragment" refers to a polypeptide that comprises at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and that specifically binds a given antigen.  An antibody fragment may comprise an antibody or a polypeptide comprising an antigen binding domain of an antibody.  In some embodiments, an antibody fragment may comprise a monoclonal antibody or a polypeptide comprising an antigen binding domain of a monoclonal antibody.  For example, an antibody may comprise a heavy chain variable region (H).  (abbreviated herein in VH), and a light chain variable region (L) (abbreviated herein in VL).  In another example, an antibody comprises two heavy chain variable regions (H) and two variable light chain regions (L).  The term "antibody fragment" encompasses antibody antigen binding fragments (e.g., single chain antibodies, Fab and sFab fragments, F (ab ') 2, Fd fragments, fragments). Fv, scFv, and single domain antibody fragments (dAb) (see, for example, Wildt et al. , Eur J.  3014695 Immunol.  1996; 26 (3): 629-39; which is incorporated by reference in this document in its entirety) as well as complete antibodies.  An antibody may have structural characters of IgA, IgG, IgE, IgD, IgM (as well as suf fi cates and combinations thereof).  The antibodies may be from any source, including a mouse, a rabbit, a pig, a rat, and a primate (human and non-human primate) and primatized antibodies.  Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like.  As used herein, "antibody variable domain" refers to the light and heavy chain portions of the antibody molecules that comprise the amino acid sequences of the complementarity determining regions (CDR; that is, CDR1, CDR2, and CDR3), and framework regions (FR).  VH refers to the variable domain of the heavy chain.  VL refers to the variable domain of the light chain.  According to the methods used in this invention, the amino acid positions attributed to CDRs and FRs can be defined according to Kabat (Sequences of Proteins of Immunological Interest (National Institutes of Health, Bethesda, Md. , 1987 and 1991)) or IMGT nomenclature.  Domain or region D refers to the domain or region of diversity of an antibody chain.  Domain or region J refers to the domain or region of junction of an antibody chain.  An "antibody gene segment", for example a VH gene segment, a D gene segment, or a JH gene segment refers to an oligonucleotide having a nucleic acid sequence that encodes that portion of the gene. an antibody, for example a VH gene segment is an oligonucleotide comprising a nucleic acid sequence which encodes a polypeptide VH domain.  The VH and VL regions can be further subdivided into hypervariability regions, called "complementarity determining regions" ("CDRs"), intercalated with regions that are more conserved, called "framework regions" ("FRs"). ).  The extent of the framework region and CDRs has been precisely defined (see IMGT or Kabat, E.  AT. , et al.  (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U. S.  Department of Health and Human Services, NIE 10 Publication No.  91-3242, and Chothia, C.  et al.  (1987) J.  Mol.  Biol.  196: 901-917; which are incorporated by reference in this document in their entirety).  Each VH and VL is generally composed of three CDRs and four FRs, arranged from the amino-terminus to the carboxy-terminal end in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 .  The terms "antigen binding fragment" or "antigen binding domain" which are used interchangeably herein are used to refer to one or more fragments of a full length antibody that retain the ability to specifically bind to a target of interest.  Examples of linker fragments encompassed within the term "antigen-binding fragment" of a full-length antibody include (i) an Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) an F (ab ') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al. (1989) Nature 341: 544-546; which is incorporated by reference in this document in its entirety), which consists of a VH or VL domain; and (vi) an isolated complementarity determining region (CDR) which retains the binding functionality of a specific antigen.  As used herein, the term "antibody binding site" refers to a polypeptide or domain that comprises one or more CDRs of an antibody and is capable of binding an antigen.  For example, the polypeptide comprises a CDR3 (e.g., HCDR3).  For example, the polypeptide comprises CDRs 1 and 2 (e.g., HCDR1 and 2) or CDRs 1 to 3 of a variable domain of an antibody (e.g., HCDR 1 to 3).  In one example, the binding site of an antibody is provided by a single variable domain (e.g., a VH or VL domain).  In another example, the binding site comprises a VH / VL pair or two or more of these pairs.  As used herein, the term "specific binding" refers to a chemical interaction between two molecules, compounds, cells and / or particles in which the first entity binds to the second, the target entity with a specificity. and a higher affinity to when it binds to a third entity that is not a target.  For example, in a diagnostic assay, specific binding of a ligand can distinguish between two variant PCSK9 proteins as described herein.  In some embodiments, specific binding may relate to an affinity of the first entity for the second target entity that is at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold at least 1000 times or more the affinity for the third entity that is not a target.  In the context of oligonucleotide strands that interact through hybridization, specific binding may be "specific hybridization".  In addition, and as described herein, a recombinant human / humanized antibody can be further optimized to decrease its potential immunogenicity, while maintaining its functional activity, for therapy in humans.  In this regard, functional activity means a polypeptide capable of having one or more known functional activities associated with a recombinant antibody or an antibody reagent thereof as described herein.  Such functional activities include, for example, the ability to bind to a target molecule.  The term "immunization" refers to the step or steps of administering one or more antigens to an animal such that antibodies can be raised in the animal.  In general, immunization comprises injection of the antigen or antigens into the animal.  Immunization may involve one or more administrations of the antigen or antigens.  Suitable methods are primary boost and RIMMS procedures as known to those skilled in the art.  As used herein, an "affibody" refers to a relatively small synthetic protein molecule that has a high binding affinity for a target protein (e.g., for PCSK9 or a variant thereof).  Fibodies are composed of a triple helix beam domain derived from the IgG binding domain of staphylococcal protein A.  The protein domain consists of a 58 amino acid sequence with 13 randomized amino acids producing a range of affinity variants.  In spite of being significantly smaller than an antibody (an affibody weighs.  about 6 kDa whereas an antibody commonly weighs about 150 kDa), an affibody molecule functions as an antibody since its binding site is approximately equivalent in surface area specific to the binding site of an antibody.  As used in this document, "VH3-23 * 04" refers to a human VH domain variant comprising the polyptide sequence of SEQ ID NO: 38.  In contrast to the reference sequence, VH3-23 * 04 has a valine residue in place of a leucine residue (see Figs. 3 and 4; L24V, the numbering comprising the signal sequence; valine in position 5 shown on Figure 4) as a consequence of the presence of SNP rs56069819 in the nucleic acid sequence encoding the VH domain.  As used herein, "rs56069819" refers to a mutation or variant in a VH gene segment of adenosine to cytosine (or thymine to guanine, depending on which DNA strand is read), producing the VH domain coding for VH3-23 * 04.  Rs56069819 is shown in Figure 4 and SEQ ID NO: 39, which demonstrate the T-> G mutation (it is noted that the dbSNP entry for RS5606819 represents the other strand, which includes the A-> C mutation).  Another description of VH3-23 * 04 can be found, for example, in US Patent Publication 2013/0071405; which is incorporated by reference in this document in its entirety.  As used in this document, "determined" or "determination" refers to verification, for example, by quantitative or qualitative analysis.  As used in this document, "has been determined" may refer to a verification on the basis of previously obtained information or information obtained simultaneously.  In some aspects of all the embodiments of the invention, the selection may include automation as a software program implemented by a computer that upon input of relevant data such as ethnicity or a panel of SNP data can make the determination based on the instructions presented in this document.  As used herein, "assay" refers to the estimation, evaluation, quantification, measurement or characterization of an analyte, for example, measurement of the level of an analyte in a sample. , identifying, an analyte, or detecting the presence or absence of an analyte in a sample.  In some embodiments, assay refers to the detection of the presence or absence of the analyte of interest.  In some embodiments, assay refers to the quantification of an amount of an analyte, for example, providing a measure of the concentration or degree of analyte abundance.  In some embodiments, assay refers to the enumeration of the number of analyte molecules present in a sample and / or a sample, for example, to determine the number of copies of an analyte.  As used herein, "multiplex" refers to carrying out a method or process simultaneously and in the same reaction vessel on two or more, typically three or more, different target sequences, for example on two or more isoforms of PCSK9, or on PCSK9 and an additional target.  Multiplex analysis typically includes analysis from 10 to 50; 10 to 100; 10 to 1000, 10 to 5000, 10 to 10,000 reactions in a multiplex format, such as a multiwell reaction, on a chip, or - multichannel.  Often the analysis or multiplex analysis is also automated using robotics and is usually performed by.  computer-based software and may include robotic manipulation of samples, automated or robotic selection of positive or negative results, search for -presence or lack of a target, such as a nucleic acid polymorphism or Protein variant The term "biological sample" or "test sample" as used herein refers to a sample taken or isolated from a biological organism, for example, a sample from a subject.  Examples of biological samples include, but are not limited to, a biological fluid sample; serum; plasma; urine; saliva; hair, epithelial cells, skin, tumor biopsy and / or tissue sample, etc.  The term also includes a mixture of the aforementioned samples.  The term "test sample" or "biological sample" also includes untreated or pretreated biological samples.  For nucleic acid analysis, the biological sample will generally have to comprise at least one cell comprising nucleic acids.  The test sample can be obtained by taking a sample of cells from a subject, but this can also be accomplished by using cells previously isolated (e.g., isolated at an earlier time point and isolated by the same person or another person).  In addition, the test sample may be a freshly drawn sample or a previously drawn, refrigerated, frozen or otherwise preserved sample. In some embodiments, the test sample may be an untreated test sample.  As used herein, the phrase "untreated test sample" refers to a test sample that has not undergone pre-treatment of any prior sample except for dilution and / or suspension in a solution.  Examples of methods for treating a test sample include, but are not limited to, centrifugation, filtration, sonication, homogenization, heating, freezing and thawing, and combinations thereof.  In some embodiments, the test sample may be a frozen test sample, for example, frozen tissue.  The frozen sample may be thawed before employing methods, methods of analysis and systems described herein.  After thawing, a frozen sample can be centrifuged before being subjected to methods, methods of analysis and systems described herein.  In some embodiments, the test sample is a clarified test sample, for example, by centrifugation and collection of a supernatant comprising the clarified test sample.  In some embodiments, a test sample may be a pretreated test sample, for example, a supernatant or a filtrate resulting from a treatment selected from the group consisting of centrifugation, filtration, thawing, purification, and all combinations thereof.  In some embodiments, the test sample may be treated with a chemical and / or biological reagent.  The chemical and / or biological reagents may be employed to protect and / or maintain the stability of the sample, including biomolecules (e.g., nucleic acid and protein) within, during treatment.  An example of a reagent is a protease inhibitor, which is generally used to protect or maintain protein stability during treatment.  Those skilled in the art will be well aware of the methods and methods.  suitable for pretreatment of biological samples required for the determination of the level of an expression product as described herein.  As used herein, "genotyping" refers to a method of determining the specific allelic composition of a cell and / or a subject at one or more positions within the genome, for example by determining the nucleic acid sequence at this position.  Genotyping refers to nucleic acid analysis and / or nucleic acid level analysis.  As used herein, "phenotyping" refers to a method of determining the identity and / or composition of an expression product of a cell and / or a subject, for example by determining the polypeptide sequence of an expression product.  Phenotyping refers to protein analysis and / or protein level analysis.  As used herein, the term "nucleic acid amplification" refers to the production of additional copies of a nucleic acid sequence and is generally performed using polymerase chain reaction technologies. (PCR) or ligase chain reaction (LCR) well known in the art (Dieffenbach, C.  W.  and G.  S.  Dveksler (1995) PCR Primer, Laboratory Manual, Cold Spring Harbor Press, Plainview, N.  Y. ).  Other amplification methods are also contemplated in aspects of the invention.  The term "allele-specific amplification" refers to a reaction (e.g., a PCR reaction) in which at least one of the primers (e.g., an allele-specific primer) is selected from an area gene polymorph (e.g., single nucleotide polymorphism), with the localized polymorphism at or near the 3 'end of the primer.  A mismatched primer will not initiate amplification, whereas a paired primer will initiate amplification.  The appearance of an amplification product indicates the presence of the polymorphism.  As used herein, "sequencing" refers to the determination of the exact order of the nucleotide bases in a DNA (deoxyribonucleic acid) or RNA (ribonucleic acid) strand or the exact order of the nucleotide bases. amino acid residues or peptides in a protein.  Nucleic acid sequencing can be accomplished using Sanger sequencing or next generation high throughput sequencing.  As used herein, "next generation sequencing" refers to oligonucleotide sequencing technologies that have the ability to sequence oligonucleotides at higher rates than are possible with traditional methods of sequencing (e.g. Sanger sequencing), by performing and reading thousands to millions of parallel sequencing reactions.  Non-limiting examples of next-generation sequencing methods / platforms include Massively Parallel Signature Sequencing (Lynx Therapeutics); 454 Pyro-sequencing (454 Life Sciences / Roche Diagnostics); reversible staining of the solid phase termination (Solexa / Illumina): SOLiD technology (Applied Biosystems); ionic semiconductor sequencing (ION Torrent); DNA nanoball sequencing (Complete Genomics); and technologies available from Pacific Biosciences, Intelligen Bio-systems, Oxford Nanopore 25 Technologies, and Helicos Biosciences.  Next generation sequencing technologies and the constraints and design parameters of the associated sequencing primers are well known in the art (see, for example, Shendure, et al. , "Next-geperation DNA sequencing," Nature, 2008, vol.  26, 30 No.  10, 1135-1145; Tuesdays, "The impact of next-generation sequencing technology on genetics," Trends in Genetics, 2007, vol.  24, No.  3, pp.  133-141; Su, et al. , "Next-generation sequencing and its applications in molecular diagnostics" 3014695 Expert Rev Mol Diagn, 2011, 11 (3): 333-43; Zhang et al. , "The impact of next-generation sequencing on genomics", J Genet Genomics, 2011, 38 (3): 95-109; (Nyren, P.  et al.  Anal Biochem 208: 17175 (1993); Bentley, D.  R.  Curr Opin Genet Dey 16: 545-52 (2006); Strausberg, R.  L. , et al.  Drug Disc Today 13: 569-77 (2008); US Patent No.  7,282,337; US Patent No.  7,279,563; US Patent No.  7,226,720; US Patent No.  7,220,549; US Patent No.  7,169,560; US Patent No.  6,818,395; US Patent No.  6,911,345; publications US 10 No.  2006/0252077; 2007/0070349; and 20070070349; which are incorporated by reference in this document in their entirety).  As used herein, "nucleic acid hybridization" refers to the pairing of complementary RNA and DNA strands as well as the pairing of complementary single strands of DNA.  In some embodiments, nucleic acid hybridization may refer to a method of determining a nucleic acid sequence and / or identity by hybridization of a nucleic acid sample with a probe, for example for example, Northern or Southern blot analysis or microarray analysis.  As used herein, the terms "treat", "treat", "treat" or "improve" refer to therapeutic treatments in which the object is to reverse, , to inhibit, slow down or stop the progression or severity of a condition associated with a disease or disorder.  The term "treatment" includes the reduction or relief of at least one adverse effect or symptom of a condition, disease or disorder.  Treatment is usually "effective" if one or more clinical symptoms or markers are reduced.  Alternatively, a treatment is "effective" if the progression of a disease is reduced or stopped.  That is, a "treatment" does not just include improving symptoms or markers, but.  also the cessation, or at least slowing down, of progression or worsening of symptoms compared to what would be expected in the absence of treatment.  Beneficial or desired clinical outcomes include, but are not limited to, relief of one or more symptoms, decreased extent of the disease, stabilization (i.e., not aggravation) of state of the disease, delay or slowdown in disease progression, improvement or palliation of the disease state, remission (whether partial or complete), and / or a decrease in mortality, it is detectable or undetectable.  The term "treatment" of a disease also includes the provision of relief with respect to the symptoms or side effects of the disease (including palliative treatment).  For a treatment to be effective, a complete cure is not considered.  The method may as well, in some aspects, include healing.  As used herein, the term "pharmaceutical composition" refers to the active agent in combination with a pharmaceutically acceptable carrier, for example, a carrier commonly used in the pharmaceutical industry.  The phrase "pharmaceutically acceptable" is used herein to refer to those compounds, materials, compositions and / or dosage forms that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and animals without excessive toxicity, irritation, allergic response or other problem or complication, proportional to a reasonable benefit / risk ratio.  As used herein, the term "administration" refers to the placement of a compound as described in this document in a subject by a method or a way that results in at least partial delivery of the agent at the level of the subject. a desired site.  Pharmaceutical compositions comprising the compounds described herein may be administered by any suitable route that results in effective treatment in the subject.  Multiple compositions can be administered separately or simultaneously.  Separate administration refers to the two compositions administered at different times, for example, spaced at least 10, 20, 30, or 10 to 60 minutes, or 1, 2, 3, 4, 5, 6, 7 apart. , 8, 9, 10, 12 hours.  It is also possible to administer compositions spaced 24 hours apart, or even spaced apart for a longer time.  Alternatively, two or more compositions may be administered simultaneously, for example, spaced less than 10 or less than 5 minutes apart.  Concomitantly administered compositions may, in some aspects, be administered as a mixture, with or without a time-release mechanism similar or different for each of the components.  As used herein, "contacting" refers to any means suitable for delivering, or exposing, an agent to at least one complex, enzyme, or cell.  Examples of delivery methods include, but are not limited to, direct delivery to the cell culture medium, infusion, injection, or other delivery method well known to those skilled in the art.  As used herein, "obtaining" refers to any method of acquiring, securing, procuring, or taking possession of, for example, a sample.  Obtaining a biological sample from a subject may include physically taking a sample from a subject (e.g., drawing blood, a hair sample, or saliva) without or with active participation of the subject; receiving a sample from a subject (for example, the subject collects a sample of saliva or hair by itself and the product, for example, in a container provided for that purpose); or procuring a sample from a storage facility, a medical facility, or a medical provider.  Obtaining from the human being or the subject refers to an active step, for example, of drawing blood or a tissue or cell sample.  As used herein, "cholesterol level" refers to a level of one or more of total cholesterol, LDL-cholesterol, HDL-cholesterol, and / or triglycerides.  Cholesterol levels can be the cholesterol level in a subject's blood.  As used herein with reference to cholesterol levels, "maintenance" refers to the action of preventing the rate from worsening (eg, increasing).  In some embodiments, maintaining a particular level relates to a method that results in the cholesterol level not increasing by more than 10% over time.  paintien can also relate to maintaining a previously achieved rate.  For example, if a human has been treated with statins, the cholesterol level achieved can be maintained by using statin therapy.  In some embodiments, the subject treated according to the methods described herein has previously had reduced cholesterol levels.  As used herein, "reduced before" indicates that at a previous time point the subject has experienced a decrease in cholesterol levels.  The decrease may be due to the administration of a pharmaceutical composition (for example, the administration of a composition as described in this document or of another composition, for example a statin) or due to another cause, for example a change in diet and / or exercise.  An existing treatment for high cholesterol levels is the administration of a statin.  As referred to herein, a "statin" (also known as HMG-CoA reductase inhibitor) is an inhibitor of the enzyme HMG-CoA reductase, which mediates the production of cholesterol in the body. liver.  Statins, by competitive binding of HMG-CoA reductase, prevent binding of HMG-CoA to the enzyme and thereby inhibit reductase activity (e.g., production of mevalonate).  Non-limiting examples of statins may include atorvastatin (LIPITORTM), fluvastatin (LESCOL ™), lovastatin (MEVACORTM, ALTOCORI ™), pitavastatin (LIVALO®, pravastatin (PRAVACHOL ™), rosuvastatin (CRESTORT ™), and simvastatin (ZOCORTm).  Statins may be administered in combination with other agents, for example the combination of ezetimibe and simvastatin.  Many subjects are, or become, resistant to statin therapy.  As used herein, "resistant to statin treatment" or "reduced reactivity to statin therapy" refers to a subject having a statistically significantly lower response to statin administration. 30 compared to a reference rate.  The reference rate may be, for example, the average response for a population of subjects or the rate of the individual subject at an earlier date.  A response to statin therapy is readily measured by those skilled in the art, for example, measurement of cholesterol levels, changes in cholesterol levels, and / or HMG-CoA reductase activity.  As used herein, the term "detectable marker" refers to a molecule or radical that can be detected, for example measured and / or determined to be present or absent.  Detectable labels may include, for example, a light-absorbing dye, a fluorescent dye, or a radioactive label.  Detectable labels, methods for detecting them, and methods for incorporating them into reagents (e.g., antibodies and nucleic acid probes) are well known in the art.  In some embodiments, the detectable markers may include markers that can be detected by spectroscopic, photochemical, biochemical, immunochemical, electromagnetic, radiochemical, or chemical means, such as fluorescence, chemofluorescence, or chemiluminescence, or any other appropriate way.  The detectable markers used in the methods described herein may be primary markers (where the label includes a moiety that is directly detectable or that produces a directly detectable moiety) or secondary markers (where the detectable marker binds to a label). Another radical to produce a detectable signal, for example, as is common in immunolabeling using secondary and tertiary antibodies).  The detectable label may be covalently or non-covalently bound to the reagent.  Alternatively, a detectable label may be linked as by direct labeling of a molecule that binds to the reagent via a ligand-receptor binding pair arrangement or other such specific recognition molecules. e.  Detectable labels may include, but are not limited to, radioisotopes, bioluminescent compounds, chromophores, antibodies, chemiluminescent compounds, fluorescent compounds, metal chelators, and enzymes.  In other embodiments, the detectable label may be a fluorescent compound.  When the fluorescent label is exposed to light of the correct wavelength, its presence can then be detected by fluorescence.  In some embodiments, a detectable label may be a fluorescent dye molecule, or a fluorophore thereof including, but not limited to, fluorescein, phycoerythrin, phycocyanin, o-phthaldehyde, fluorescamine, Cy3TM, CySTM, allophycocyanin, Texas red, peridinine, chlorophyll, cyanine, tandem conjugates such as phycoerythrin-Cy5TM, green fluorescent protein, rhodamine, fluorescein isothiocyanate (FITC) and Oregon GreenTM, rhodamine and its derivatives (e.g., Texas red and tetramethylamine rhodamine isothiocyanate (TRITC)), biotin, phycoerythrin, AMCA, CyDyesTM, 6-carboxyfluorescein (commonly known by the abbreviations FAM and F), 6-carboxy-2 ', 4', 7 ', 4,7-hexachlorofluorescein (HEX), 6-carboxy-4', 5'-dichloro-2 ', 7'-dimethoxyfluorescein (JOE or J), N N, N ', 11-tetramethyl-6-carboxy-rhodamine (TAMRA or T), 6-carboxy-X-rhodamine (ROX or R), 5-carbo xy-rhodamine-6G (R6G5 or G5), 6-carboxy-rhodamine-6G (R6G6 or G6), and rhodamine 110; cyanine dyes, for example Cy3, Cy5 and Cy7 dyes; coumarins, for example umbelliferone; benzimide dyes, for example Hoechst 33258; phenanthridine dyes, for example Texas red; dyes based on ethidium; acridine-based dyes; dyes to.  carbazole base; dyes based on phenoxazine; porphyrin-based dyes; polymethine dyes, for example cyanine dyes such as Cy3, Cy5, etc.  ; BODIPY dyes and quinoline dyes.  In some embodiments, a detectable label may be a radiolabel including, but not limited to, H, I, S, C, P, and P.  In some embodiments, a detectable label may be an enzyme including, but not limited to, horseradish peroxidase and alkaline phosphatase.  An enzyme label can produce, for example, a chemiluminescent signal, a color signal, or a fluorescent signal.  Enzymes contemplated for use as detectable markers may include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-V-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-VI-phosphate dehydrogenase, glucoamylase, and acetylcholinesterase.  In some embodiments, a detectable label is a chemiluminescent label, including, but not limited to, lucigenin, luminol, luciferin, isoluminol, theromatic acridinium ester, imidazole, sodium salt and the like. acridinium and an oxalate ester.  In some embodiments, a detectable label may be a spectral colorimetric marker including, but not limited to, colloidal gold or glass or colored plastic beads (eg, polystyrene, polypropylene, and latex).  In some embodiments, the reagents may also be labeled with a detectable label, such as cMyc, HA, VSV-G, HSV, FLAC, V5, HIS, or biotin.  Other detection systems.  can also be used, for example, a biotin-streptavidin system.  In this system, immunoreactive (i.e., specific) antibodies with the biomarker of interest are biotinylated.  The amount of biotinylated antibody bound to the biomarker is determined using a streptavidin-peroxidase conjugate and a chromogenic substrate.  Such streptavidin peroxidase detection kits are available commercially, for example from DAKO; Carpinteria, CA.  A reagent may also be detectably labeled using fluorescent emitting metals such as 152Eu, or others of the lanthanide series.  These metals can be attached to the reagents using these metal chelating groups such as diethylene triamine pentaacetic acid (DTPA) or ethylenediamine tetraacetic acid (EDTA).  15 As used in this document, "authorization number" or "marketing authorization number" refers to a number issued by a regulatory body through which the organization determines that a product and / or a composition In particular, the medical device may be marketed and / or offered for sale in the field under the jurisdiction of the body.  As used in this document, "regulator" refers to one of those bodies responsible for evaluating, for example, the safety and efficacy of a product and / or a composition and the control of sales / marketing of such products and / or compositions in a given field.  The Food and Drug Administration (FDA) in the United States and the European Medicines Agency (EMA) in Europe are two examples of these regulatory bodies.  Other non-limiting examples may include SDA, MPA, MHPRA, IMA, ANMAT, Hong Kong Department of Health-Drug Office, CDSCO, Medsafe, and KFDA.

As used herein, "injection device" refers to a device that is designed to perform injections, an injection comprising the steps of fluidically temporarily coupling the injection device with a person's tissue. , usually the subcutaneous tissue. An injection further comprises administering a quantity of liquid drug to the tissue and decoupling or removing the tissue injection device. In some embodiments, an injection device may be an intravenous device or rv device, which represents a type of injection device used when the target tissue is blood within the circulatory system, for example, blood in a blood vessel. vein. A common, but not limiting, example of an injection device is a needle and a syringe. As used herein, a "buffer" refers to a chemical agent that is capable of absorbing a certain amount of acid or base without undergoing strong variations in pH.

As used herein, "packaging" refers to how the components are organized and / or confined in a unit suitable for distribution and / or use. A package may include, for example, pouch boxes, syringes, ampoules, vials, tubes, double-shell type packaging, barriers and / or containers for maintaining sterility, labeling, etc. As used herein, "instructions" refers to a written, printed or graphic material display on the immediate container of an article, for example the written material displayed on a vial containing a pharmaceutically active agent, or details on the composition and use of a product of interest included in a kit 3014695 containing a composition of interest. The instructions present - the process. of treatment such. that envisaged to administer or to realize. As used herein, a "solid surface" refers to an object suitable for attachment of biomolecules. Non-limiting examples of a solid surface may include a particle (including, but not limited to, a ball or particle of agarose or latex or a magnetic particle), a ball, a nanoparticle, a polymer, a substrate , a slide, a coverslip, a plate, a box, a well, a membrane, and / or a grid. The solid surface may comprise many different materials including, but not limited to, polymers, plastics, resins, polysaccharides, silicon or silica materials, coal, metals, inorganic glasses, and the like. membranes. As used in this document, the "ranking" of a subject, for example, ranking the subject's ancestry, relates to the determination whether the subject has biological ancestors who are from a particular geographical area. , and, therefore, are likely to present particular genetic variants found in populations that historically occupied this area. The classification may include, for example, obtaining information about the family of the subject, questioning the subject or a family member about the ancestors of the biological family, and / or genetic analysis. Ranking can be done on the basis used for the 1000 Genome Project, as it will be familiar to the skilled person. In some embodiments, the subject may be classified as being of particular ancestry if at least the subject's genome comprises a substantial number of different alleles in common with other human beings of that ancestry (for example , determined with reference to the Project 1000 Genomes database), for example, at least 10, 20, 30, 40, 50 or 100 alleles in common or more. Abbreviations for particular groups of ancestry are provided in Table 3. The term "statistically significant" or "significantly" refers to statistical significance and generally means a difference of two standard deviations (2ET) or greater.

Other than in the practical examples, or where otherwise indicated, all numbers expressing amounts of components or reaction conditions used in this document should be understood to be modified in all cases by the term "about". The term "about", when used in connection with percentages, may mean ± 1%. As used herein, the term "comprising" or "comprising" is used with reference to respective compositions, methods, and one or more components thereof, which are essential to the process or composition but still open to inclusion of unspecified elements, whether essential or not. The term "consisting of" refers to respective compositions, processes, and components thereof as described herein, which are exclusive of any element not cited in this description of the embodiment. As used herein, the term "essentially consisting of" refers to those elements required for a given embodiment. The term allows the presence of elements that materially do not affect the basic and novel or functional features of this embodiment. The terms singular "one", "one", "the" and "the" include plural articles unless the context clearly indicates otherwise. Similarly, the word "or" is meant to include "and" unless the context clearly indicates otherwise. Although methods and materials similar or equivalent to those described herein may be used in the practice or method of analysis of this disclosure, suitable methods and materials are described below. The abbreviation "e.g." is derived from Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation "e.g." is synonymous with the term "for example." Definitions of common terms in cell biology and molecular biology can be found in The Merck Manual of Diagnosis and Therapy, 19th Edition, published by Merck Research Laboratories, 2006 (ISBN 0-91191019-0); Robert S. Porter et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); Benjamin Lewin, Gen. X, published by 20 Jones & Bartlett Publishing, 2009 (ISBN-10: 0763766321); Kendrew et al. (eds.), Molecular Biology and Biotechnology: Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8) and Current Protocols in Protein Sciences 2009, Wiley Interscience's, Coligan et al., eds .

Unless otherwise indicated, the present invention has been accomplished using conventional procedures, as described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual (4 ed.), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, USA (2012); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (1995); or Methods in Enzymology: Guide to Molecular Cloning Techniques Vol.15-, S. L. Berger and A. R. Kimmel Eds., Academic Press Inc., San Diego, USA (1987); Current Protocols in Protein Science (CPPS) (John E. Coligan, et al., Ed., John Wiley and Sons, Inc.), Current Protocols in Cell Biology (CPCB) (John S. Bonifacino et al., Ed., John Wiley and Sons, Inc.), and Culture of Animal Cells: A Manual of Basic Technique by R. Ian Freshney, Publisher: Wiley-Liss; 5th edition (2005), Animal Cell Culture Methods (Methods in Cell Biology, Vol 57, Jennie P. Mather and David Barnes editors, Academic Press, 1st edition, 1998), all of which are incorporated herein by reference in their entirety. . Other terms are defined in this document within the description of various aspects of the invention. All patents and all other publications; including references from the literature, and patents issued, published patent applications, and co-pending patent applications; Quoted throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in these publications that could be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of this application. Nothing in this regard shall be construed as an admission that the inventors are not entitled to backdate such disclosure under a prior invention or for any other reason. All statements as to the date or the representation that the contents of these documents are based on the information available to the applicants do not constitute any admission of the correctness of the dates or the content of those documents. The description of the embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure of the precise form disclosed. While specific embodiments, and examples, of the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, such as those of ordinary skill in the art. recognize him. For example, while the steps or functions of the methods are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially simultaneously. The disclosures provided in this document may be applicable to other procedures or processes as appropriate. The various embodiments described herein may be combined to provide alternative embodiments. Aspects of the disclosure may be modified, if necessary, to employ the compositions, functions and concepts of the references and the above application to further propose alternative embodiments of the disclosure. In addition, because of functional biological equivalence considerations, some changes can be made to the protein structure without affecting the biological or chemical action in type or quantity. These and other changes may be made to the disclosure in light of the detailed description. All of these modifications are intended to be included within the scope of the appended claims. Specific elements of any of the foregoing embodiments may be combined or substituted for elements in other embodiments. In addition, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also have such advantages, and not all embodiments have These benefits need not necessarily be present within the scope of the disclosure. It should be understood that particular configurations, aspects, examples, clauses, and embodiments described herein are presented by way of illustration and not as limitations of the invention. The main features of this invention may be employed in various embodiments without departing from the scope of the invention. Those skilled in the art will understand, or will be able to determine, by using no more than a routine study, many equivalents of the specific procedures described herein. Such equivalents are considered to be within this invention and are covered by the claims. All publications and patent applications mentioned in the specification are indicative of the level of expertise of those skilled in the art to which this invention belongs. All publications and patent applications are incorporated herein by reference to the same extent as if each individual publication or patent application was specifically and individually indicated as incorporated by reference. The use of the word "an" or "an" when used in conjunction with the term "comprising" in the claims and / or the brief may mean "a", "but it is also consistent with the meaning of "one or more", "at least one", and "one or more than one". The term "or" in the claims is used to mean "and / or" unless explicitly stated to relate only to variants or that the variants are mutually exclusive, although the disclosure supports a definition that relates only to variants. and to "and / or". In all, this request, the term "about" is used to indicate a value. includes the intrinsic error variation of the device, the method being used to determine the value, or the variation, that exists among the subjects of the study. As used in this specification and in one or more claims, the terms "comprising" (and any form of comprising, such as "include" and "include"), "having" (and any form of having, as " have "and" a ")," including "(and any form of including, such as" includes "and" include ") or" containing "(and any form of container, such as" contains "and" contains ") are inclusive or flexible and do not exclude additional process items and steps not mentioned. Any portion of this disclosure may be read in conjunction with any other part of the disclosure, unless it is otherwise clear from the context. All compositions and / or methods described and claimed herein may be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those skilled in the art that variations can be applied to the compositions and / or processes and in the steps or in the sequence of steps of the process described herein without departing from the concept, spirit and scope of the invention. All such substitutes and similar modifications evident to those skilled in the art are believed to lie within the spirit, scope and concept of the invention as defined by the appended claims. The present invention is described in more detail in the following non-limiting examples. The invention addresses the need to treat humans with naturally occurring alleles of PCSK9, rarer genotypes and 3014695 phenotypes (rarer forms of protein) that exist in their natural state. In this regard, the invention proposes the following aspects. In a first aspect: a method of reducing the level of cholesterol or maintaining previously reduced cholesterol level in a human being in need comprising a. selection of a human comprising (i) a nucleotide sequence of proprotein convertase subtilisin / kexin type 9 (PCSK9) selected from the group consisting of SEQ ID NO: 29 to 37; and / or (ii) a nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein; and B. administering to said human an antibody or antibody fragment that specifically binds one or more amino acid sequences of PCSK9 encoded by said nucleotide sequence understood by humans. In one example, step (a) comprises selecting a human comprising a PCSK9 protein encoded by the nucleotide sequence of (i) or (ii). In one example, the antibody or antibody fragment specifically binds said amino acid sequence of PCSK9. In one example, the antibody or antibody fragment binds a second PCSK9 protein comprising an amino acid sequence encoded by (i) a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 and / or (ii) a nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein. In one example, the antibody comprises a VH domain derived from the recombination of a human VH gene segment, a human D gene segment and a human JH gene segment, the VH gene segment comprising a nucleotide sequence which comprises a single nucleotide polymorphism with nucleotide C as indicated in rs56069819 (CTGTACCAAGCCTCCCCCAGACTCCA [A / C] CAGCTGCACCTCACACTGGACACCT) O. In one example, the VH gene segment is VH3-23 * 04 (SEQ ID NO: 38) encoded by a sequence comprising SEQ ID NO: 39. In one example, the antibody comprises a VH domain, wherein the VH domain comprises the sequence of the framework region 1 of SEQ ID NO: 40. for example, humans have been determined to comprise the nucleotide sequence of (i) and / or (ii). In one example, the human has been determined to comprise a variant protein of proprotein convertase subtilisin / kexin type 9 (PCSK9) encoded by the nucleotide sequence of (i) and / or (ii). In one example, the method further comprises the step of determining that the human comprises the nucleotide sequence of (i) and / or (ii). In one example, the determining step is performed prior to administering the antibody to humans. In one example, the method further comprises the step of determining that the human comprises a variant protein of proprotein convertase subtilisin / kexin type 9 (PCSK9) encoded by the nucleotide sequence of (i) and / or ii). In one example, the determination step is performed prior to administration of the antibody to humans. In one example, the determining step comprises analyzing a biological sample from humans for (i) a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37; and / or (ii) a nucleotide sequence encoding the catalytic domain or C-terminal domain of the variant PCSK9 protein. In one example, the assay includes contacting the biological sample with 30 c. at least one oligonucleotide probe comprising a sequence of at least 10 consecutive nucleotides that can hybridise specifically to and identify in the biological sample a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof, or which specifically hybridizes to an antisense sequence of said sequence, wherein said nucleic acid hybridizes to at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence thereby forming a complex when at least one nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least 10 the coding sequence for the catalytic domain or the C-terminal domain thereof is present; and / or d. at least one oligonucleotide probe comprising a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 or comprising an antisense sequence of said consecutive nucleotides, wherein said consecutive nucleotide sequence comprises at least one nucleotide present in said selected sequence that is not present in SEQ ID NO: 28 thereby forming a complex when a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 is present; and the detection of the presence or absence of the complex, wherein the detection of the presence of the complex determines that the human being comprises the variant protein of CSK9. In one example, the assay comprises amplification of the nucleic acid and optionally one or more methods selected from sequencing, next generation sequencing, nucleic acid hybridization, and allele specific amplification. In one example, the analysis is performed in a multiplex format. In one example, the method further comprises obtaining the biological sample from humans. In one example, said biological sample comprises serum, blood, stool, tissue, cell, urine and / or saliva of said human. In one example, said human being is or has been further determined to be substantially resistant to statin therapy. In one example, the human being receives or has received statin therapy or has reduced responsiveness to statin therapy. In one example, it is further administered to humans a statin. In one example, said antibody or antibody fragment and said statin are administered separately or simultaneously. In one example, said human is indicated as being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 and / or the nucleotide sequence thereof coding for the catalytic domain or C-domain. terminal of a PCSK9 protein. In one example, said human is further indicated as comprising the nucleotide sequence of SEQ ID NO: 28 and / or the coding sequence for the catalytic domain or C-terminal domain thereof. In one example, said human being is said to be homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37 and / or the coding sequence) for the catalytic domain or C-terminal domain of those -this. In one example, said human being has been diagnosed with at least one condition selected from a lipid disorder, a hyperlipoproteinemia, a hyperlipidemia a dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition. In one example, said method treats or prevents in said human at least one condition selected from a lipid disorder, hyperlipoproteinemia, hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, elevated blood pressure, and cardiovascular disease or condition.

Certain embodiments of the technology described herein may be defined in any of the following numbered paragraphs: 1.  A method of treating and / or preventing a proprotein convertase subtilisin / kexin type 9 (PCSK9) mediated disease or condition in a human which has been determined to comprise and / or selected as comprising a protein variant of PCSK9, the method comprising administering to humans a ligand that binds the variant PCSK9 protein to treat and / or prevent said disease or condition.  2.  The method according to paragraph 1, wherein said variant PCSK9 protein is selected from the group consisting of variant PCSK9 protein forms f, c, r, p, m, e, h, aj and q.  3.  The method according to paragraph 2, wherein the variant is mature PCSK9.  4.  The method according to paragraph 1, 2 or 3 further comprising analyzing a biological sample from humans for the form of the variant protein of PCSK9.  5.  A method of treating and / or preventing a disease or condition mediated by a variant protein of proprotein convertase subtilisin / kexin type 9 (PCSK9) encoded by (i) a nucleotide sequence selected from the group consisting of SEQ ID NO: 29-37; and / or (ii) a nucleotide sequence coding for the catalytic or C-terminal domain thereof in a human which has been determined to comprise and / or selected as comprising (i) the nucleotide sequence selected from group consisting of SEQ ID NO: 29 to 37; and / or (ii) the nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein, the method comprising administering to said human a ligand which binds said variant protein PCSK9 for treating and / or preventing said disease or condition.  6.  The method according to paragraph 5 further comprising analyzing a biological sample from human for (i) a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37; and / or (ii) a nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein.  7.  The method according to paragraph 6, wherein the assay comprises amplification of the nucleic acid and / or one or more methods selected from sequencing, next generation sequencing, nucleic acid hybridization, and amplification allele-specific.  8.  The method according to paragraph 6, wherein the analysis is performed in a multiplex format.  9.  The method of any one of paragraphs 1 to 8, further comprising obtaining the biological sample from humans.  10.  The method of any one of paragraphs 1 to 9, wherein said human has been further determined to be and / or selected to be substantially resistant to statin therapy of said disease or condition.  11.  The method of any one of paragraphs 1 to 10, wherein the ligand is selected from an antibody, an antibody portion, an antibody fragment or an affibody.  12.  The method according to paragraph 11, wherein the ligand is an antibody or an antibody fragment which specifically binds to a human PCSK9 selected from the f, c, m, e, h, p, q and aj forms, where the antibody or fragment comprises a VH domain derived from the recombination of a human VH gene segment, a human D gene segment and a human JH gene segment, wherein the VH gene segment comprises a sequence nucleotide which comprises the SNP rs56069819 (SEQ ID NO: 41).  13.  The ligand according to paragraph 12, wherein the VH gene segment is VH3-23 * 04.  14.  The method of any one of paragraphs 1 to 13, wherein said administration further comprises administering a statin to humans.  15.  The method of any one of paragraphs 1 to 14, wherein said ligand and said statin are administered separately or simultaneously.  20 16.  The method of any one of paragraphs 1 to 15 wherein said biological sample comprises serum, blood, stool, hair, tissue, cells, urine and / or saliva of said human .  17.  The method of any one of paragraphs 1 to 16, wherein said human is indicated as being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 and / or the nucleotide sequence thereof encoding a catalytic domain or a C-terminal domain of a PCSK9 protein.  18.  The method of any one of paragraphs 1 to 17, wherein said human is indicated as comprising the nucleotide sequence of SEQ ID NO: 28 and / or the coding sequence for the catalytic domain or C-terminal domain thereof. this.  19.  The method of any one of paragraphs 1 to 18, wherein said human is indicated as being homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 and / or the nucleotide sequence thereof. ci coding for a catalytic domain or a C-terminal domain of a PCSK2 protein.  20.  The method of any one of paragraphs 1 to 19, wherein said human is determined to comprise and / or selected as comprising: a.  SEQ ID NO: 29 and is classified as of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU, then the administration to said ligand which specifically binds said protein PCSK9 comprising a variant encoded by SEQ ID NO: b.  SEQ ID NO: 30 and is YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FINE or CEU, followed by administration to said human of a ligand which specifically binds said variant protein of PCSK9 comprising a variant encoded by SEQ ID NO: 30; or c.  SEQ ID NO: 32, and is classified as of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU, and then the administration to said human of a ligand that specifically binds said variant protein. PCSK9 comprising a variant encoded by SEQ ID NO: 32; or d.  SEQ ID NO: 33, and is classified as of LWK, ASW, YRI or CLM, then the administration to said human of a ligand that specifically binds said variant PCSK9 protein comprising a variant encoded by SEQ ID NO: 33; or e.  SEQ ID NO: 34, and is classified as of ancestry LWK, ASW or YRI, then the administration to said human being of a human of a variant of the 29; or classified as ASW ancestry, a ligand that specifically binds said variant PCSK9 protein comprising a variant encoded by SEQ ID NO: 34; or f.  SEQ ID NO: 35, and is classified as of PUR, TSI, FIN or CEU ancestry, then the administration to said human of a ligand that specifically binds said variant PCSK9 protein comprising a variant encoded by SEQ ID NO: 35; or g.  SEQ ID NO: 36, and is classified as of LWK, ASW or YRI, then the administration to said human of a ligand that specifically binds said variant PCSK9 protein comprising a variant encoded by SEQ ID NO: 36; or h.  SEQ ID NO: 37, and is classified as ancestry CHS, ASW, JPT, PUR or CHB, then the administration to said human of a ligand that specifically binds said variant protein of PCSK9 comprising a variant encoded by SEQ ID NO: 37  15 21.  The method of any one of paragraphs 1 to 19, wherein said human being is determined to comprise and / or selected as comprising: a.  PCSK9 protein f, and is classified as of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU, followed by the administration of a ligand which binds specifically said form of PCSK9 protein for a time and in an amount effective to treat and / or prevent said disease or condition in said human to treat and / or prevent said disease or condition in said human being; or b.  c-form of PCSK9 protein, and is classified as of ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FIN or CEU, and then the administration of a specifically binding ligand said form of PCSK9 protein for a time and in an amount effective to treat and / or prevent said disease or condition in said human, to treat and / or prevent in this manner said disease or condition in said human being; or 8 c.  the p-form of the protein, and is classified as of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU, and then the administration of a ligand which specifically binds said p-form of the PCSK9 protein for a time and in an amount effective to treat and / or prevent said disease or condition in said human to treat and / or prevent in this manner said disease or condition in said human; or d.  the m form of the protein, and is classified as of LWK, ASW, YRI or CLM, then the administration of a ligand which specifically binds said m form of the PCSK9 protein for a time and in an amount effective to treat and / or preventing said disease or condition in said human to treat and / or prevent in this manner said disease or condition in said human being; or e.  the e form of the protein, and is classified as of LWK, ASW or YRI descent, then the administration of a ligand that specifically binds said e form of the PCSK9 protein for a time and in an amount effective to treat and / or preventing said disease or condition in said human to treat and / or prevent in this manner said disease or condition in said human being; or f.  the h form of the protein, and is classified as of PUR ancestry ,.  TSI, FIN or CEU, then administering a ligand that specifically binds said h form of PCSK9 protein for a time and in an amount effective to treat and / or prevent said disease or condition in said human, to treat and / or thereby preventing said disease or condition in said human being; or g.  the form aj of the protein, and is classified as of LWK, ASW or YRI, then the administration of a ligand which specifically binds said AJ form of the PCSK9 protein for a time and in an amount effective to treat and / or preventing said disease or condition in said human to treat and / or prevent in this manner said disease or condition in said human being; or h.  the form q of the protein, and is classified as CHS, ASW, JPT, PUR or CHB, while administering a ligand that specifically binds said q form of PCSK9 protein for a time and in a quantity effective in treating and / or preventing said disease or condition in said human to treat and / or prevent said disease or condition in said human being.  22.  The method of any one of paragraphs 1 to 21, wherein said ligand is capable of specifically binding said variant PCSK9 protein or a nucleic acid encoding said variant PCSK9 protein.  23.  The method of any one of paragraphs 1 to 21, wherein said ligand specifically binds two or more human PCSK9 variant proteins or a fragment thereof selected from the group consisting of SEQ ID NOs: 4 to 27.  24.  The method according to paragraph 23, wherein said ligand specifically binds two or more human PCSK9 variant proteins or a fragment thereof, wherein at least one of the protein fragments comprises an amino acid sequence selected from SEQ ID NO: 4 to 14, 18 to 23, 26 and 27.  25.  The method of any one of paragraphs 4 and 6 to 23, wherein said human PCSK9 protein analyzed in said sample is in the mature form.  26.  The method according to any one of paragraphs 4 and 6 to 24, wherein said human PCSK9 protein analyzed in said sample is in the pro form form.  27.  The method of any one of paragraphs 1 to 26, wherein said disease or condition is selected from lipid disorder, hyperlipoproteinemia, hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, elevated blood pressure, and cardiovascular disease or condition.  28.  A kit for genotyping a proprotein convertase subtilisin / kexin type 9 (PCSK9) gene variant in a nucleic acid sample of a human being suffering or at risk of a PCSK9 mediated disease, the kit comprising a.  at least one nucleic acid probe comprising a sequence of at least 10 consecutive nucleotides which can hybridize specifically to and identify in a biological sample the presence of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 at 37 and the sequence thereof coding for the catalytic domain or the C-terminal domain of a PCSK9 protein, or can hybridize specifically to and identify in a biological sample the presence of an antisense sequence of said nucleotide sequence, wherein said nucleic acid probe is bridged to at least one nucleotide present in said selected sequence that is not present in SEQ ID NO: 28 all antisense sequence thereof; and / or b.  at least two nucleic acid probes comprising at least two sequences, each of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 or comprising an antisense sequence of said consecutive nucleotides, wherein at least one of the oligonucleotide probes comprises at least one nucleotide present in said selected nucleotide sequence that is not present in SEQ ID NO: 28 or an antisense sequence thereof, and c.  optionally, at least one of the following components: one or more buffers, a package, a label, and / or instructions for genotyping PCSK9 in a biological sample comprising nucleic acids obtained from a human.  29.  The kit according to paragraph 28, wherein the nucleic acid probe is attached to a solid surface.  10 30.  The kit of any one of paragraphs 28 and 29, further comprising a detectable label attached to said nucleic acid probe 31.  A kit for phenotyping protein proprotein convertase subtilisin / kexin type 9 (PCSK9) in a biological sample, the kit comprising a plurality of antibodies or portions or fragments of antibodies, wherein each antibody or fragment or part thereof antibody is specific for a PCSK9 variant protein selected from the group consisting of f, c, r, p, m, e, h, aq and q or a catalytic or C-terminal or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3; and optionally one or more of the following components: one or more buffers, a package and / or a label or instructions or a label for phenotyping PCSK9 in a biological sample comprising PCSK9 obtained from a human.  32.  The kit according to paragraph 31, further comprising a stative.  30 33.  A pharmaceutical composition comprising a ligand capable of binding specific variants of proprotein convertase subtilisin / kexin type 9 (PCSK9) selected from the group consisting of f, c, r, p, m, e, h, aj and q forms; a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 34.  The pharmaceutical composition according to paragraph 33, wherein the ligand is an antibody, a part of an antibody, a PCSK9 variant-specific antibody fragment or affibody selected from the group consisting of f, c, r , p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO : 1, 2 or 3.  35.  The pharmaceutical composition of any of paragraphs 33 and 34, further comprising a statin.  36.  The pharmaceutical composition of paragraph 35, wherein the statin is atorvastatin.  37.  A drug delivery system comprising the pharmaceutical composition according to paragraph 33 or 34 and an injection device or IV.  38.  A kit comprising the pharmaceutical composition according to paragraph 33, a package and instructions or a label for administering the ligand to a human suffering or at risk of a PCSK9 mediated disease or condition, wherein human expresses a variant protein form of PCSK9 selected from f, the group consisting of f, c, r, p, m, e, h, aq and q or a catalytic or C-terminal domain or a peptide of them.  39.  The kit according to paragraph 38, wherein the instructions or the label indicate the administration with a statin and / or to a human being which is indicated for a statin-based treatment or has received the administration of a statin or exhibits reduced reactivity to statin-based treatment.  40.  The kit according to paragraph 38 or 39, wherein the human has been determined to be and / or selected to be resistant to statin treatment.  41.  The kit according to paragraph 39 or 40, where the instructions or the label indicate the administration to a human being who has received a statin and further instruct to reduce the administration of the statin to humans.  42.  The kit according to paragraph 38, further comprising at least one buffer, package and / or instructions or tag for genotyping PCSK9 in a biological sample obtained from a human.  43.  The kit according to paragraph 38, where the label includes a marketing authorization number issued by a regulatory body.  15 44.  The kit according to paragraph 43, or the regulatory body is selected from the FDA or EMA.  45.  The kit according to paragraph 38, wherein the label or instructions further include instructions for administering alirocumab or evolocumab to said to be human.  46.  The kit of any one of paragraphs 38 to 445, further comprising an IV or injection device which optionally comprises alirocumab or evolocumab.  47.  A kit for the treatment and / or prevention of a proprotein convertase subtilisin / kexin type 9 (PCSK9) mediated disease or condition in a human being which has been determined to comprise and / or selected as comprising a variant protein of PCSK9, the kit comprising (a) alirocumab or evolocumab in a sealed container, and (b) a label of instructions indicating the administration of alirocumab or evolocumab to a human which expresses a form of PCSK9 variant protein selected from the group consisting of f, c, r, 3014695 p, m, e, h, aj and q or a catalytic or C-terminal or peptide domain of these.  48.  The kit according to paragraph 47, wherein the label further indicates that if the human being has received or is receiving the administration of a statin, treatment with statins should be continued.  49.  The kit according to paragraph 47, wherein the label further indicates that if the human being has received or is receiving statin administration, the statin therapy should be reduced or discontinued.  50.  A method of treating and / or preventing a proprotein convertase subtilisin / kexin type 9 (PCSK9) mediated disease or condition in a human, the method comprising: a.  analyzing a biological sample from humans for the presence of one or more variants of the PCSK9 protein selected from the group consisting of f, c, r, p, m, e, h, aj and q of PCSK9; and B.  administering a therapeutically effective amount of a human PCSK9-binding ligand to humans when one or more of PCSK9 f, c, r, p, m, e, h, aj and q forms are detected.  51.  The process according to paragraph 50, wherein the ligand binds one or more of the forms f, c, r, p, m, e, h, aj, and q of PCSK9.  52.  A method of treating and / or preventing a proprotein convertase subtilisin / kexin type 9 (PCSK9) mediated disease or condition in a human, the method comprising: a.  analyzing a biological sample from humans for the presence of one or more PSCK9 nucleic acid variants selected from the group consisting of SEQ ID NOS: 29-37 or at least one of the sequence encoding the catalytic domain or C-terminal domain thereof; and B.  administering a therapeutically effective amount of a human PCSK9-binding ligand to humans when one or more of the PCSK9 nucleic acid variants are detected.  53.  The method according to paragraph 52, wherein the ligand specifically binds one or more of the f, c, r, p, m, e, h, aq and q forms of PCSK9.  10 54.  A method of selecting a human for the treatment and / or prevention of a proprotein convertase subtilisin / kexin type 9 protein-mediated disease (PCSK9) with a human PCSK9 binding ligand comprising a.  analyzing a biological sample taken from humans for the presence of a variant of the PCSK9 protein selected from the group consisting of f, c, r, p, m, e, h, aj and q, and b.  selecting the human for treatment with the human PCSK9 binding ligand when at least one of the PCSK9 protein variants selected from the group consisting of f, c, r, p, m, e, h, aj and q is detected.  55.  The method according to paragraph 54, wherein the human is indicated for statin-based therapy or has been administered a statin.  25 56.  The method of paragraph 54 or 55, wherein the human has been identified as substantially resistant to statin therapy or has reduced reactivity to statin therapy.  57.  The method of any one of paragraphs 54 to 56, wherein the disease or condition is selected from a lipid disorder, a hyperlipoproteinemia, a hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition.  58.  The method of any one of paragraphs 54 to 57, wherein the administered human PCSK9 binding ligand is specific for the detected form of PCSK9.  59.  The method of any one of paragraphs 54 to 58, wherein said form of PCSK9 protein comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27.  60.  The method of any one of paragraphs 54 to 59, wherein said form of PCSK9 protein comprises the mature form of PCSK9.  15 61.  A test for the selection of a human suffering from a proprotein convertase subtilisin / kexin type 9 protein-mediated disease or condition (PCSK9) as eligible for treatment with a human PCSK9 binding ligand the process comprising 20 a.  contacting a biological sample from said human with at least one oligonucleotide probe comprising a sequence of at least 10 consecutive nucleotides that can hybridize to and identify in the biological sample a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or C-terminal domain thereof, or which specifically hybridizes to an antisense sequence of said sequence, wherein said nucleic acid is hybrid to at least one nucleotide present in said selected sequence that is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence, thereby forming a complex when at least one nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof is present; and / or b.  detecting the presence or absence of the complex; and c.  selection of humans as eligible for treatment with human PCSK9-binding ligand when the presence of at least one complex comprising a form of PCSK9 encoded by SEQ ID NOs: 29-37 or the coding sequence for the catalytic domain or the C-terminal domain thereof is detected.  62.  A test for the selection of a human being as eligible for treatment with human proprotein convertase subtilisin / kexin type 9 (PCSK9) binding ligand, the method comprising: a.  contacting a biological sample from a human suffering from a human PCSK9-mediated disease or condition with one or more antibodies, antibody portions or antibody fragments capable of binding to a variant form of PCSK9 selected from the group consisting of PCSK9 f, c, r, p, m, e, h, aj and q, thereby forming a complex when one or more of the forms f, c , r, Pr m, e, h, aj and q of PCSK9 are present; b.  detection of complex presence or absence; and c.  selection of humans as eligible for treatment with human PCSK9-binding ligand when the presence of at least one complex comprising the form f, c, r, P.  m, e, h, aj and q of the PCSK9 is detected.  63.  The test according to paragraph 61 or 62, wherein the disease or condition is selected from a lipid disorder, a hyperlipoproteinemia, a hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition.  64.  The assay according to any of paragraphs 61 to 63, wherein the human PSCK9 binding ligand is specific for the detected form of PCSK9.  65.  The assay according to any of paragraphs 61 to 64, further comprising amplifying the nucleic acids from the biological sample.  66.  The assay according to any one of paragraphs 61 to 65, further comprising isolating the nucleic acids from the biological sample.  67.  The assay according to any one of paragraphs 61 to 66, further comprising administering said PCSK9-binding ligand to said human.  68.  A method for producing a human anti-9 proprotein convertase subtilisin / kexin antibody binding site (PCSK9), the method comprising obtaining a plurality of anti-PCSK9 antibody binding sites, screening for antibody binding sites for human PCSK9 binding selected from the group consisting of f, c, r, p, m, e, h, aj and q forms or a catalytic or C-terminal domain or a peptide thereof which comprises amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and isolation of an antibody binding site which binds in the screening step, and optionally producing a PCSK9-binding fragment or derivative of the form f, c, r, p, m, e, h, aj or q of the isolated antibody.  69.  A method for producing an antiproprotein convertase subtilisin / kexin type 9 (PCSK9) antibody, the method comprising immunizing a non-human vertebrate with a human PCSK9 comprising an amino acid sequence selected from the group consisting of the amine sequences of the f, c, r, p, m, e, h, aq and q forms or a catalytic or C-terminal domain or a peptide thereof which comprises a variation of amino acid from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of an antibody that binds a human PCSK9 selected from the group consisting of f, c, r, p, m, e , h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3, and optionally the production a fragment or a derivative linking the form f, c, r, p, m, e, h, aj or q of the PCSK9 of the isolated antibody.  70.  The method according to paragraphs 68 and 69, wherein the non-human vertebrate is a mouse or a rat.  71.  The method of any one of paragraphs 68 to 70, comprising the step of obtaining a nucleic acid encoding the antibody, fragment, derivative or binding site and optionally the insertion of the acid nucleic acid in an expression vector.  72.  A kit for the genotyping of human proprotein convertase subtilisin / kexin type 9, x (PCSK9), wherein the kit comprises a nucleic acid (i) comprising a sequence of consecutive nucleotides which hybridises specifically to a sequence nucleotide selected from the group consisting of SEQ ID Nos. 29 to 37 or at least the coding sequence for the catalytic domain or C-terminal domain thereof, or specifically hybridizes to an antisense sequence or an RNA transcript. said sequence, wherein said sequence of consecutive nucleotides hybridizes to at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence or an RNA transcript of that -this ; and / or (ii) comprising a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ NO: 29 to 37 or comprising an antisense sequence or an RNA version of said consecutive nucleotides, wherein said sequence of consecutive nucleotides comprises at least one selected which is not 73.  A kit for nucleotide present in said sequence present in SEQ ID NO: 28.  genotyping or phenotyping of the human proprotein convertase subtilisin / kexin type 9 (PCSK9), wherein the kit comprises a ligand antibody that binds a human PCSK9 selected from the group consisting of f, c, r, p , m, e, h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 or an antibody, fragment or derivative produced by the process of any of paragraphs 68 to 71.  20 74.  A method of targeting a proprotein convertase subtilisin / kexin type 9 (PCSK9) for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human, the method comprising administering of an anti-PCSK9 ligand to a human being comprising a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37, whereby a PCSK9 encoded by said nucleotide sequence is targeted.  75.  The method according to paragraph 74, wherein the method comprises targeting a human PCSK9 selected from the group consisting of f, c ', r, p, m, e, h, aj and q with said ligand for treating and / or prevent said disease or condition in said human being.  76.  A method of treating and / or preventing a proprotein convertase subtilisin / kexin type 9 (PCSK9) mediated disease or condition in a human, the method comprising targeting a human PCSK9 selected in the a group consisting of the forms f, c, r, p, m, e, h, aj and q by administering to humans a ligand which binds said PCSK9, treating and / or preventing in this way said disease or affection in the human being.  77.  The method according to paragraph 76, wherein the human genome comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37.  78.  The method of any one of paragraphs 74 to 77, wherein the human has been or is genotyped as being positive for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the coding sequence for the catalytic or C-terminal domain thereof.  79.  The method of any one of paragraphs 74 to 78, wherein the human has been or is phenotyped to be positive for a human PCSK9 selected from the group consisting of f, c, r, p, m, e , h, aj and q.  80.  The method of any one of paragraphs 74 to 79, wherein the method comprises genotyping the human as a positive for a nucleotide sequence selected from the group consisting of SEQ ID NOs: 29-37 or the sequence coding for the catalytic or C-terminal domain thereof.  81.  The method of any one of paragraphs 74 to 80, wherein the method comprises phenotyping human as a positive for a human PCSK9 sequence selected from the group consisting of f, c, r, p, m, e, h, aj and 30 q.  82.  The method of any one of paragraphs 74 to 81, wherein the human has been or is genotyped as heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the coding sequence for the catalytic or C-terminal domain thereof; optionally wherein the human being has been or is genotyped as comprising the nucleotide sequence of SEQ ID NO: 28 or the coding sequence for the catalytic or C-terminal domain thereof and a nucleotide sequence selected from the group consisting of SEQ ID NO: 28 ID NO: 29-37 or the coding sequence for the catalytic or C-terminal domain thereof.  83.  The method of any one of paragraphs 74 to 82, wherein the genome of the human being has been or is genotyped as being homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the sequence coding for the catalytic or C-terminal domain thereof.  84.  The method of any one of paragraphs 74 to 83, wherein the method comprises genotyping the human for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or the coding sequence for the catalytic domain or C-terminal thereof prior to administration of the ligand to humans, wherein the ligand is determined to be capable of binding to a PCSK9 encoded by said selected sequence.  85.  The method of any one of paragraphs 74 to 84, further comprising administering said ligand and a statin (eg, atorvastatin) to humans.  86.  The process according to paragraph 85, wherein the ligand and the statin are administered separately.  87.  The process according to paragraph 85, wherein the ligand and the statin are administered simultaneously.  88.  The method of any one of paragraphs 74 to 87, wherein the ligand is administered by injection.  subcutaneous.  3 89.  A method of reducing cholesterol or maintaining cholesterol previously reduced in a human being in need comprising a.  selection of a human comprising (i) a nucleotide sequence of proprotein convertase subtilisin / kexin type 9 (PCSK9) selected from the group consisting of SEQ ID NOS: 29-37; and / or (ii) a nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein; and B.  administering to said human an antibody or an antibody fragment that specifically binds one or more amino acid sequences of PCSK9 encoded by said nucleotide sequence understood by humans.  90.  The method according to paragraph 89, wherein step (a ') comprises selecting a human comprising a PCSK9 protein encoded by the nucleotide sequence of (i) or (ii).  91.  The method according to paragraph 89 or 90, wherein the antibody or antibody fragment specifically binds to said amino acid sequence of PCSK9.  92.  The method according to paragraph 89 or 90, wherein the antibody or antibody fragment binds a second PCSK9 protein comprising an amino acid sequence encoded by (i) a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37; and / or (ii) a nucleotide sequence thereof coding for the catalytic domain or C-terminal domain of a PCSK9 protein.  93.  The method of paragraph 89 or 90, wherein the antibody comprises a VH domain derived from the recombination of a human VH gene segment, human D gene segments and a human JH gene segment, the segment VH gene comprising a nucleotide sequence which comprises a single nucleotide polymorphism with nucleotide C as set forth in rs56069819 (SEQ ID NO: 41).  94.  The method according to paragraph 93, wherein the VH gene segment is VH3-23 * 04.  5 95.  The method of any one of paragraphs 89 to 93, wherein the antibody comprises a VH domain, wherein the VH domain comprises the sequence of the framework region 1 of SEQ ID NO: 38.  96.  The method of any one of paragraphs 89 to 95, wherein the human has been determined to comprise the nucleotide sequence of (i) and / or (ii).  97.  The method of any one of paragraphs 89 to 96, wherein the human has been determined to comprise a variant protein of proprotein convertase subtilisin / kexin type 9 (PCSK9) encoded by the nucleotide sequence of (i) and / or (ii).  98.  The method of any one of paragraphs 89 to 97, comprising the step of determining that the human comprises the nucleotide sequence of (i) and / or (ii).  99.  The method according to paragraph 98, wherein the determining step is performed prior to administering the antibody to humans.  100.  The method of any one of paragraphs 89 to -99, comprising the step of determining that the tumor be comprises a variant protein of proprotein convertase subtilisin / kexin type 9 (PCSK9) encoded by the nucleotide sequence of i) and / or (ii).  101.  The method according to 100, wherein the determining step is performed prior to administering the antibody to humans.  102.  The method according to 100 or 101, wherein the step of determining comprises analyzing a biological sample from humans for (i) a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 at 37; and / or (ii) a nucleotide sequence encoding the catalytic domain or C-terminal domain of the variant PCSK9 protein.  5 103.  The method according to paragraph 102, wherein the analysis comprises contacting the biological sample with a.  at least one oligonucleotide probe comprising a sequence of at least 10 consecutive nucleotides which can hybridize specifically to and identify in the biological sample a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29 to 37 or at least a coding sequence for the catalytic domain or the C-terminal domain thereof, or which specifically hybridizes to an antisense sequence of said sequence, wherein said nucleic acid hybridizes to at least one nucleotide present in said selected sequence which n is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence, thereby forming a complex when at least one nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 or at least the sequence coding for the catalytic domain or the C-terminal domain thereof is present; and / or b.  at least one oligonucleotide probe comprising a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 37 or comprising an antisense sequence of said consecutive nucleotides, wherein said consecutive nucleotide sequence comprises at least one nucleotide present in said selected sequence that is not present in SEQ ID NO: 28, thereby forming a complex when a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37 is present; and detecting the presence or absence of the complex, wherein detecting the presence of the complex determines that the human comprises the variant protein of PCSK9.  104.  The method according to paragraph 102 or 103, wherein the assay comprises amplification of the nucleic acid and optionally one or more methods selected from sequencing, next generation sequencing, nucleic acid hybridization and hybridization allele-specific.  10 105.  The method of any one of paragraphs 102 to 104, wherein the analysis is performed in a multiplex format.  106.  The method of any one of paragraphs 102 to 105, further comprising obtaining the biological sample from humans.  107.  The method of any one of paragraphs 89 to 106, wherein said human is or has been further determined to be substantially resistant to statin therapy.  20 108.  The method of any one of paragraphs 89 to 107, wherein the human being receives or has received statin therapy or has reduced responsiveness to statin therapy.  109.  The method according to any one of claims 89 to 108, wherein the human being further receives the administration of a statin.  110.  The method of any one of paragraphs 89 to 108, wherein said antibody or antibody fragment and said statin are administered separately or simultaneously.  30 111.  The method of any one of paragraphs 106 to 110, wherein said biological sample comprises serum, blood, stool,. tissue, a cell, urine and / or saliva of said human being.  3014695 112.  The method of any one of paragraphs 89 to 111, wherein said human is indicated as being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 and / or the nucleotide sequence thereof. ci coding for the catalytic domain or the C-terminal domain of a PCSK9 protein.  113.  The method according to any one of paragraphs 89 to 112, wherein said human is further indicated as comprising the nucleotide sequence of SEQ ID NO: 28 and / or the coding sequence for the catalytic domain or the C-terminal domain of it.  114.  The method of any one of paragraphs 89 to 113, wherein said human is said to be homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 and / or the coding sequence for the catalytic domain or the C-terminal domain of these.  115.  The method of any one of paragraphs 89-114, wherein said human being has been diagnosed with at least one condition selected from lipid disorder, hyperlipoproteinemia, hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition.  116.  The method of any one of paragraphs 89 to 115, wherein said method treats or prevents in said human at least one condition selected from lipid disorder, hyperlipoproteinemia, hyperlipidemia; dyslipidemia; hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis, peripheral vascular disease, claudication, type II diabetes, high blood pressure, and cardiovascular disease or condition.  EXAMPLES Example 1 - Rare variants of PCSK9 The present invention provides anti-PCSK9 ligands; and ligands binding or targeting PCSK9 as described herein.  Ligands have a variety of utility.  Some of the ligands, for example, are useful in specific binding assays for human genotyping or phenotyping, affinity purification of PCSK9, particularly human PCSK9 or its ligands, and in assays for screening to identify other antagonists of PCSK9 activity.  Some of the ligands of the invention are useful for inhibition of PCSK9 binding to LDLR, or inhibition of PCSK9 mediated activities.  Anti-PCSK9 ligands (e.g., antibodies and antisense RNA) have been developed based on the targeting and neutralization of the so-called "wild type" human PCSK9, which is the existing form of common (See, for example, US20120093818A1 and US20110065902A1).  While such therapies are useful for human patients carrying this form of human PCSK9, the inventor has found it useful to study the possibility of targeting much rarer forms, but still existing in the natural state. , PCSK9 among human populations.  In this way, the inventor has an idea of the natural occurrences and distributions of the rarer forms of human PCSK9 that can serve as useful targets (at the protein or nucleic acid level) for treatment, prophylaxis and diagnosis of the relevant human being with diseases and conditions mediated by or associated with the activity of PCSK9.  This provides in particular personalized therapy, prophylaxis and diagnosis in humans who lack the current PCSK9 gene or protein (i.e., form a or such that used in US20120093818A1 and US20110065902A1 for generating antibodies).  Those skilled in the art will appreciate that SNPs or other changes that translate into amino acid variation may cause variability in the activity and / or conformation of human targets to be addressed.  This has generated great interest in personalized medicine where genotyping and knowledge of the variability of protein and nucleotides are used to more effectively personalize drugs and patients' diagnosis.  Therefore, the invention provides pharmaceutical agents and custom assays that specifically target more rare polymorphic variant forms of PCSK9.  Such forms or "alleles" (at the nucleotide level), in many of the examples determined by the inventor, include multiple nucleotide and amino acid changes from the nucleotide and amino acid sequences of the forms. Corresponding currents, that is, there are multiple, non-synonymous nucleotide changes that translate into multiple corresponding changes in the target protein in humans.  In addition, the inventor has surprisingly realized that the rarer natural forms, although present in humans at much lower frequencies than the common form, are nevertheless represented in multiple and diverse human populations of the ethnically and usually with many human examples 3014695 by represented ethnic population.  Thus, the inventor realized that targeting these more rare forms would provide efficient treatment, prophylaxis or diagnosis across many human ethnic populations, thereby extending the utility of the present invention.  With this realization, the inventor has realized that there is a significant industrial and medical application for the invention in terms of the choice of anti-PCSK9 ligand for administration to human patients for treatment and / or prophylaxis. diseases or conditions mediated by or associated with PCSK9.  In this way, the patient receives drugs and ligands that are personalized according to his needs, as determined by the genetic or phenotypic constitution of the patient.  In this context, the invention provides for the genotyping and / or phenotyping of patients in connection with such treatment, thereby permitting a proper match of the drug to the patient.  This increases the chances of medical efficacy, reduces the likelihood of inferior treatment by using medications or ligands that are not adequate to the patient (eg, poor efficacy and / or side effects) and avoids bad pharmaceutical prescription and waste.  In developing this thinking, in this non-limiting example, the present inventor has decided to determine a set of variants of human PCSK9 based on the following criteria, which are criteria that the inventor has imagined would provide drugs and medical diagnoses useful for a personalized need in the human population.  The inventor has selected variants having at least 3 of the following 4 criteria: - variants of PCSK9 having a cumulative frequency of a human allele in the range of 1 to 10%; 1 - variants of PCSK9 having a total frequency of a human genotype in the range of 1 to about 15%; variants of PCSK9 found in many ethnic-human populations (using the conventional categorization of the 1000 Genome Project, which is an accepted standard in the art, see Table 3 below); and - variants of PCSK9 found in many individuals distributed across these many different ethnic populations.  Based on these criteria, the inventor identified the variants listed in Table 1 below (excluding form a).  The selection of the inventor included, as a consideration, the selection of the nucleotide variation that produced amino acid variation in the corresponding forms of PCSK9 (i.e., non-synonymous variations), as opposed to silent variations that do not alter the amino acid residues in the target protein.  Table 1 - Variants of human PCSK9 distributed over several human populations and with a total human genotype frequency in the range of 1 to about 15% / amino acid susceptibility, distributions and frequencies in populations ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, END, CEU 0.0855 0.153 12 153 X 12 ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR , END, UEC 0.0729 0.1299 0.0081 (0.1377) 0.009 (0.0324) 0.0292 0.0234 43k: Noliame ations.  that sl - Freclukrée réguer, 0c. . ; -: he oni. 1. -:. . . . . . .  .  . .  .  .  :: - :: F3 var 137 ASW, GBR, TSI, CLM, JPT, PUR, IBS, END, CEU LWK, ASW, YRI, CLM 499 p 0.02 I, r 29 4 0.0225 '(G , 022) X 0.0441 (0.0441) 0.009 (0.16) 193 exx LWK, ASW, YRI 0.0135 (0.0135) 0.0068 hxx LWK, ASW, YRI 0.009 (0.009) ) 0.0045 aj X x PUR, TSI, FIN, 9 4 0.0081 (t, 0081) 0.0041 ECU qxx CHS, ASW, JPT, 0.0063 (0.0063) 0.0032 PUR, CHB Table notes "x" in a box indicates that the amino acid for the variant form is different from the amino acid at that position in the a form, the variant amino acid being presented in "Position and variation of the amino acid". "amino acid" of the table and the amino acid of the form a being presented in the first row of the table; the amino acids at all other positions of each variant form are identical to those found in the form a.  The numbering of amino acids is according to the numbering presented for the pro form in Table 2 below.  1.  Number of individuals in the database of 1000 Genomes found to carry the allele; 2.  Number of unique human ethnic populations in the database of 1000 Genomes in which the allele appeared 3.  Frequency of a heterozygous human genotype, i.e., the cumulative frequency of all genotypes with one occurrence of the variant allele and an occurrence of another allele (heterozygous state), for example, the genotype ac in the database of 1000 Genomes; 4.  Frequency of a homozygous human genotype, i.e., the cumulative frequency of.  two occurrences of the variant allele (homozygous state), for example, the cc genotype in the 1000 Genomes database; and 5.  Total frequency of an huMain genotype, i.e., the total frequencies of a human genotype 2'a heterozygous more homozygous.  6.  Cumulative frequency of a human allele from all occurrences of the variant allele in the 1000 Genome database.  Form a 'is identical to form a except that form a' has glycine (G) in position 620 (see US20120093818 (Amgen, Inc)); the form has an E at this level.  (B) Vatiations of the nucleotide sequence of selected alleles 443T 4 4 ::: 4V 61: 9P:. 5b50564J Read:. . ) 056 8 1 55'523855 1 55524 37 1 55527222 55529187- A to Vâtia n: ng4 pvpoD, vme d 1. ,. ,. The number of the variant of the variant is corrected by the number of rs. 802 195 "x" in a box indicates that a variant allele includes the non-synonymous variation of the nucleotide indicated in the 5th row.  Notes to Table 5 1. 'The notation is the chromosome number (all positions are on human chromosome 1): coordinate number (Ensembl version 73 -September 2013, genome assembly GRCn37 (GCA_000001405,13); 2.  Nucleotide change (compared to the nucleotide of the allele presented in the first row) giving rise to an amino acid change in the variant form (compared to the amino acid of the allele a); and 3.  NCBI reference number dbSNP (NCBI dbSNP Build 138 released 25 April 2013).  Table 2 - Sequences (a) Amino acid sequence of the.  form a of human PCSK9 (SEQ ID NO: - "Pro-form" with signal sequence 53 M G TVSSR RSMV PL PL LL LLL LL LG PA G A RA. QEDEDGDYEELVLALRSEEDGLAEA PE EGT TA FHRCAKDP WELP GT YV * TvTL KE AND HL QSE RTAPPLgAQAARRG YLTKI LEV EFIG LL PGFLVKMSG DLLELAL KL PH VDYLEEDSSVEAQsipwnleritppryiradeyqppdggshievOldtsiqsdhreiegremedfenvpeed gtrfhrgaskcdshg thJà ,, p. rs.  grdagvegasinrstrvincqgievsgtligWfirkseqpvgplv) A pdaggys: rtilnaac: qrlaràgvvlvtaagnfrddacly Spasa pevitvgatagdqpvtlgtIginfgrcvdifapgediigassOcstcfvsgsgtsqqaahvagiaaminisaëp eleaeh griinsak-42S 443 474 daleavifpecignAtpnlvealppsthGAGVVQLFCRTVWSAFISGPTRMATAIARCAPDE ELISCSSFSRSGKRRGERM EAn: GGKLVCRAH NAFGGEGVYA1 AR CCULPOANCSVHTAPPAEASMGTRVHCH QQGHVILTGOESHWEVEDLGT 519 520 HKPPVIRPRG PN QCVG EAS1 H R H CC. HAPGLEC KEHGIP. APQEQVTVAC EEGINTLTGCSALPGTSHV GAY 6. 70 AVD N TCVVR SR DVSTTG STSEEAVTAVAI CCRSR H LAQASQELQ Italic - signal sequence 1-30 Courier = pro-peptide 31-152 lowercase - catalytic domain 153-449 197 CAPS = C-terminal domain 450-692 underlined = residues changed from l Allele a in other sequences (numbers of residues aa shown) The pro form is the sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1.  The mature form is the sequence of amino acid number 153 through (and including :) amino acid number 692 of SEQ ID NO: 1.  (B) Amino acid sequence of form a of human PCSK9 (SEQ ID NO: 3) - "Mature form" (The numbering and notation according to SEQ ID NO: 1 above have been retained) sipw nientppryradeyq ppdgg sivevyi here tsid sdhre ieg rvnivt envpee dgtrfh mas. kcds hg thug rd a gvakgas m rsi nc qgkgtvs glef rksq ivq pvg pkiviip! g g vi vi vi vi vi sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa sa. d p p iga iga iga iga 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 42 G'r. (A RCOEL P QAN CSVH TA PPA EAS M GT RVH CH: QG HV LT GCSS HW EV EDLG T 51g 620 H KPPVLR PRGQPN QCVGH R EKS1 HA C CHAPGL KVKEHG 'PAPQEQVTVACEEGWTLTGCSALPGTSHVLGAY 570 AVD N TC \ AIRS R DVS GSTSE EAVTAVA1 CCR SR H LAQASQE LQ: 198 (c) Nucleotide sequence of human PCSK9 allele a (SEQ ID NO: 28) - Coding for "Pro-form" plus ATGG signal sequence <; C4a7GTC4GCTCCAGGCSGTCCTGGTGGCV; CTGaACTGCTGCrGCTGCTG CFGCTGCFCCTGGS TC eEt <Girà CrT. ## STR2 ## ATC CAC. ° ee'ECT: Ce: Ce; C CGC TGG T GGAGGTTGCCT CACCTAC-TGGTG SAME "GAAGGAGGAG ACCCACC T CTC CAGT CAGAGCG CACT cG c 0G0CTGCAGGC0C.AGGCTGCCCG CC G GG GATACCT CA0U; GCAT AG AT CGT GTCTTCC ATCGCCTT = TCCIGGCrrCCTWTZAAGATGAerGGCGACCT WTGGACCZGGCCTTGAAGTTGCCC-CAT, GmCGACTACATCAGGAGGA: Cr0CTCTGTCT.TTGOECAGegcetcc .. : cgt.ggeecctggegemetaccertece cfgt.ie.::>ganggceg e tge Ex: au: cc cep cggeggcauttgeggagegta tcteeta ga ce cc au a cege gtga ccguaa etr.::g3ggesagggtcatggt.cac cg dtegag egtg eecg e gga ggecggge cccgettec e ce this gpc egc.a agtg tee cagtce gcacc tg agg ,,, ggtgiec..eug.geegggegcesscgtggeeeiegg.gtgccagcege: gcegeetgcgcgtetca erlg cceeggg eagggcacggenegee cec teeten-c C tpettattcggaaeaecageggtc (agimteggggcc; 3ctutggtgctetgcexct cz gcg g-3 gccgcgtc (tca acgcceictg:, ' - ;. 3.g, tgcctggc.gagg, gc ggg 1: cge tetgetextgctec ggc aa cttcegge g atge cdgcrtc tecieccc ge tceetcccg eg gtea teacegitg ggcc ace; eg agagec gecete ccctgggge ttggsg En cntegccentegg ectetttgcc c guegga ateattutgc eeezigcga c cageacttg eragteca cagegtge, gacebseaggetgel ,, gereeettggetggeettgeegceatgab, gcteetgecgagergggegttgaggcagagaetg 199 N4.2M, MI to MeeaT GO: to eka: tCr.:Crtegetaeagegtue rttegge: ctlggttcertg'ageae.agegggtactgacccozacrtggtggcqactcm; c-c. has accc: etGGGGCAGGTTGGCAGCTGTTTTGCAGGACTGTATGGTCAGCACACTCGGGGCCTACACGGATnGrC w7-4vAnà, G,: m ACAGCCA, TCGCCCGCTGCGCCCCAGATGAGGAGCTGLTGAGCTGCTCCAGTTTCTCCAGGAGTGGGMGCGG CGGGGCGAGCGCATGGAGGCCCMGGGGGCAAGCTGGTCTGCCGGGCCCACAACGCTTTTGGGGGTGA, GG G G TGTC TACGCCATT CCAGGTGCIGCCTGCTACCCCAGGCCAACTGCAGCGTC CACACAGCTCCACCAGCTGA G CCAGCATGGGGACCCGTGTC CACTGCCACCAACAGGGC CACGTCCTCACAGGCTGCAGCTCCCACTGGGA GGTGGAGGACCTTGGCACCCACMGC (1: GCCTGTGCTGAGGCCACGAGGTCAGCCCAACCAGTGCGTGGGCC AC: AG GGAGGC CAGCATCCACGCTTC CTG CTGCCATGCCCCAGGTCTGGAATGCMA, GTCAAGGAGCATGGAA 'afflK.AGàZMUMGG, MAG, TCCCGGCCCCTCAGGAGCAGGTGACCGTGGCCTQCGAGGAGGGCTGGACCCTGAUGGCTGCAGTGCCCTCC CTGGGACCTCCCACGTCCTGGGGGCCTACGCCGTAGACAACACGTGTGÎAGTCAGGAGCCGGGACGTCAGCA Ei; MG G ACAGGCAGCACCAGCGAAGAGGCCGTGACAGC C GT C-MC ATCTG GGAGCCGGCACC CCC TGG C GC AG GCCIT.CCAGGAGUTCAGTGAC Italics = nucleotide sequence encoding the signal sequence (nucleotides 1-90) = Courier nucleotide sequence coding for the propeptide (nucleotides 91-456) minus cules = nucleotide sequence coding for the catalytic domain (nucleotides 457-1346) 5 CAPS = nucleotide sequence coding for the C-terminal domain (nucleotides 1347-2076) Underlined = allelic variations from the? allele in other sequences ( aa residue number changes and codon changes shown) The pro-form is encoded by the nucleotide sequence of nucleotide 91 to (and including) nucleotide 2076. 200 The mature form is encoded by the nucleotide sequence of nucleotide 457 up to (and including) nucleotide 2076. Nucleotide sequences of variant alleles Thus, (i) The nucleotide sequence of the f allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the allele: f comprises a GTC codon in place of an ATC codon at the position labeled "I474V" in SEQ ID NO: 28 (ii) The nucleotide sequence of the c allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the c allele comprises a GGG codon in place of a GAG codon 10 at the position labeled "E670G" in SEQ ID NO: 28; (iii) The nucleotide sequence of the r allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the r allele comprises a GTC codon in place of an ATC codon at the position labeled "I474V" in SEQ ID NO: 28; and a GGG codon in place of a GAG codon at the position labeled "E670V" in SEQ ID NO: 28; (iv) The nucleotide sequence of the p allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the p allele comprises a GTC codon in place of a GCC codon at the position labeled "A53V" in SEQ ID NO: 28; and a GTC codon in place of an ATC codon at the position labeled "I474V" in SEQ ID NO: 28; (v) The nucleotide sequence of the m allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the m-allele comprises an ACC codon in place of a GCC codon at the labeled position " A443T "in SEQ ID NO: 28; (vi) The nucleotide sequence of the e allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the e allele comprises an AGT codon in place of an AAT codon at the position labeled "N425S in SEQ ID NO: 28; and a GTC codon in place of an ATC codon at the position labeled "I474V" in SEQ ID NO: 28; (vii) The nucleotide sequence of the h allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the h allele comprises an ACC codon in place of a GCC codon at the position labeled "A443T" in SEQ ID NO: 28; and a CCG codon in place of a CAG codon at the position labeled "Q619P" in SEQ ID NO: 28; (viii) The nucleotide sequence of the? 1 allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the? 1 allele comprises a CTT codon in place of a CGT codon at the position labeled "R46L" in SEQ ID NO: 28; and a GTC codon in place of an ATC codon at the position labeled "I474V" in SEQ ID NO: 28; and (ix) The nucleotide sequence of the q allele is identical to SEQ ID NO: 28 except that the nucleotide sequence of the q allele comprises a GTC codon in place of a GCC codon at the position marked "A53V in SEQ ID NO: 28; and a GGG codon in place of a GAG codon at the position labeled "E670G" in SEQ ID NO: 28. Amino acid sequences of variant pro-forms (the numbering is according to SEQ ID NO: 1 cited above) (A) The amino acid sequence of the form f is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1i except that the amino acid sequence of the form f comprises a valine at position 474; (B) The amino acid sequence of form c is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of form c comprises glycine at position 670; (C) The amino acid sequence of the r-form is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of 3 SEQ ID NO: 1 except that the amino acid sequence of the r-form includes a valine at position 474 and a glycine at position 670; (D) The amino acid sequence of the p-form is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of the p-form comprises valine at position 53 and valine at position 474 (E). The amino acid sequence of the form m is identical to the amino acid sequence of the amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of form m comprises threonine at position 443; (F) The amino acid sequence of form e is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of form e comprises a serine at position 425 and a valine at position 474; (G) The amino acid sequence of form h is identical to the amino acid sequence of amino acid 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of the h-form comprises a threonine at position 443 and a proline at position 619; (H) The amino acid sequence of the α1 form is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID 0: 1 except that the amino acid sequence of the form aj comprises a leucine at position 46 and a valine at position 474; and (I) The amino acid sequence of the form q is identical to the amino acid sequence of amino acid number 31 to (and including) amino acid number 692 of SEQ ID NO: 1 except that the amino acid sequence of the form q comprises a valine in position 53 and a glycine at position 670. Amino acid sequences of the variant mature forms (the numbering is according to SEQ ID NO: 1 cited above) ( A ') The amino acid sequence of the form f is identical to SEQ ID NO: 2 except that the amino acid sequence of the form f comprises a valine at position 474; (B ') The amino acid sequence of form c is identical to SEQ ID NO: 2 except that the amino acid sequence of form c comprises a glycine at position 670; (C ') The amino acid sequence of the form r is identical to SEQ ID NO: 2 except that the amino acid sequence of the form r comprises a valine at position 474 and a glycine at position 670 (D' The amino acid sequence of the p-form is identical to SEQ ID NO: 2 except that the amino acid sequence of the p-form comprises a valine at position 474; (E ') The amino acid sequence of the form m is identical to SEQ ID NO: 2 except that the amino acid sequence of the form m comprises a threonine at position 443; (F ') The amino acid sequence of the form e is identical to SEQ ID NO: 2 except that the amino acid sequence of the form e comprises a serine at position 425 and a valine at position 474; (G ') The amino acid sequence of form h is identical to SEQ ID NO: 2 except that the amino acid sequence of form h comprises threonine at position 443 and proline at position 619; The amino acid sequence of the α1 form is identical to SEQ ID NQ: 2 except that the amino acid sequence of the α1 form comprises a valine at position 474; and (I ') The amino acid sequence of the form q is identical to SEQ ID NO: 2 except that the amino acid sequence of the form q comprises a glycine at position 670. The mature form of p is identical to the mature form of f and j- The mature form of c is identical to the mature form of another sequence analysis and in silico 3D modeling (see Figure 1) revealed that the selected variants also fulfilled the additional selection criteria following: - variants of PCSK9 whose variant amino acid residues (against the common form of human PCSK9) are found in the mature form of the target (i.e. domain); and variants of PCSK9 whose variant amino acid residues (against the current form of human PCSK9) are exposed to the surface on the target, which the inventor saw as determining the topography of the target and as potentially contributing to how and where ligand binding to the target occurs.

As shown in Figure 1, the identified positions 425, 443, 474, 619 and 670 (found in the selected variants of the invention) are all exposed at the surface and outside the pro-domain. The 425 and 443 positions of the variants are exposed at the surface on the catalytic domain, while the 474, 619 and 670 positions of the variants are exposed at the surface on the C-terminal domain. Thus, the inventor has applied the new selection criteria to determine variant to rare forms of human PCSK9, realizing the utility of their nucleotide and amino acid sequences in various configurations, various aspects, various clauses. , the various embodiments and the various examples of the invention in this document, and in this way proposing new personalized medical and diagnostic applications as described above. Adaptation of antibodies to the rare variant profile of PCSK9 The invention includes the possibility of customizing the treatment of humans by further selecting antibody-based ligands with variable domains based on gene segments commonly found in humans. humans of the ethnic populations where variant forms of PCSK9 are found to satisfy the selection criteria of the invention. An example is provided below for ligands comprising VH antibody domains derived from human VH3-23 recombination. The inventor analyzed the frequencies and distribution of various human VH3-23 alleles and realized the desirability of using ligands based on human VH3-23 alleles including SNP rs56069819. This SNP corresponds to a leucine change at position 24 in the protein sequence encoded at a valine at this position (L24V change) and the SNP is located at coordinate 106725482 on human chromosome 14. Figure 2 shows the cumulative frequency distribution of alleles through the Project 1000 Genomes database of human VH3-23 alleles including SNP rs56069819 (such alleles being indicated by 'C' and the most common allele (which does not understand this SNP) being indicated by 'A'). The figure shows that the VH3-23 alleles including the SNP rs56069819 are present at a cumulative frequency of 11% across all human ethnic populations taken as a whole, while in some specific human ethnic subpopulations (ASW, LWK , YRI, CEU and GBR), such alleles are present at a higher than average cumulative frequency. As shown in the figure, these variant forms of human PCSK9 (labeled "Variants") which are found in the various subpopulations with a higher than average occurrence of human VH3-23 alleles including SNP rs56069819. Table 6 shows the VH3-23 variants and SNPs they include, as well as their cumulative frequencies of alleles as found in the Project 1000 Genomes database. Notably, human VH3-23 alleles including SNP rs56069819 were found in the CEU population at a frequency that is almost double the frequency of 11% for all populations. For the ASW and YRI populations, the frequency was higher in a quarter of the population. Thus, the invention advantageously selects a ligand comprising an antibody or an antibody fragment, wherein the antibody or fragment comprises a VH domain derived from the recombination of a human VH gene segment, a human D gene segment and a human JH gene segment, the human VH gene segment comprising a nucleotide sequence which comprises the SNP rs56069819 (numbering -dbSNP, construction number as cited above). In one example, the treatment can be further personalized by selecting a ligand that specifically binds to a human PCSK9 selected from among the f, c, m, e, h, p, q and aj forms, these forms being those appearing in FIGS. human populations ASW, LWK, YRI, CEU and GBR.

In one example, the VH gene segment is VH3-23 * 04, which is a commonly found variant that includes the SNP rs56069819 in human populations ASW, LWK, YRI, CEU and GBR.

In one example, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human expressing a human PCSK9 selected from the forms: f, c, m, e, h, p, q and acted. In one example, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human of ASW, LWK, YRI, CEU or GBR. In one embodiment, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human of ASW ancestry, where the human expresses a PCSK9 selected among f, c, m, e, h, p and q or the human comprises a corresponding nucleotide or amino acid sequence shown in Table 5. Optionally, this ligand comprises a V H domain derived from the recombination of Human VH3-23 * 04. In one embodiment, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human of LWK ancestry, where the human expresses a PCSK9 selected among f, c, 25 e and h or the human comprises a corresponding nucleotide or amino acid sequence shown in Table 5. Optionally, this ligand comprises a domain. VH derived from the recombination of human VH3-23 * 04. In one embodiment, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human of YRI origin, where the human expresses a PCSK9 selected among f, c, m, e and h or the human comprises a corresponding nucleotide or amino acid sequence shown in Table 5. Optionally, this ligand comprises a VH domain derived from the recombination of VH3-23 * 04 human. In one embodiment, the ligand is for the treatment and / or prevention of a PCSK9-mediated disease, condition, or disease in a human of CEU ancestry, or the human expresses a PCSK9 selected from f, c, p and aj or the human comprises a corresponding nucleotide or amino acid sequence shown in Table 5.

Optionally, this ligand comprises a VH domain derived from the recombination of human VH3-23 * 04. In one embodiment, the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human of GBR ancestry, wherein the human expresses a PCSK9 selected among f, c and p or the human expresses a PCSK9 selected from f, c, p and aj or the human comprises a corresponding nucleotide or amino acid sequence shown in Table 5. Optionally, this ligand comprises a VH domain derived from the recombination of human VH3-23 * 04. In one example, the ligand is alirocumab. References The references cited herein are incorporated by reference in their entirety. 1) Horton et al., Trends Biochem Sci.

2007 Feb; 32 (2): 71- 7. Epub 2007 Jan 9, Molecular biology of PCSK9: its role in LDL metabolism. 2) Seidah and Prat, J Mol Med (Berl).

2007 Jul; 85 (7): 685-96. Epub 2007 Mar 10, The Proprotein Convertases Are Potential Targets in the Treatment of Dyslipidemia. 3) Benjannet et al., J Biol Chem.

2004 Nov. 19; 279 (47): 48865-75. Epub 2004 Sep 9, NARC-1 / PCSK9 and its natural mutants: Zymogen cleavage and effects on the low density lipoprotein (LDL) receptor and LDL cholesterol. 4) Lagace et al., J Clin Invest.

Nov 2006; 116 (11): 29953005, Secreted PCSK9 Decreases the number of LDL receptors in hepatocytes and in the universes of parabiotic mice. 5) Maxwell et al, Proc Natl Acad Sci U S A.

2005 Feb 8; 102 (6): 2069-74. Epub 2005 Jan 27, Overexpression of PCSK9 Accelerates the degradation of the. LDLR in a post-endoplasmic reticulum compartment. 6) Park et al., J Biol Chem.

2004 Nov 26; 279 (48): 50630- 8. Epub 2004 Sep 22, Post-transcriptional regulation of low density lipoprotein receptor protein by proprotein convertase subtilisin / kexin type 9a in mouse liver. 7) Rashid et al, Proc Natl Acad Sci U S A.

2005 Apr 12; 102 (15): 5374-9. Epub 2005 Apr 1, Decreased plasma cholesterol and hypersensitivity you statins in mice lacking Pcsk9. 8) Kotowski et al., Am J Hum Genet.

2006 Mar; 78 (3): 41022. Epub 2006 Jan 20, A spectrum of PCSK9 alleles to plasma levels of low-density lipoprotein cholesterol. 9) Chen et al., J Am Coll Cardiol.

2005 May 17; 45 (10): 1611-9. Epub 2005 Apr 21, A common PCSK9 haplotype, encompassing the E670G coding single nucleotide polymorphism, is a novel genetic marker for plasma low-density lipoprotein cholesterol levels and severity of coronary atherosclerosis. 10) Pisciotta et al, Atherosclerosis.

2006 Jun; 186 (2): 433-40. Epub 2005 Sep 23, Additive effect of mutations in LDLR and PCSK9 genes on the phenotype of familial hypercholesterolemia. 11) Zhao et al, Am J Hum Genet.

Sep 2006; 79 (3): 514-23.

30 Epub 2006 Jul 18, Molecular characterization of loss-offunction mutations in PCSK9 and identification of a heterozygous compound. 3014695 12) Seidah et al, Proc Natl Acad Sci U S A.

2003 Feb 4; 100 (3): 928-33. Epub 2003 Jan 27, The secretory proprotein converting neural apoptosis-regulated convertase 1 (NARC-1): liver regeneration and neuronal differentiation.

2 Table 3 - Human Populations of the 1016.0 Genomes Project Below is a summary of the ethnic populations according to the sequences of the 1000 Genomes Project. Population European Ancestry Residents VUtah4CEPE with ancestry NorcL Europe Tuscany in Italy (TSI) Finnish Finland (FIN) Chinese Dai in Xishuangbanna (CDX) Chinese in Denver, Colorado (CHD) (pilot 3 only) Japanese in Tokyo, Japan (JPT) Chi .Minh City, Viet Ancestry 3 Yoruba population in Ibadan, Nigeria (YRI) Gambians in West Division, Gambia (GWD) West African population (TBD) Améte African Southwestern descent of United States (ASW) Afro-Caribbean to Barbados (ACB) Peruvians to Lima, Peru (PEL) Ahom in Assam State, India K, Iwrith Reddy to Hyderabad, India Puerto Ricans to Puerto Rico (PUR) Colombia Medellin Colombia (CLM) Ascending from .-- Bombay Island East - Punjabi to Lahore, Pakistan 214 Table 5 - Sequences of the PCSK9 eAttte:,: VM1M4: - gq, ugqçe:.: RM SEOUENCES D AMINO ACIDS --- Italic = sequence signall -30 Mail pro peptide 31-152 Tiny = catalytic domain153-449 CAPS = C-termina domain l 92 So.itignés = residues changed from the allele: s ... in watertrés sequences (num: érbeAs iesidus its present) tero-form tLG rf: ix; ri YK: in KEE ix.; lesiteLF ,,. .m5yrIez sequence signal riY i?. ". k, -4'0, e.wgph-e5.1! i5dag5.ze.: in;: ia, zi..0.W.agsMe: 4; 30frdddydy!; : eeàpe'v.: tel-.7e, t: r1a51d5: {pe-k $,: '! e4e5Z: 5e: CW: ip.IP g, k..4ei <: 5EtCeeteigtea: rlvaea 8: 5' ## EQU1 ## where: ## STR1 ## ## STR2 ## .em: 5, e> e.r3r <GAto EAQG `C .: a, APGGECA); e: t.slAik <::::: ..: Li: r4CeANCSVHTAPPAeASM.CiTRVH.0 s e5'.5 ' '..-; ,, ... 15: c5RGC.pegQ.C.IGH'S P :: - ..> ... - e.:.'>* :.'.... C: -IAPCii .. 5.tel:4,:E'ki1.1PAP<TeeiseTVACe.E5:51+:111TCiCIV4IPe5HVV.,:iekY AV neerze, ie. Pro-form ":) F5P5:;? 1? :::; :::: Z; 5? PI: VF.11,51C5 '-AtEe 59ft5Mkifewpi ..-.> 5'.9: 5Vin :: <1 I: kg-Me <5 ... fiEg: 5e, 1; 5k5 / 5;: ev <wee; i, e, - # p: 1 ->., GysM5: eaqqrlerege, Avt.g: 5'effddec .55 prpdgep, -iir, 4 -5.3-:: 54; 5 47, * 3; `,.: #.! S A FGGE-C> '</ Y: k5 ::: -...: CUPQM5.7..5 \ 51-he'ApeAEASM: /oepp4L.jenN.evee..epteeetweefee..ee>mde,db:'e% ....erffig.)3.-meet>me 4.w 0,> eCe-e., 3.euv ,, zufskEniwee :: - Yr., Yred-tmra-eVe.zHz ::; - re ', u7auwalm -'.,: Ues> s U.1.1 0d-0.1d OT.e.-ISY.Irjelle-WSUZ: efis <Life, ehSIS.DJUSeke, IU-fW \ A> 1.N3:) AV eleki-PPIDd-WS: -.) - 9171.11`a; DIKpe & LAtiàbded = -.) Rege>, - 4: Y: 119dVRY:):,: N: H, Y.3% -H9A ") ta" 456.09kfdInAdeeK: - 1.... 910aAl4VMSS :: kallAi.-IEJOCH: DHAaleelSV: WdetrailkSDefeDenDejreiKka ".19.e. AttPee-PeeCIA: 1> e50 '$:,` iesen> ik, i-A9Sle.5: eS :) .9111 ", <Cr> WeeffileWUdDS: WeSted. <1.kCA10) .VeeD'4e, (`: feeM31.4i: 1 ed.:`:e'e'e'e'e.e'e.e.e. 1 ,,, :::, meen ::; _; te: ee.eueu5, ke.eqdvele, I # Ad}:> AP-s.:4: -edh {e74 *, .., to) :, -.R.K8; 3 {eW.: ._ 3WseSi: :-); e. ,,, there :: p ... e .. »teâl -?,> 4?> Lear> - .. r.ezebAwepeeelewfflleswe , Ceee.: Lip 4; 5: - ..: pe4ds.; 37 <eeper.bie, ap ..... ::.:;;; Del, u, n2scedliey, -,: j2;: 22, m a.),,,,,,,,,,, aeczeame7eza, -iii:,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,. MA; lreMSS: DDI1AHD: 00H.: MATIIiYaS'e: Wde11.1: 1A.S -.), E10d11: 3 :::: ee`ei> 03D: D.; J> C11-reiDAM9: Dr.: 1V3 I z ..>. islesi3. {q3b.qae,; * zie.:iemteweeMaeli:qeeeb$-:ebplmv.i5eeepeci 4; 3 -) <- zi.:.ft persi..34: eileelAwkfeeepicreeveas4 <toleidv..yedtes§eikelv, .. .a, ei.iy: x.qe ,; ;?, Weefeeyeepïe-5 -...> v Zq4z. This is the case of the following: 1.DNA # .1M5: 35.aS5 :), U2SACC,;). 1..e..A.DINCMV Â '>; ern% H> -II, DeSMDDIC / 24: 4) 33. WA = 3: 0 .ed eamew ettuod. see.Afees4p, if ese_pmge..b, ii4epee), .. eee> swe'pe.k3aest'lezm5 & e.eik, 5: eepda.Pkepe.'P1: 3 QUIJOi-0.1d r; ..) Ad0. read asuonbas Da Ae Lincy-oid rns- d 17,3 emei; eu.sp,:, wee.s.eitesmeee.beebe 34> 3ccesee ::: pe;%}; .- .. iiire,?.? fflc31q.N .... imupsseec p3, k;, see4s .I; ## EQU1 ## where: ## EQU1 ## , 'ems-rumenkee, eiveude. £ 4-meeuel-euevi -.> m> meEtïie, Y:; g4E, (> Jbi> Vzse esp,:.:: p4eep edemp) u:, eeeqee.ebgeebse, peppmepeep ... 6,75.04.1: Cape: h.pbeues.A, a: d. -Ej ... imke 4e1.; Leeapdtlb, 4apa ... giej: .a; ee3m ej; s eJnew euuod tne .. ., - seemusanws: e2e5.s .... tm.u.5 ... e, e.s5eAtatuomf eiCfee.-MCS: MSWSIlall.elV. "-) # VAtel>, 1: -K111eSHV5 ;. M-AJ.CID: e1rW) VEMedeed-de.44d.Wee: 44 :, 9TZ TT: 191 £, 21.'aMeSaailARERY.OHDHA511906 :: V.3VddViMAKeieklillMe5-A1-DaDOeleed :::. + M: 4.eMTe :> 95b5: IMS-413a0 ", kereeeeeiiei9SFee:% .Ats.1, tiZ.1DM, .DYD.-EelkeeM4; ', 3-43..eid.iPeePAP. ee.pobee4lednemweeeeku.ebsee: te, 6eleep :: '5e.eeerd.r .... eu, e4: eezikdtpbeule:.' mv.A.edenez.,. /eepp,quee,e;:::?>4AeCemepbe.ev.we,Mfemeee\dbeev4*-4::::::ege)etve. uueeceeereef.A% A.tee.m;,. eq.wce.e.i> ': ,, 54apeee..ime4.p4e.meee, qpeg';: p02; meepdeeMr.e.k.dd pe :: 5.3. emteee; ';;; e: ezrz, 2: .1: I:;: m ,.. uenrrenzzaegeze.s..e-meammu, k.,. err: uzzer,: fie.reenz, ".. edurzeU-TiW ': 37Zeuk.,% mileezue, ealmise) d-Pesniee.kenVislAre) .e.Vd19A1) Wk ## EQU1 ## I.Dee., Leedee-kHAS: 3NeMTeDeeele ', M> 39.F-MVNKe., QAT,' VI: ',,, MU.U9SUSiSS ", .. 1S11130-C1.-steWkIl.d9Sle.SMADentis ez: e This is an example of a problem that may occur in the future. Mig.ViiiSIDd-reSD.91.1..keeenigC..eM1.1e156V'llEn-ErMYY.319, tiVH.D .: ". "SVH $ 7.5e ::: UHDADtNd0: 1: iacref> .: dkre-: 91.z.laA3: - .MHe, 17YD, L1N-F.YOOK.) HAW.9e4V3te. Of nose, tettken: n.ev '$, AA9 ::. ,, ee4VNP, Ve -.) A - ::> Den', aege.9.e09. ... .. ...... .. .. .. .. Of REERERHeça ): MTE./1, YY, NOT>: dl, .. / SY'is4.11MDM) VisieMefiefrde eeee ,, e <Ii3103: AaMRSSD01.1M-i: 0070i-CHAUID 050% 1 esile- 1.41.00 ... 5S, ESDSIIHOesi: lfIVIV.ML <IDPfe.ees.U10.-tie.) .., V, DVDW; 'e4! Eekele3bP.eeee ti'ee> pei.q :::. 54: ; ee. :: eie5} ttp, 13 "-eileAzeeeb.ges.kimpe -.) pesle4rWikkep.x..4. 4u.iegeeedbplyvvies ..; §e, ab'E55ee.: s: hpepp..y.u ' i.eetweAe.m.ineeup.,: ssKIZTerrnCf.ene., 7.0 '.,>. 1.11.-eR, - "MI.M: enes: Xf.errerere.)% 7"; "1 ..ererti erkUVZ "Tg.;` ... eetZICH-e.ar> él ;;; . Yedern: M.IrriendeAM.5Sb'Set i.D.:A ....? 15.3. Asuenbe DeAe ewlopaid 'Vesee.:'UAtaLNUAV> § -> MeNielqi: SS) 5..3.1.1AHDMHDHAUID:, "e: We 61Keeeeet cn M33 VVIEIM-Ilree..ii-ei: SD? ., MBOeSte.DakiirtYl.en inHVSM, il.W.re.'iM0VDeegkiee <P4-4Emi3P; e47ks almew ew.Rad rfuo..to.: K.vnirse. ,, e.exe: evnAve ..: 53sis.D. .11: 5; x-wsuisfo.te, nee .e, ... W <HS.J.De.T. ::> erUf> A9'.ia: 71-AlAte..5eNdDeTeec ::::: i19 ## EQU1 ## ,, Dre.MgrirOPDHA5ii, k, DMVeed OIRie-DtefeU: 11-neeleeAMYe ...'- '9.0NRV8 -.) A1.> EDU:; i' n4: PbeeMedeeepwee0eks, eeebet.; - ffle.lee-lee. ' : 2 .degp..6 .-: 1: -e4weer. Oxib '.. e.beu-4e2.4, e, aee.d .ena? ", FaeAkSS;: 3" :: 11AHDribH:'. 3HAk # IDtkenkede.W.Lneepeentinin: Me.'sf, t, ffflDC.-peSk) ster,> Alneyret-I t ez, eA; 4:; O: Maep.z :: e.17eegwweeeemeeeb.b: 11..bs' Peepzegeadekp <\: 4ik.egegAd bpbe e ".SKWeb.M-WeP-eadiWaPViWA..32, zsp; i4pbm.g: <(eaelreepddbiepuluetf ;;: 01,: er.Z., 1; Kesn'ere'eY, YIA: niVe.W.US, D; U: `PnliSMADINUIVI eVIN-MD-MS: 19.111" CM: "." I: SjbeedED.ffl> MYaiDseti-1 ::: :( y-: NHe, ', euHDAMMern MeeA (PEIH UV: Y-MIGINIUM-GE) ".) 1.1AHD'OOHDHAeleee5V3teddeif-11,, S-Zeee..3tflICYDee: salt, A. 9 '.. 3.`, DJ'M-MDffl, iEi9t) .13 t4e srtnj; ..: i-itmafergefte5wweee.e'e..bd serfs Ha'T.UtMe-`..17: Frfene .: "Snii DnTerenrea ze N. ez> tei.:eV9VdEiln> 7777e.edisMAS; eSStsif)., '' 0150SVOse1 - FaSti: Y.:, IreiVelAV5: 3S1SDLISA.CUSUA-es <Mnal'V. .191.AMWD'DIV: »- 1,11 ..). Ven:,,,,,,,,,,,,,,,,,,,,,,. , DONd.r,.) £ .7k? ## EQU1 ##. ## EQU1 ##, ## EQU1 ## ... dte "N.4tie ..>;> <M.:9ffl 'and>, 40epitle.evevee2.e, m.to" eiztqM ..use; ::. d.:wbmde.'4db- Aemmi: age> e <O> b,;> :: es: i> ::.: TaseeneiiSqg ::: - »JE: tees ODuonbes 3aA.e 9W.101.-Old .QW.101-0,1d 6TZ 1eikeaeuepeeis5eJs: I.: 1: .-- (-, pjyzemveeeld95 .-,;: eveiAisiteet, ... e,: e., ToAelemee;, 4 ";: epaepmew,> 4sp 1,: .. ee, :: -. ", :::! .. 4s: gletiecke.e ... ,, e.eiweeeee., 1weebisesbeep.;: - ..,.; ..- gse, seeepe1.1: 0- y + .mgjuAg-pebgbevie64 ,,,,,,,,, adesees ApeppeN-elep? deept):.: eevmse, fe.'e;: deeelid'atp .: 4,3.e ,,, eew.e..me> heilitz: ,, ze, m;: e-weet .-- me,?, .- 3rd-pi ,,, e ..} 5.em .: 5: eepceetewepeade> ue.plimu & ireeieeqp-it: ' é.4per, ... é4enpddbkepe ':.), At, it: epmfig, C - u.Azene.z.zze..a: 4' r. îlensmri: ::::, Tmefee.ee ".. urcerrveailwi-x.winecmre, .. x.-rte.?:Yezzenrzmz.Zeimeriamer '& z:', .. mine ''; e5 -.>: -., ::: e. '.. i ewmpoid dmee.', `'" .ra - r: ,, w, zze-AeZa -, :: a - ,,, ze-e: ertr, A1US.MeMzea' aD -0.1e0S \ éYen.ie. a '...), ..: 4VA.VINeg.; 1SiS.C.11: 5; An'eSUPC> .: 11NOAV e: 23 .e + VeMe > 1.Dee'ye.5:, * - 9111e15 £ ':, 33Yeffdrj'eida4'i ::> e:> E :: i31D: delHD: rilS: V3deDA: itNe-J95, i 15M3Mixeder. :::: YD111ARMrSrlDlesiDeàSAS: ": Ïeerl.rn: D: Dee fs.919 N Wee.) M> 9-DO n V ': e19kfg> eY, -; e: USS.ZeriTeeer_2051Xiii: t1 .Eieeb-OeMeiee-Mtuileefee ,, : ei-Ei> 9 .-, Oree.e <p7ersp% 5etpzeMeepe:) 4..i0e: pkMpbe:; 4:,: iP ,,, e. <3der, e1.7: S 'P.PP.peee : v <vs.e: aten: lA {"eet :: e.3? 3,4," e; ev, e <; at, db, I, bvw - eweiietc ;. ers.3:,: 5 m.meiîe: e: r.>. 32.m.es.ftm .: 1 .f, .1Z> relketZTIMIC ieuf3! s amenbs 39-A awaoko.id e, -: 4th ee ... ns%? -eSLD1c: VS) D.17.i.LVe-> 33 ', YeAleit.f ... ne: DelceDH: 3> i ... M41) 319GM-CDS'V'M WeAD.r.e40'. ..)> J. Of # Adaf: 7: 510M3MHSS ::> - Dlle2H90.0-HDHAUEinekeat'tC, 140.-e.Mile »Aje'd.TD ::; - eirçA .te.39f.kie- ee .- {VeMT - 4D5OV3 eie19:> i: e>; 9> Seelililills ,, Hild'eat ';; V: IVV4? Le951, el $ MeeeiDilt) s'ef, V. Desdife-Pedkvieer4me.P F} e-sfflke;: e ... eeeeleeswtae.eElereeet, -. <511% bs, eqic: -. V) p? .. see. % FS% 4: ej;: prS: 3-2geeg-4: vi: bpime-4 e:.. 1-44% ,, ::: ade ed.,;. .49-J: - 'reiebxe.p:; .. 1,:> peed, weeewp, .. 31i3u.:; Pebui, e.:; K:.: EeeeepdzibAe! E3.Axide. ::: kkem, e5 ,; aJn; ew awaod tna.OEVrernetWe ::> WAVIAtiehS.I.SDU: V> 0.:1 "/ SUr >>.>; 5.1, r4WW kite: <, - ;: e A fia 0 ZZ; tm ; e; wee; i2eix, 4ffli # .zasttusee-elmesiea2de4; p7,.> .J4L; .ree: Vejcpt3e44e2A e., °, <; {'', eee; c4ti 4 -.) ep -.- ;;; Sb;: nev <2; 5, ... a3;: sse-erE,: ep epa mx #? LweLeffl: .1qpebmpiiiMieedpddb, <Amukddl; .i ..,: z;;: eame.

9WJ oj- 0 id Oleee: OselHe.S.`e: ', WAleiWfaei: Sa., LU-1; \ eLe,;: nAHSI.94: 1VSDD.111; 46M ::,' DVALAOndtk> eaE91'faXP; s ## EQU1 ##. f, Naesse. N: f -M-Mli De>?;: Ea; ee ;;: a9.P.4> ;;; I: b'aU.5 "S); rri; 3:. 06e," ;; "e4 ;; etiOnateDSFe.S)> Oe's.e, s5". .); 410 :: MeLIDgaidekW4 - '; bP'ef-Wne; * 44; b.eeM ecizo); Li:, Wliede..AeLeeter'bMpe-lpfeed ;;; .- "ide..e.veiff; peawes, phetnib.4.etadeee: S ApEtpipe ;;; Dee70; Ao ., 3rd ;; Aneetw, i ':,;, 4, Lne.:;: tiAeldSliesb:;:;:;;; ;; ;;; i2nw., 4Dy_s_ pebmpiese: md ab' M. t. , '.. e14> .3 naTzerzenae. ee.numeee 9e:: Ie Qle eouenb ss ewlopoid .0.150eefereie e: a-aWA ",.; t1A.V: ÉiSle.i, D.11.S.AO > L.b:. 'LA: aJMaiM2 "4 .Z AVO1AHSUOdlesr; ODI.11, MaIs'edADatufziedie / -r-3; M: Dnedse .: 4D05-: Mr. Inel-Ols.YONeDe ... .. "MdelAdkil'k: ID13: 11M / MW: ii% -y 5y.e) is: ee ee ee ee. AUele.e <d: bpbeueee,.: * Vedeees einlew etuiod (.1-ffliA / CINC, 'W''v9-.1e4p.m..9.`s: D * 1111'ilie33WAINCeibeitedet-r3W5 ::: ## EQU1 ##. : Al> TZZ ez ffi 0150Mtle ::: 53Dtssei.V1A-VâS1,91.te'Cre-Wie.lielUte.e rie3 i: Ma.M3eMese :: enAgg.CODHAaiDeGV.Zedelei.NreeiOzinneteitert, :: '. EN1-eseDATenCeen esierge> DUSeMS: raMeeen: S ".1.3WWWUC: Defee ,:, ee & le.): M: <* ee'reeq.4de: ffie-Ue-4e3-te'ei '<"ei'5,: e> eyeib..nefemDe.1 IeTarre'tereaDeer.iAnA e .. ## EQU2 ## ..1.9 ... YrdeDed9r, ",: ernMarke:? ,, I4liedee, 4.1..From 191elleafe: ere.7.f1 .-) .. 0A11:; 75e0W.) PN.IUWriiVeldktInA.5.:Melin. 7.n: 'eM.f.D39.:D.liVNHveDA1',49:50V7,3> M44V1) -4'weddedeEeeeeeeeeeeeeeeeeeeeee',.>?> 43.1.5.:)geeee:a. , fid.mpe :::: ep.ieienxibe.) beuW.I., g., 4 ..: eleeek :: 1M5YO'n: H: ', -. i: SU: Xiref.V1ek "VhS.1. ## EQU1 ## , D,:;? I ') 3eALA: 1-Yricl: teser.Y-0> <W> 31.:.)eeM.-,'&..:;:s.:Knte.31MDIC.Y4e0:9 > .1.delAtifei.4e, ne.rrzenaeeeeeze ,, :). Uegia, mtrra-2eesueeerr ::: 'e.neeeeseeeerezeeezee, A4: ua, e3emm op oa d muOis aouenbos oema likes (/' awJad ZZZ Ï3-U : ## EQU1 ## where: IMHSS.Zi: D11AH, ZSOE, DE.HDHAUDWW3eddtqH, e ', SDNY / Odll: D. :) fflk: 1), AD, IDafeeHe% :::: 9, s:?:> E5OY; ??. 3 .. ed3: MU: Ma141143.Fedbpbe. £ 3 ". Ie.;> ElMed". "- i: ## EQU1 ## where: ## EQU1 ## Ate..i. :) 7CM: SIDdee.5.i.3.1-: UM.D.MWALse) 7Etee4.0HIM> M15.> DVH: .1> :) ffleS-Wi'dHDA'S; -0.NdODxiells ,, -4- 4: 1.9103A3M8e;) - 9.1.1A.ReOHDH.Isil. 904V.Vd "IHAON" -te.t11.1: D - :) EPe..A, esD; I: D9eeNfeeMIXE: ie-.` :). Y73 e.WIDUM9SeaSe.Sal330.zW:Mt4- ', ## EQU1 ##: ## EQU3 ##: ## STR2 ## Ye: Yek'We-e, 0-1.Ae-4): ee: Ile-U : AP: -. IEe,: i-wpbm.e.fa.ze: leme>, wweeeie.qees: b. Ap.epexpecine ..?,., 4ele.me> etnejearsklehmee; db-Aivr-, zene-A-.Ceb: ". sjear.ene.'48a8p. ::. e ::,? ve% ;, 4? A.gp: 3> melm41.eee..çezieAtol tet5ls epuenbs Dahu 9MW-0.1de: MAR-SIDefite'S :), 9 ::: ILMD:?. 3), A. /AtreGrede-13>AX.:)3i1Dde.H":".).Ss :. <H # 7.Ce7MHF) A3-0t4, in -.:. From Me.el.dxi, i, 4k .. r: We'AD,; 11 / S: e3S: DS ::: 1330efo .. *.;. ". Wk1.11.69-SK Ate, ..) Se..M.,: vEF.kq-- ## EQU1 ## where: ## EQU1 ##, ## EQU1 ##, ## EQU1 ## pdbpbe4.eS>. .'4: heeeeed> s> Pe'l3P41) een''e: Ee '"eEEeeeeeeee": 5'ee3K> .. e "M (-4e> A: -dev>, zib-n; ft 9 : 4Aieeekra "-?:, .E> e33t .. £ V4.kri. £ 5ee>) .7 1E`.4} T 224 SEQUENCE NU C LÉO TIDIQUE ::::: Italic:! = Nucleotide sequence coding for : the signal sequence (nuclecOel - 9.0) (Ourriet = nucleotide sequence coding for the propeptide.:(nucleoticy5:91456) Tiny = nucleotide sequencecoding: for the catalytic domain (.Nucleotides MAJUSCULEequence nuclémiChiva: coding for: dornaineC terminal (nucleotid0e1 : 3472076) fd: 6 MCAGe.ZGC7r, .. ".7., .. ke6e5CtSeiree.Aeire.: (176Yrifî.C: 5.C.76-e. '7, CreCreCent e461e5T to c: rf CC : G ceagrGcecen5cG cee to "titi". ",." ...

1 C.32GTcre.,. Mc = meneatcecenaeceggagcegatUeoe - .: teea qe:> 3aggqgatgaeàztmeeecaga,: g.eeggmcctgg, aeeie.eztce.-egàn <eegcata-eae: agetgàewai:. 'Eea eeeguaegeeggzeactefeettep'patgt..e.zeepeganeegua « egttceece.gàeeggma'ece. aegnazeeee.:t eneeeaeetggcàewzegtt: mgtzgËe.gc..e.a.e.ggeràagWue4gr; evg-cn: ee.gc.ecgtge., autetzem. 4.aggeue, e, -57t: 3gc.gey.aecct: cata: gcs .... tm2.40tetegee togiveAfe.Weeege: Cregge, greeelietggegegetgeecctggsgee, F, P), 3.-to5e <cce.gta: caaile: ::: ipx1: g ::::zilegeztggieugizt, ggeeeegetgeeeecetecege :: toctteceieje, getgesegedeaaccceageecagctecc: putcàlew4Mgmeeue toegaceageeeaget, getgeeeclegggà: Ct .: egg gaemettege.egCgggguecUtge.eeeagugaggw :: atezae4gtgeC <egegegulmce (.C: eegeceagK, Iegg, aute ;: acef; r4.ztgeexaegtgetggeetgzauegaW..74,, tctei.ezige.ege, .getre. xetiegceeezttgàggea ,, z.gaeg, ezzsetetegcce4eggettet.e.ege. ticetaelpegaecceeeggetenexat-4eeetegtsieeeeztzteeeeeen ::: 8CeseG.GGC:> 'k4.j .. ## STR1 ## ## STR1 ## ## STR1 ## ## STR1 ## ## STR1 ## ## STR1 ## ## STR1 ## ## STR2 ## ## STR2 ## ;, BCAAe; CTGeCTGCCGee, ', CIACMC ,, GCrfrisreGGeTe-ACE e "' 1" CrACC> iCCATTGoelAi.:76C:TGCC:mc.TACCCCAG ;; '; CCA.4e.T-GCAeG.T X: ACAZtecre, cAccAre.`, Tegy.71 ef, :: GCArere; GGGArre: G1- (3-TC-Cle.TGC: CAC: rMCAC.i.GGC: e.: A 'rreT C: e: AGGCMCeert.:CCAC:11'GGGAG (... 17U.s .: ".: IAGGACCITO.G.Cee, :::: C.ACA.AGIe ,, CC, TGTGCTGAGCC.UCGAGGTCAGC. CCAACCe3TGCter.IGCe ::: AC kei5.> 5) 1: Y; i:> 5.YreD9. $ \ E ") 1D'Ofer.>. LVE. 5.:,> 5) 1. . :) 1.9De: 31 ": .- 7) .1e,> :). 91, D: ',:) ./ ..) ::". 11 -)?: -:' '' .. ..IM) -.> VD:>: 19 ',, eeD., 1'.: ,, v.:imoDI::,1Y5.>.e.:DVY,',i'ene.YY.) : 15) DeDD'1 / 4t) DDCVDDD.ICI) DD): DDWYIn '... eY :: D11: `ZeD * VDDI.D DVDDDID`z,' D ': 0.1.25DV:, 9.1: Y3E. , 5 "ROV :: 11." .. 3111?) - ,: eD: ',> E.'ee-, t) cnODY:) DDI :: eX) 1.:Di..9 Xel? :) D .DDIVD: DV. :), "" DVD.I.D5 ..: Yensni'IDDYDVCYDDIF: 70.-IDDI: Dw :): 0: eYel.TAtt.DDID: Daum) .0.D vz5 ...) ## EQU2 ## f) ## EQU1 ## 1:) itDr) ... *. Pf: ffl5.3.ES ::: VVY) 5e.-W991'in5.:> :)! Mt, DD: F) D: ".>. e: e: 105> teeDDD.1.9.e) V-f, .- M1) 111.DV:.... DDIDDIDDValDDIDE; kl-99VD.LVENDIX:, ... 7, DDI:) F.0:> DD: 11.9.73,: Fee :). V 7) 59: 1I.e5D: ire:> t ... Y .. ") .990i. :: e: .W.:,) 9V) .J ... 9: ..), 15-fi .mr: ye9 ... ffl: 9: ii..1..2,9.1:.) 9-5: f>.), D11: 99'se): '.'_) eD9P?: .- 3: 3: 3rd> eseeranOenebeeeik, eaeemm, .-?, Eel: :) e: e .: Aecceece andce3Us'emIT'ihereefezdzklee.-eer4-.m. :: e ..: s.-ie OEOE5, ', Ç 3 ::: e2; ::: -. * -> eee: ZeCneebet4C-2e3-e "):> en, linkeeelte.P0 '; 0.4e.CCieee: deineeetegeier.A: PneCe.::geCe neaC33?". : .Y :: eie; me.7 ... me.). 3rd-4: -mke? .. mp: Aiel4e ....>,: e ::> E <.M. -ErinT5-e- cm-.51i p-.:-1:welige,:ey.31:`&;;:pew)ce:;-: eie: u3elirae) ::):> and,: eà: 3: 3e: e: Ei'2e, e .: 7 '.>: FâerX? EYAeree:', Dez> w> ea:>: x.3e,%>:;?;: E:?: Ee:>;,>:> -: - e: 1 ::: <:>:> -:,: ePee ', .eI': â'2.: ',. Y., npeie.e.IC,:> ep, eeeCelpee'n2ee2p 'neeeeeme'AeCaCce.' eâàeCzre:;): e .. ",". â, K ',: e.fs, ..' ke12.::M -1.m ... rk ,,, p. eMeepece .neeme ... mnpeeemeerkre.) :: vere ,, p3e3e4e -_, ..},. 'n.7:> 1e,' hzem-s) 3, Uce neCe:) 114: 3em., * ai ', b.2kehmN.2:, keW.C.i ': cleeezae "in:' '... iîheffib: in.Ae-i Weeenecf. 14x) Emez,: e enebne9e4: <iiceee.xerae: ncn>. ::: can :: ,, élee5.e.: Exe.a.i - .., Beiv..3: pee. ECUM ::::; M`..2: Eneeee>; e: - .. L> .- '.. i - :. ee.), ::: e * 8-Ï5 ..: Me .. .e: .- w ... eczn, F-e; geerfr. 3-.we-4. `ekf. '<totelp: .- ik :): MeI.f: S :::: a>.:, ::::;;: e: enemeeà'fb'iei: <: meC :) e :: t "- WeMe-: 4egeee 'g'e.e-iene. K * W'ceece," 3VZK> OC: .uz :: r, - Z, CM; ::,;.. :>, ZY: r, ee;:%. ;;. Z:, ij,; fZ ::. F..L.,:; K-ekf ('>. "Cj:>; ::: fees $ Zê "Z ';, ireir; Zf;' Wji '' '): 1 ::;.. zn :: Z; z7. .s'eer e. W.ME:'slkeee:'>..MZ,f:MZ,'..:Z;ZZ:;::eeZZ4)IeZkIZ.::fjSice ZIWIelte; ::: * :), ". ,, Z- ZietreetZZre.:::Z,',e.)%7,1:5eiee.'>X:e.):ZZ;X:4 ;: ee.e.ZZ: ZeelZe: .. e;) Zf-1 ;> X; eZekt7 -.:-. CrY ::::: kne :), I5.72.ZD: ZZYZeDCY-Sea Ye> ILY-13ZiDeY'.YeZe: Z: 2: YO-5 :: ,, D1 -3:.>,:, Z,: ler'sYnCID ', ::::,' ',' :, Is: Menfr; :::: e ;; `), .., enf: Z ... . " 'z'u .. <ZZI: eZZY.377.> 7 ,, kZZ'er5.-Yeer.5... -ZYW :: Mf.D -.:.; X: M: 5-.,., "'. 7'.2f)' '' ':` .. "ZMIZZeseZe <jteMMS., F eZZ: Zeà-Z9 ## STR1 ## 'Z'Z,.,: E, Yt'C>.'.;.> *: Efit '.>,: IeW,> 4, - .. k :),: f) J, .. 9a ) -39.9e, 9) 9i: :); L>. Ele.3? .Herla fc. C. 9.91.M.OD.0 DL, DijeD 9e 91 :: 25.1-W: X.>. D1 ' ) DM.DDiDDIDD DD> 9.Del.) .. r) DV., .. i.DD ..) e DD91 .V, DDVD9 -; ", :: 191: DVD9D-3., DVD9D: e135: 11: 11.'n: 7.1: D115: CY, -PID% eDID ::: CD. WD'eVD:> - SYV73: eeM3VDDDVZ.k.VI.D VeCie4.:., ',. :: te) 9k ;: e.;) 1f: 3Yefei: Xree.YDV: DI: Ckt.1.91.MD: .W.: 1, W.) tetill3D39. :) e.4.,),; »ef) 9.990 :: 11.1 ;.:: .: SVLY..7.1) ....... ":": -.) 9 .. :). ',; OrK, X.: * 1 .. DV,> :: JI. :::. D.:-.U3V9.11.0ZeteDDI:7,), ..), ..> .. W.DDVM: D1 :: # ::> DD I 9 .. D :::: VM.9.'Dkr. ), From: Def: 51 ":)" ..: 9 ::: Ms: -y.- :: .. y? D £: ze ,,,,::;; z- @ e,;,. .5.i :::::: e,.> V.V9D.JY: M) V95 .... "Father: 31DYVVD9P, IY: fe.rsl99Y.): M91V.70DID5f) .1 :) .. .) 11. 7.719 :-) e.:.):).1,e)Dee7):)::),DVDDDV ç) aiDMD.1.5,, n5) r) DDel:> 1: 11.MYteCCIDCDD'i; iD14W5, D911 ## EQU1 ## , Det: zentrV% e21; Dee ",) From VCD Q1D9t01" MDIVDDDI.) DD: 111 :). D.) 1:; 01;, ..): DnDDDi DD DV: :) V ;; OD?;, -D..1.9 :: ei: Dr ,, :) Vt <1 ../ X, DVILCDI5.4): 'WZ,; _, D' ... 'iV: C: 11', 91.D. 1,.) ::, f3.) ::, k1; P; 71D, Z, -) 1: 7,> DallY'WD D VD DI w; e9913kr ..),)) ::. Tt). ..eznin.: :). ".-. p, e - :::;,. 1 ..-...) ::> 19.3..re.: _,): 39? .. 9 .: ', V: .WY ::: (... W :::::> :::: j TQW: j .... fo "....) ::: i) v.995 , 5,, Ve1 :, 53> e. ",): :) 9 D-VCiDC'eDV '... 1.D1C.CV1) Y.YeDCIDVe.") Cr, keeD: 7.D 5: 5V: 1. *, M: C ,, i110i MD 1 DD.:C:5,1.01:k 5311 VY: ', C'SPIrk, 1C31 DDDDDVD.0 5.DDC111.:0DeNDV:"..01)D9D) DC5 ), 1C1 (9DIDVVYeDDMf7,: D> 1951Y: = DfD.; S9: C5 D VO DC'efCD5CIDVD9V-.1): 1-14.911CD1: Dr1> .D; 1.: DDI:) 9VCCV1IIk, 'D1. MDC5n; QC "DIY) 1D.W 9-94VDDY1 ::> VID .::51DDUDY:ite):e1").;091':e1:;'Tee2 9V1) C.L.W.Cre'n5eil9Ovy) :: * 9, DleYye. e. "- eee'teSg-eileepue.: mzerseeMeeeere, U ,,: ee, ue eee,; e endeeexape, .pe ,, w:%: Ca.eeeestienee." 1 <.eeeP3Cenihneed3Ce-Peee: eZjereMePn ' e: .Me474 * ineCen.e .: e:: ee: :: 9e33i in. iZ ^ 4'N 'ri Kfeieekeelea: MeMeleeD2 -:> eSAenVreeineri.rsendne',: "<7C.7,: hnleWee.ePe2 :::" 44:,> Ce.a eeWOdeargr.i: Flee: e.'6 ::>:> e :) »: ei.Me.:3:):et.More..3:e.:e5:-ieet.:>:er.**: enter: '.>:> ::> ;: 3.g>:> "Sp>? E:> eeeeeDU ::.:,?. Sea> reb" .3eg.§.YM eem-si.4., e.se4: 3n-A ... beiege.bev..msp: D2, .. ehe fK.>. m:; 1.'eyi: yr> .emegeee.: e :: , ... a pezeeopemee = 3, egnerà :::,; -: 5: -.> r.èr.e> .: 5th,; 2-6.ygieeeen-3nee: e..â-ep-Debne. ): p: eeeeAeee: .eyeee2 eeee, -2.epe .................................... ...................................... ............ ......................... 3rd -) .- 3,2mteeieezfe.neneeceng: e.,: En.e, memenee ,,,, " = esetemest..1: eseeee..e: ezne,: ir-JeIne. not; eemeleeeeneceenne.47.e.ge ,, ee eneep. '-ii3ecei> ... ee,: e ... becem ,, eeem e.e6w ::. 1: m.5:, - ezelb. e ....-): 4 - .. 1, .. z, .. $ 2 gen cf 4eïeep3eeK ,, oc: xxwzye: ez-mr. ::, o, .w ,, uzz9 -.> ;-) to -, ::, z, ::; -, z 5 -., ..,: ys2.5ey: a5z, a.: ,,, w, ea - :::; (1.zzuo> ,,, ,,,,,,,,,,,,,,,,,,,,,... A.- .. * wu-trei.weyt, ...--. :: 1 ..'-: 5.); I ;.;;); 3, .i, I, ::: Eu: : -1Z, CZ, .L-; ZZ.;,; Z, ..,: E :, 1 Y ZZ: f. .Ni-M, Ife> .1-e, e, e: ', Z, Ze., 12, ekre-Z,: YV: ": ', Z, - .fref: eZtZeZZ"., "C7) ee'M: .7,.,:' Mser, ::" .. 7.e --- ZZZ: e :: eirZs: Cr) el: ,,, EMDY:,>: - .. 5iCiZ :: e: 1:;.) .., 1.0: ;; -, - ez, zz, -. 7:; ein, 5, >>.)% ee, -. ::::: e, teeei ,,,, ::.: '::: e;: ;;; ttl%: = 1 /: .-, ;;.;: §), M * w, .- 1;,: ii, f1: 0; ::; e: <ee'e,; :: - '' ZM:> ` , MZ> 5.1 ::.:.: 1 ', eZZ.ZZ ..: Z5Z.:`...:."::::75-TteeXU: -: ^ .. ZZY1).,,> ZZk' 5 :: tYe-15.: ;;; ::, :::: eCI: 2CeCZ.55z, e5;.:, .. 5f.:::'.d-.: ',; 15; .. ... ',' '...): Mel> C4,11, .I = DVIC .. "? ...- Qe-) f.)> -. MiAes .'-, :::? M ( ## EQU2 ## e) 1.-ZDE: W.: 7 ::. V5 ::: f .. »71.e)) e> .Ri..D .: ef .. a) DDD.). 1 ... ".>.:;>, ily p .. ::::.) :: ,,, p": i _ .... ee .2L994 ",), - .0.1 -.): 1.Y. ". 9.0 W9." * "<91.;"). 1 "3 'X". "I ::" .. Ye.`) :) rsi "'" ' e &Numsp; &numsp; &numsp; &numsp; &numsp; &numsp; &numsp; &numsp; &numsp; &numsp; &numsp; ----____ --- DDV ', 3D :: t.,:.> DIDZesne5;, D :: Del-D1).:.): DDIDD: 1 :::,: re'Y.) FULD :) :) DVDtee.19: X ,, D1.5-Ï-5WDZsDVD.WD *: CD Vr,?. ';:, IV..L). V1., 5ICID7MDDD: OCV9CeD.I.DVI: C-1, E.0: rereDtelDDCD ::, V, I ... ODDDCD1` ;.) :: 119, .WCMI :), "XDDD, L., CMMD .I.DVD? '.DDD.I.DVDIM :).' E,) .. 11: 7.9.:.) DVDC ', .T.CUat, MC9ID:.);: ,, te. Dte, ., WU: UU, LC:;,;);,. E ...) D :) ;: r2a>., 4> Ç ey,:%; ::%., .. 'sz ,,, - , ecc.? .., - .. ^, ..: - .., .-: 7 :: ...

9ZZ VD9 '; "1 ::> IDWDD9);) Eg'sfDee,), LDV, IDi5Z57DW: jiIbTijii559Mel.D ::.;.'. ': KDDDD.1: D :: IfYMDLD', W) 7 .. ) D919nal: DODID-9 <91 :: Ye., 1zIaIM99'1.1'99; M: DLY.) 991D: DZek..19.11 :: 9te55: 55, -f-1711: 3YYYDD0.1 -... wEt.uem7eni:> Dvw) exaDMV:.) 941.-WY) 9: 7,: r) DX.I. ';: a191 :::: QD1.D 9Dgz.e.: `; : tU7,109 / te: "Yr) rel,: esen: MreeDD> eDe9.1 ::>", Y, X, MMDD: ', Y,: r.) 9:10:>:) ::: 9V :: ee.),: sii.) Jà'pmersn ::>,: e.;: mee-333: 3-30.; peeeea'îi, ey ..- ,,, enee.1: ereMmee.ge: AtzeCeAenf'lm, y4-, pezeyg., AeEececeueoezmeepneele..enmeari.epep'towemieee4-e.ç.o4e2ocee.DD: p'epuex ,, ye.:...e ieee4pegen. ".:> Eve: D ;: y2ec: aezeme.L> eD: -. * :::: - .. iezeegfemcw..yoea3..4-34: -seetzpeeE.,).:: pe ::::: weegkee Pj> - >>. Yee..e. "4: iee.gieegeaiteeae ..) ::,:; ee2e", :: leeeeeeeeeeeeeeeeeeeeeeeezezeeeeeceneWee2 ...? .. 'eere: we'a .. "sbuceibzez'see, ere_Le .e.-Areelt.: eeerekeezk: ',. 5eheaeemeeezeeeeee: r; omeeeeMri3O ,,. eezsUeebee-, m:, c: -shyeewaeecrexee' Z.:,ZZr.,cTeeeeemeaazeez:'5e3Y.zezze: ez) ,,,, Yezm5 '').. eeeee <rz'n.e. zzeez,: zzzzr.; e :: w: .eez: zez, c, -: r: fz: r :::,: .. z; 'f eee "Jekr-zZD5x3eiT, Zec." 21;') DIe ) ::: ktez) 5.'re;. (re_.53't.7-se.oezkeDeese..: zz <zeezek.tezzefy.wzice: r: and, 7.e.if..re ... Kemsy xcea.tuo.w.:.) D.09.D9.09.a9e9: 1: .9.VM: 9; e3zu) Dataset,: o.299: 9e-e;), ..: ".. 5) e ... e.>: 2vy, DieSNXU.:e-)V9 9DYnD: ') D MCDV ".) DDD: :). Eenif:> DMI: D.91.3,1'FI: 0: DilD: 5) 9 "Yr) VDIDX, Q9D9W9D9tCOV: 7, k: D" - ,, e:> DD ".51.7P-ir.), .V.peitnr.efflPXY '- .: erDeenezfiDIDID :: W: :)` , Y; -T- -------- DeeleDDDID :: ',, inrsD7,091DDD: Del.: 75, D $: :), 111-9.11E, 3DDE, WD-VDIDOC, De'e " . For example, "Yee VV5..lejlArdDVDD5re", - lied to "Fee," 11 5>, <.> \ E`, 17M5ntf.):,): J :: .->. E ", 111 ', r *: :), Y,: iD-1V, -:> DVMD:', Ve.-Dk .. $ DVDD- DIDY.:XY-IIM.WDSIDDDY)%01`,)ale,"IerMD.;::::MCNVD,IeD:>91.-'Ye: ',', 01.9.1e,), ": i. , e5.7e, I9.9, WMV: r.> 9 f: eeD'1. ::> From: ', Yle: 7;: r:: k1.; M-Ye, YeDVMIDDDVD-91DW-Meee ,: 3 / 7.YVIDD.12.0, 91, ',:> ej,.',> F, 3V) :: e5) UVID: DeDUD..k DeCieDIDeV-VD./ -1 tD9Dste'VeDDX> f,> FM: D.LZW.D9Ze'VY: DeDVE.e.) ;: e \ -e ".Y.), 1) D-D'Venee: ZseeDD D9 C ',` ....- .. v- -> r) -ee99 "..-, '1.7 / 1, :) D9D9a.t,', W:)> - ID9% ,: D.L9 Den 9 ... 01? ') eee'D 9W.-`c ": - og3 2: e.wziee".: 57.exedeele, nme: ".1t :: ,, e, Cdelb2emenelipmeeKeveeijeee: Drep: puDee4k .: 'aeee:; i.a2'e , e23eeed'ae, pnec .: Aeell :: Ceh.) "ep:;: toO8eie: nl'iea.: '3: ge-s: Reene -.- se-, 3cAee", esfe: e: -. eae ::. $ O, Mea-ere4,14: epeeCeee; .- Ji.ee.ztp-Jeeneeezeere-Siee-emoe & w.l.mens>, - eq. ',: * 5: 3rd, eupeecee? It'ke - '> ene.ep.:neWeeeli.e.-; --.-? .e3ememenIU.e.s31, .. eg: seneeem-el-eezepee33cn-.w: peApeee:, eennP .: E, P- - :: 32Zent;: 1-13: 5th ": 0. 2peet-O,% ', e, 022er,: cleix) 2oïe: :).. üzccaezeti - .. n:; <-, ere332emeeMence- :... MaD: eP.Ue2gi'eePe, -: efailee: return: emee'0Ee: K> eeoeeea3eueMeD; r, e-Seienx> ÏEee, e '> ene-: e :: eau SeeKdApeenaleâcapac :) .e.fl.oeaenee: 1-fee3eikelt: e; eke.,;: E.): 142: 4, Weeiieeihmexee: Ye: imatk-jaeffeeen '.. km.,' Reei: seee-) v: I = Iyee2Z-fs`e-ZiE ' ene) :-) Aelp, m-Jel: 'YgDeib: e2-4.13eseeele2iS ,,,: fe .-,. F, eeàsr,' r, mz ,,, eezeeece,; s, e2, ice: se , 3, -:,: e-ee, - ;: me. :: ',: eek.nee;:> Ag-z>, Mee'? Aze: Y; Y ::::: -: ^: ee ,, k2-neetee - Zen; ^ i: MEEFT.. ZZZe.M) -Z, Zer-ejl ::: 5;> e.M'etZ3 'i .. ""; ZZZYier.. Mfifef) ;;; YCZZYDZDZZeC = ZZDSWD1. ;; Y:; e0De; ":::::: £ ', 1 ::: rf :::, -e.:.:::ig:,::::15).' :: -1 ::::, .. ii ;;, 1-ZeWe ",.> 5> ,: kee :::,": -:; J: fle ?.;: ', Ze5e1, -;' ' ## EQU1 ##, ## EQU3 ##, ## EQU3 ## 9,: ree9 :): 9: "Wel" .91: 3D, D.91:.>. 91.:Mi>,-IVY)D.1,`,"e.);.,C9DJ.9.9 .1DW.9: CVMD.9n1.9, re; k: 999'1.

7VaLDV: ".1D1 ::. SeVD-Ere'ZO'Jr.) ::, '' Dee-MD -1 --- '.. 0 .-: eMenekte9DDID-1);:', 1: ', : uVDDZ: LiD:; (e: Y ') ::: D.§> §-5: VeM e.:4-1-MVDDV ::?; vyn De, ér - - - - 8ZZ el :: ; 9199W. "4.:JeM91J'EW,9:0912.,),r,).9.1:-)V":"DeriaXe:9.199.0D,W9,:299YD:) .D9e) MM-U9. 99..k.1 Y.::,x3e7)1:71DIDO:DDY,WDMILD'VIDIDID'YeDW,Wiite:19"..)C9Der3-3DDD.DDI. Deddi-DC) :: * - 13.73V99DID. Mr>: ".): Mieelen.D91: DVDIDD: DVDDIDD99V5Y, i) Y9MU'JDDDIDD: WD11-Deen'en-D-VD.r.) :: ..)".: $ D.DeM: DI ' , YeeDi.) 1: :) :) DTED :: WV 19teeY.:).9...WV.99.1DIV9VYM:DE).1vDD.. DeDIMLIZereMeexeYMe9Y9-9, e ": Pe: eT5 :: CV:) 1DDVF, Q: ss-r,) DDDs.eDt :: emr:; :) f:, o.DD> esrx: y:" Dsreg) lr) :,? kef), D..ID M ::. e ..). 'YCOV.1: M..1 ::, ::' at: -. Dee ..). 9% ':) .. ) D1.1.VZ;: .. '> DY;' '.- r.. ## EQU1 ##, ## STR2 ##, ## STR2 ##, ## STR1 ## MDD.VDDlit0Frame,> D19 * D-DD MDDIVPDC: Yel:) VIDDDE) DD; 11 ::: V.IYYree:.) 1S4liVI-5) .reeD eeDDILLI5.). 17) DVDF.). 11.D.DVD : D On. esq '.. leee4 emcsr: 514-flegulli.eec.: 5neeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee : mememeeeemeiwwe.we "rob.ye.geheeeneeecceleeeen.pf..ey ..> emn: wc:" ecenehe zenememrealeeeeemeemoom:> pkeesexeyeepeeeee: mcesr, mc <mee.,: "noee.we.enmeh -.''_ ': '.r.'.. 'j: Z: ee': ';,' rt> r,. 'De; Y; M;' ee'ete..CZ 'i.ri-Z. "UZ Ze.iritTejr.e.::::"":::::r.::eln'iCknZ;:ne".::>C:Cn e.erneee, if 6 DY9.15 ...) `; <:. Created: '9-DV.:.: D "..) 3.1Y3 aD ,, DF ..' ç..7, C, D1,) ::: Yes: DDC :: 'D' e.) 9: 3 "..) D1391: D.re) DDILD: IDDVDVDIDYYY-DeDWOD5leeDDV: $ 0VDD <.. a: VD'5 .- / lID ..,> .: lizi:,> -... .ru: Dv:> DiD9DreaiDDDv5D, L) 9DDV-MtDDDID: MD19: DDVDIDDVD: Dt'I ") es.1 :: 1, DD ..), .0: 73.1 Dc, c, VVEaLVCieCDDVViDieftne, Y.Mke15.> 91.DIIDDX, OIAr ...) DDIDDI: .Z,> L, :). 9 ', e1: Dre,) ev:; 095. :) teD: DD),?' : Dte: XM.Y): 711.9 ".) 91..DttX" YeteMDDV.; K1D, DVDDin: Yeee-DIDEF, The) .1: 7CD: :) :) DtiV: N: 7 :::::> :). e.YDDILY.) 'n Dei) DID ie.D.DDI:', WM: 11) Ve,> 91). DF,: Y ... W.:$1:"It.X.YeDY. 'eneseer.) ::: MZDZ: iron.C.IDMVDDeDeoe.). Ve ..): :) D OD5NDIDDD n L DDW'Ye.C.3.M, D ee n9D_CeDD'J` ..`3` ihD.DDDID'seDYrD ter.31.DD ', M and D 1. DIDEWD.D9.11,9DV'a-z -' ", ': 9: = YDeemes ae -.), erf) e,.;: c .5 "n.Yeeeemeeeecceiie - iJeee :: tenete. 'eesefe) soul ...'; toee.e4.7ece) edeee ,, f3epe.>. eme .. 3/4 ... 3deeeAeeieekszireretsec,?, AE} Mae: rae.lice:> elteAejekne22:, 1: »m: deeape.he :: 4th; : sv: '. >>. ela'efsltreeCee4' $ ,. ee.meeeipee.,: ',, k () C: p' .. AeleUe.-ne ,, ejeE ", <MeCe: 51.Iw4emeneepeseger, eezee : peefaemeolmeneeeteàVieepee: 30 :: i'imbeen'ap:> Itrjbee.,,,,,,,,,,,,,. ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, : 'ee) U ve: neecaggweem :: eegeaecr) nreynene, me'aafkear <ea: eee :: he: -nv> eaym: eeleuii: lt'ee5eel): m, zs, zlu) e, e, z-mv .zz: <, -:> zseve: zzc ... y.,;.) ezeeve) eeezze, z, .yz) -z) cwe ,, n ,, zfzreve.) ezzu ',. ex>; e ;,;, -: z, z, -: -: z, -:>: :) 1.0 f): Z5.ZZktZeSU ',> etr: L: .se: Zetkt :); fe: .eeMZUaZ'Ye; >:> ZZeMeeeXr: f-eeee.ne) WDIDX5CDC9DDDDD:>, ... :: 2kieD919.1tD, 91,91: 3-91 :). EreSIDDI-DDI, n1..MI: 3;: e91.991. D: 91.99 ..: 19: = 9VUDID31W-91.9): - Ye: hDent Y.). DW1: 5) ;: eVDD ', 71 * ;: l9VD.DVDI, DVI9I: D33: Y.nV'e. ## EQU1 ##, ## STR2 ## 9 "..- e: :)" 11 - .. M.:Y."Ye'9 Dteelleen:., 'DDIse> 19DIDIe.:; * MrCX..elsenDID: DI: D: laY,:.) :: W: Y.: ', ÎIV.-.) £> ;; WD-D'ec.5. * :: -.> E -WYJDDDI9M1Dte: C ",:">,), V1109'es): 7: P .., 0-1k.:. Of). r, .9.1:> ere. :: UD :( »29..9.1.: De) ke.) V: DI.U111) YeDY .-) 9: ge ::, 1 ', - Pe.reeXel: DeZniDIDDXMMDEUtk :; $ 91:>.,): VDDV919, DEs9DULO: .X5Ye, WX, r) * D9.9X3DMIDDI.Y: .WV :: 59 :). From; .YrIDX) * D9: 91Y, 1fY): DDDDa9: :,:.:, 'Dna>. W) ;: e. e eek,: v7e, e nw: leneerricegescAe ».. aetmeemywnseng = wpecez4neien, n; &;: p, .eer.o., .- pep- ,, -D.:epg4es .. ceeer» weennzaecceneeoleecepffeeaee.m: ceeyew_ * lecemmecejeme-4.iiske3 ::::: e. be aeemeoecoz.eze. ,, epe.e., .. 324eze-e.yegneezereeery, .teneeaeeeeene ::: zepeye, eyee the ....) ::. e., .. 7.eieleee-Atmee3decem-w, azoceeceneenek, xeeeudem: - "... 'ereeree,: egene3reee e.D.:,-rezismnieeeafflep.::=K:gees:nr.wr. . '..MM5 "-Y!".' ") :::.: DZI-6;: kaaZZMYZ: <> elf.:é.6;':',1ZeMezZeCi%-eWle":"):ZZE*7 , f'DO`e ... tee. "eM.D.1919.):.> ..).: *. ret-> DDD: r. ## EQU1 ##, ## EQU1 ##, ## EQU2 ## ) 9.) 39.91.9WD.) 19S. 09-Dr: erey: u.9.: X; <vDDD-.91V *: t zeciwee DDIZE) Da.l.DIMMDD.reer5.:1:CDe:11.:er. "1D9eD: 7eZDD.L.) . :). 91DD. CeeDID9V -) DVDD'e51):> DIDD9:) .. <> 1; VVDt ';' ,,. Rf,: ,,. Ç. ': TeDV ,, zre. :). 1: Dv. "\ EV" ..) DIDDIDID3ste> 20 -,; 092. - ", naL) D1 '... 101L ..-> DDV.). D.2; t0: DVDD.DDV9D eYeDDDID'IDD . :) 1) -... 9eDDIDD9Y.Ye:DIDDID:«e))De.'CrCeei:)351:::::E5IDVD-. 11: DID: DU: P. (99 DDDVOIL, 99 ::: 4DDIULD eXte: YY.Y - .: 3 Dee 'X $ "S; 99: ese'VDDV.194.eDDYnD.O.LLteekDeane19.DDIDDV' eDVDP./DDX0D::"0.1;19:Y:ne.) 1.D.).>:> Of ve.e:e.:*,7ne.),:ef,-Meimeesce:eseepeleMeeme .. ne.e'e.-5: "4.,: ;;;: aele: * Wneceei'hee.cce.pp4ce .-) ce,: n? eae: sex: t.peree_.2,: e ?: , epeeztem: .p.:;,?:. {. rweez4erseneeel .- ::,: mreep.e., zee'ngte, Pex-0: npee.yee 5: 234 weelleeryrelleara>; *. m .... 1, ee.: C: 14 caetrinceteie ..- f) .S.02: led:% ': e.nreeloWiete-Direpe ... e & c :: & "::: e ::? Ecce.yeacci- .. .4ne.enee3M eY) 721.,: Eiffelbneween.eceemgehesecc2e-eetn -). 11emee.3.1, k: f3.eeEanw.:> .11.tree.0 ::% .e3. "4-Q.ke Meeccepeeneeee , ke: p: "., e, efflwen: CeleereW2e>,> 2-IIU" lbeez, e3e3.'ne, .. e .: 31: D. Llete :: "11 :: 303.DV D9 ID 1 01> 5.) 5 ..>: MY5i7DWY.Pr.1, Date, '9.', 7) 9V) IDDVDD .9 DID :::: (..>. DaDO.I.DVDDI.:1001,DVD_D:)DVDDIDDDDVDDID>are-YD.D.19:1DVal9> s7fs-1,99.1, IDDVSefV.IL9) D, I, VVDELL) 1 , 99VMDDDINMDIDDIDDLIDDD> :? 7, .. 5: Diy: se, MDEs'.VeDDV 51: 1 eVZOE "): 99Y.WVD; W: M1 ::: ef.D.1.71LeIDDZQW [e59: :) ze :) , D.teD, F :), From eDI.D9YDV ",, 1.1`arDere" .. WM.leY ..) V: 01: DWDDDDVZODDVID9.12n91.:> 5. -IIF-3-eD: D11 ',' .. IDDDVIDI zeDeeeeeovzveezeieeDreeDvDeseueeleereve "welz, .9. ,,,, m91.1.:-;v4)5:).9 genmeae, -MxneeeIgeeente ..: ApeeneeceeMemenee: ne ' re7e.c: ws) .ae: $ ent.'re, e. ##. ee :: perem..iIm.eeefe: ree3eeeeeeye'-e.4m: nencesei,. =, eecenweâekyepee., :: pe-is, 7z <,; xmpz: p-pep * ee weeaxuyeeeb-Je.p.eze; q.w4eee, nereeepeeeeeeeeee: rf ':, 2kriaeA :: - 3em:' :: n;> :) fa> aze.e '.:> zieee: M: eîe': father, .. e;:> Sztt: 81-'5: penle8Ae.r: àie.na% ::> Semeetu: M.1.,, ewlkg4caRge.. c> r3.me:ieibeeg:a:nt.:-InS "> .- n & e.V, epee; 4> 2 - ,, 2e.e.pate: Agiek.,: aereer.g., eilezei ', Yeeee "nede # 42. eeee.e.ii'emOEen -4t.-dee24.2..seeeatreSe: decempamesinae3fieee ^; e: s:.:. e.Mee: Mcp-.W .: 3ccezee. ,,: menalle.ee eccre.meut; 5, - 234 Table 6 - Human VH3-23 variant alleles HaplotkDe VH3-23 Cumulative SNP frequency of the allele a (= VH3-23 * 04) 0.0983 rs56069819 d 0.0087 rs56069819 rs61750837 rs61752504 e 0.0046 rs56069819 rs1064090 rs1055799 J 0.0009 rs56069819 rs1055799 u 0.0005 rs56069819 rs1064091 s 0.0005 rs56069819 rs61752504 rs61750837 r 0.0005 rs56069819 rs1064090 '0.114 TOTAL': Table 7 - Examples of Antibody and / or Antibody Antibody Fragments PCSK9 useful in any and all aspects of the invention SEQ ID NO comprising a monoclonal antibody or anti-PCSK9 fragment thereof which are incorporated by reference from the published patent application numbers cited in the present invention. adjacent column. A patent or patent application which is incorporated by reference in its entirety, and specifically with respect to SEQ ID NOs comprising a monoclonal antibody or a fragment thereof anti-PCSK9 cited in the adjacent column. Regions Determining US20120020975 Al Light Chain Complementarity (CDRL) - SEQ ID NO: 5, 7, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 , 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 270, 271, 272, 273, 275, 277, 286, 287, 288, 297 , 299, 301, 405, 407, 409, 411, 413, 415, 417, 421, 425, 429, 433, 437, 441, 445, 449, 453, 457, 461, 465, 469, 473, 477, 481 , 485; Regions Determining Heavy Chain Complementarity (CDRH) - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 61, 62, 64, 65, 67 , 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 278, 289, 290, 291, 292, 298, 300, 302, 401, 404 406, 408, 410, 412, 414, 416, 419, 423, 427, 431, 435, 439, 443, 447, 451, 455, 459, 463, 467, 471, 475, 479, 483; CDRL - SEQ ID NO: 5, 7, 9, 10, 12, US20120027765A1 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 465; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 463 SEQ ID NO comprising a monoclonal antibody or a fragment thereof anti-PCSK9 which are incorporated by reference from the patent application publication numbers cited in the adjacent column. A patent or patent application which is incorporated by reference in its entirety, and specifically with respect to SEQ ID NO., Having a monoclonal antibody or a fragment thereof anti-PCSK9 cited in the adjacent column. CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 465; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 463; US8168762B2 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 222, 229, 238, 405, 407, 409, 411, 413, 415, 417; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 247, 256, 265, 404, 406, 408, 410, 412, 414, 416; US20120020976A1 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 461, 465, 485; CDRH-IDIP ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 459, 463, 483; US20130085265A1 SEQ ID NO comprising a monoclonal antibody or anti-PCSK9 fragment thereof which are incorporated by reference from the patent application numbers cited in the adjacent column. A patent or patent application which is incorporated by reference in its entirety, and specifically with respect to SEQ ID NOs comprising a monoclonal antibody or a fragment thereof anti-PCSK9 cited in the adjacent column. CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 461, 465, 485; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 459, 463, 483; US20130079501A1 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 158, 162, 395, 473, 477; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 180, 175, 308, 368, 471, 475; US20120213797A1 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416; US20120251544A1 SEQ ID NO comprising a monoclonal antibody or anti-PCSK9 fragment thereof which are incorporated by reference from the patent publication numbers cited in the adjacent column. A patent or patent application which is incorporated by reference in its entirety, and specifically with respect to SEQ ID NOs comprising a monoclonal antibody or a fragment thereof anti-PCSK9 cited in the adjacent column. CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33, 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 461, 465, 485 CDRH - SEQ ID NO: 47, 48, 49, 50 , 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 459, 463, 483; US20130052201A1 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 , 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417, 461, 465, 485 CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416, 459, 463, 483; US20130058944A1 CDRL - SEQ ID NO: 5, 7, 9, 10, 12, 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 2q, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54 ', 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416; US20130079502A1 SEQ ID NO comprising a monoclonal antibody or fragment thereof Patent or patent application which is incorporated by reference into its entirety, and specifically by reference from the reference numbers to SEQ ID Nos. NO comprising a publication of monoclonal antibody or fragment patent applications cited in the adjacent column. of it anti-PCSK9 quoted in the adjacent column. CDRL - SEQ ID NO: 5, 7, 9, 10, 12, US20130245235A1 13, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 26, 28, 30, 31, 32, 33 35, 36, 37, 38, 39, 40, 42, 44, 46, 405, 407, 409, 411, 413, 415, 417; CDRH - SEQ ID NO: 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 64, 65, 67, 69, 71, 72, 74, 76, 77, 78, 79, 80, 81, 83, 85, 87, 89, 91, 404, 406, 408, 410, 412, 414, 416;

Claims (34)

REVENDICATIONS1. An anti-human PCSK9 ligand for use in a method of treating and / or preventing a PCSK9 mediated disease or condition in a human whose genome comprises a nucleotide sequence selected from the group consisting of SEQ IDs NO: 29-37, wherein the method comprises administering the ligand to human, characterized in that said ligand is an antibody or an antibody fragment. The ligand of claim 1, wherein the ligand has been or is determined to be capable of binding human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq and q forms. A ligand that binds a human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 4-27 for use in a method comprising the step of using the ligand to target said PCSK9 in a human being. method for treating and / or preventing a PCSK9 mediated disease or condition, the method comprising administering the ligand to human, characterized in that said ligand is an antibody or an antibody fragment. The ligand of claim 3, wherein the genome of the human comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29-37. A ligand according to any one of the preceding claims wherein the human has been or is genotyped as being positive for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the domain coding sequence catalytic or C-terminal domain thereof. A ligand according to any one of the preceding claims wherein the human has been or is phenotyped to be positive for a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj and q or at least the catalytic or C-terminal domain thereof. A ligand according to any one of the preceding claims wherein the method comprises genotyping the human being as being positive for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof. A ligand according to any one of the preceding claims, wherein the method comprises phenotyping the human being as being positive for a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h , aj and q or at least the catalytic domain thereof. A ligand according to any one of the preceding claims, wherein the human has been or is genotyped as being heterozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof; optionally where the human being has been or is genotyped as comprising the nucleotide sequence of SEQ ID NO: 28 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof and a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof. A ligand according to any one of claims 1 to 9, wherein the genome of the human being has been or is genotyped to be homozygous for a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof. A ligand according to any one of the preceding claims, wherein the ligand comprises an antibody binding site which binds a human PCSK9 comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 4-27 and optionally has been or is determined to be capable of such binding. A ligand according to any one of claims 1 to 10, wherein (i) the ligand comprises a sequence of consecutive nucleotides which hybridises specifically to a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29 to 37 or least to the coding sequence for the catalytic domain or C-terminal domain thereof, or specifically hybridizes to an antisense sequence or an RNA transcript of said sequence, wherein said sequence of consecutive nucleotides hybridizes at least to a nucleotide present in said selected sequence that is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence or an RNA transcript thereof, respectively; and / or (ii) the ligand comprises a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or is an antisense sequence or an RNA version of said consecutive nucleotides, wherein said sequence of consecutive nucleotides comprises at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28. A ligand according to any one of the preceding claims, wherein said disease or condition is hyperlipidemia, hypercholesterolemia, heart attack, stroke, coronary artery disease, atherosclerosis or cardiovascular disease or condition. A ligand according to any one of the preceding claims, wherein said disease or condition is associated with elevated LDL-cholesterol. A ligand according to any one of the preceding claims, wherein the ligand inhibits the binding of human PCSK9 to the human LDL receptor and optionally has been determined to be capable of such inhibition. A ligand according to any one of the preceding claims wherein the human is substantially resistant to statin-based treatment of said disease or condition. A ligand according to any one of the preceding claims, wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human (i) whose genome comprises SEQ ID NO: 29 and where the human being is of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU; or (ii) whose genome comprises SEQ ID NO: 30 and wherein the human being is of ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FIN or CEU; or (iii) whose genome comprises SEQ ID NO: 32 and where the human being is of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU ancestry; or (iv) whose genome comprises SEQ ID NO: 33 and where the human being is of LWK, ASW, YRI or CLM ancestry; or (v) whose genome comprises SEQ ID NO: 34 and where the human being is of LWK, ASW or YRI descent; or (vi) whose genome comprises SEQ ID NO: 35 and wherein the human being is of PUR, TSI, FIN or CEU ancestry; or (vii) whose genome comprises SEQ ID NO: 36 and where the human being is of LWK, ASW or YRI descent; or (viii) whose genome comprises SEQ ID NO: 37 and wherein the human being of CHS, ASW, JPT, PUR or CHB ancestry. A ligand according to any one of the preceding claims wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human being (i) which expresses the f of PCSK9 and where the human being is of ASW, YRI, GBR, TSI, CLM, LWK, MXL, JPT, PUR, IBS, FIN or CEU; or (ii) which expresses the form c of PCSK9 and where the human being is of ASW, YRI, GBR, TSI, CLM, CHB, LWK, CHS, JPT, PUR, FIN or CEU; or (iii) which expresses the p-form of PCSK9 and where the human being is of ASW, GBR, TSI, CLM, JPT, PUR, IBS, FIN or CEU parentage; or (iv) which expresses the form m of PCSK9 and where the human being is of LWK, ASW, YRI or CLM ancestry; or (v) which expresses the e form of PCSK9 and where the human being is of LWK, ASW or YRI descent; or (vi) who expresses the form h of PCSK9 and where the human being is of PUR, TSI, FIN or CEU ancestry; or (vii) which expresses the form aj of PCSK9 and where the human being is of LWK, ASW or YRI descent; or (viii) which expresses the q form of PCSK9 and where the human being is CHS, ASW, JPT, PUR or CHB. A ligand according to any one of the preceding claims, wherein the ligand is an antibody or an antibody fragment that specifically binds to a human PCSK9 selected from the forms: f, c, m, e, h, p, q and aj, wherein the antibody or fragment comprises a VH domain derived from the recombination of a human VH gene segment, a human D gene segment and a human JH gene segment, the VH gene segment comprising a nucleotide sequence which comprises SEQ ID NO: 39 or its complement. The ligand of claim 19, wherein the VH gene segment is VH3-23 * 04 (SEQ ID NO: 38). The ligand of claims 19 or 20, wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human expressing a human PCSK9 selected from the forms: f, c, m, e, h, p, q and aj. The ligand of any one of claims 19 to 21, wherein the ligand is for the treatment and / or prevention of a PCSK9 mediated disease or condition in a human being of ASW, LWK descent. , YRI, CEU or GBR. 23. A pharmaceutical composition for the treatment and / or prevention of a PCSK9 mediated disease or condition as defined in claim 15 or 16, said composition comprisinga ligand according to any one of the preceding claims; optionally a statin, preferably atorvastatin; optionally in combination with a label or instructions for use in treating and / or preventing said disease or condition in a human being, said label or instructions including instructions for administering alirocumab or evolocumab to said human ; and optionally an IV or injection device which comprises the ligand and optionally a statin. 24. A method for producing an anti-human PCSK9 antibody binding site, the method comprising obtaining a plurality of anti-PCSK9 antibody binding sites, screening the antibody binding sites for binding to a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq and q forms or a catalytic or C-terminal domain or a peptide thereof which comprises a amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and isolation of an antibody binding site which binds in the screening step, and optionally the production of a PCSK9-binding fragment or derivative of f, c, r, p, In, e, h, aj or q form of the isolated antibody. A method of producing an anti-human PCSK9 antibody, the method comprising immunizing a non-human vertebrate (e.g., mouse or rat) with human PCSK9 comprising an amino acid sequence selected from group consisting of amino acid sequences of the forms f, c, r, p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises a variation of amino acid from the corresponding sequence of SEQ ID NO: 1, 2 or 3 and the isolation of an antibody that binds a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj and q or a catalytic or C-terminal domain or a peptide thereof which comprises an amino acid variation from the corresponding sequence of SEQ ID NO: 1, 2 or 3, and optionally the production of a fragment or a PCSK9-binding derivative of f, c, r, p, m, e, h, aj or q form of the isolated antibody. The method according to claims 24 or 25, comprising the step of obtaining a nucleic acid encoding the antibody, the fragment, the derivative or the binding site and optionally the insertion of the nucleic acid into a nucleic acid. expression vector. 27. Kit for the genotyping of PCSK9 of a human, wherein the kit comprises a nucleic acid (i) comprising a sequence of consecutive nucleotides that specifically hybridizes to a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or at least the coding sequence for the catalytic domain or the C-terminal domain thereof, or specifically hybridizes to an antisense sequence or an RNA transcript of said sequence, wherein said consecutive nucleotide sequence is at least one nucleotide hybrid present in said selected sequence that is not present in SEQ ID NO: 28 or hybridizes to an antisense sequence or an RNA transcript thereof; and / or (ii) comprising a sequence of at least 10 consecutive nucleotides of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 to 37 or comprising an antisense sequence or an RNA version of said nucleotide sequence consecutive, wherein said sequence of consecutive nucleotides comprises at least one nucleotide present in said selected sequence which is not present in SEQ ID NO: 28, characterized in that said kit comprises a ligand according to any one of claims 1 to 22 or an antibody, fragment or derivative produced by the method of any one of claims 24 to 26. 28. Use of an anti-PCSK9 ligand that binds human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aq and q forms in the manufacture of a medicament for the treatment and / or in the prevention of a PCSK9 mediated disease or condition in a human whose genome comprises a nucleotide sequence selected from the group consisting of SEQ ID NOS: 29 to 37, optionally for treatment and / or the prevention of a PCSK9 mediated disease or condition in a human as recited in claims 17 or 18, characterized in that said ligand is an antibody or an antibody fragment. 29. Use of an anti-PCSK9 ligand that binds a human PCSK9 selected from the group consisting of f, c, r, p, m, e, h, aj, and q forms in the manufacture of a drug for the targeting of said PCSK9 in a human to treat and / or prevent a PCSK9 mediated disease or condition, possibly for targeting PCSK9 in a human as recited in claims 18 or 18. 30. Use according to claim 28 or 29, wherein the ligand, human, disease or condition is according to any one of claims 1 to 22. 31. A method of genotyping PCSK9 of a nucleic acid sample of a human, the method comprising identifying in the sample the presence of a nucleotide sequence selected from the group consisting of SEQ ID NO: 29 at 37 or the coding sequence for the catalytic or C-terminal domain thereof, characterized in that said method comprises the use of a ligand according to any one of claims 1 to 22 or an antibody, a fragment or a derivative produced by the process of any one of claims 24 to 26 for carrying out said identifying step. 32. A method of typing PCSK9 of a protein sample of a human, the method comprising identifying in the sample the presence of a human PCSK9 selected from the group consisting of f, c, r , p, m, e, h, aj and q, characterized in that said method comprises the use of a ligand according to any one of claims 1 to 22 or an antibody, a fragment or a derivative produced by the process according to any one of claims 24 to 26 for carrying out said identification step. The method of claims 31 or 32, comprising obtaining a sample of serum, blood, stool, hair, tissue, cells, urine or saliva from a human, from which the nucleic acid or protein sample is obtained and used in the step of identifying said sequence. 34. A diagnostic, therapeutic or prophylactic kit comprising a ligand that is capable of binding or has been or is determined to be capable of binding to an amino acid sequence selected from SEQ ID NOS: 4 to 27 and instructions for performing the method according to any one of claims 34 to 36 and / or a label or instructions indicating or covering the administration of the ligand to a human as defined in any one of claims 1 to 22, characterized in that said kit comprises a ligand according to any one of claims 1 to 22.