EP4669654A1 - Rekombinante adeno-assoziierte virusvektoren ohne immundominantes t-zell-epitop und verwendung davon - Google Patents

Rekombinante adeno-assoziierte virusvektoren ohne immundominantes t-zell-epitop und verwendung davon

Info

Publication number
EP4669654A1
EP4669654A1 EP24716481.7A EP24716481A EP4669654A1 EP 4669654 A1 EP4669654 A1 EP 4669654A1 EP 24716481 A EP24716481 A EP 24716481A EP 4669654 A1 EP4669654 A1 EP 4669654A1
Authority
EP
European Patent Office
Prior art keywords
seq
aav
aav9
arginine
vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24716481.7A
Other languages
English (en)
French (fr)
Inventor
Ronit JOLLES-MAZOR
Sojin BING
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
US Department of Health and Human Services
Original Assignee
US Department of Health and Human Services
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by US Department of Health and Human Services filed Critical US Department of Health and Human Services
Publication of EP4669654A1 publication Critical patent/EP4669654A1/de
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0008Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
    • A61K48/0025Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
    • A61K48/0041Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being polymeric
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • Recombinant AAV vectors engineered to lack the T cell epitope maintained their functions and potency, including yield, cellular specificity, in vitro and in vivo transduction efficacy, and biodistribution in mice, while not eliciting any cellular immune responses.
  • the present disclosure addresses the unmet need for AAV vectors with reduced immunogenicity and improved safety.
  • isolated nucleic acid molecules that encode a modified AAV virion VP1 protein lacking a native CD4 T cell epitope.
  • the modified AAV VP1 protein has an amino acid sequence at least 75% identical to the wild type AAV serotype 9 (AAV9) VP1 protein set forth as SEQ ID NO: 1 and includes one or more amino acid substitutions that result in a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314, a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1.
  • vectors that include a modified VP1-encoding nucleic acid molecule disclosed herein.
  • the vector is an AAV vector, such as an AAV1, AAV2, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV13 vector.
  • the AAV vector is an AAV9 vector.
  • the AAV vector further includes a heterologous open reading frame (ORF), such as a therapeutic gene.
  • ORF heterologous open reading frame
  • Host cells that include an isolated nucleic acid molecule or vector disclosed herein are further provided.
  • the modified AAV VP1 protein has an amino acid sequence at least 75% identical to the wild type AAV9 VP1 protein set forth as SEQ ID NO: 1 and includes one or more amino acid substitutions that result in a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314, a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at 9531-109705-02 position 317 of SEQ ID NO: 1.
  • the AAV vector particle can be, for example, an AAV1, AAV2, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV13 vector particle.
  • the AAV vector particle further includes an AAV genome, such as a recombinant AAV genome that includes a heterologous ORF (e.g., a therapeutic gene).
  • AAV genome such as a recombinant AAV genome that includes a heterologous ORF (e.g., a therapeutic gene).
  • Compositions that include a pharmaceutically acceptable carrier and a recombinant AAV vector or a recombinant AAV vector particle disclosed herein are also provided.
  • a method of administering a therapeutic gene to a subject by administering to the subject a recombinant AAV vector particle disclosed herein, wherein the vector particle includes a recombinant AAV genome containing the therapeutic gene.
  • isolated VP1-derived peptides that include a CD4 T cell epitope.
  • the isolated peptide is no more than 40 amino acids in length and includes the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6.
  • Kits that include an isolated peptide disclosed herein are further provided. Such kits can be used, for example, for immune monitoring assays. Further provided are methods of inducing immune tolerance against AAV in a subject by administering to the subject an isolated VP1 peptide disclosed herein. In some aspects, the method further includes administering to the subject one or more immunomodulatory agents.
  • FIGS.1A-1G Rational design of chimeric AAV9 gene therapy vectors.
  • FIGS.1A-1G Rational design of chimeric AAV9 gene therapy vectors.
  • FIGS.1A-1G Rational design of chimeric AAV9 gene therapy vectors.
  • FIG.1A Responses of PBMCs obtained from 52 donors to peptide pools from AAV9 VP1 protein were measured by interleukin (IL)-2 and interferon (IFN)- ⁇ ELISpot assays.
  • PBMCs from healthy donors were stimulated with empty AAV9 capsid for 14 days, followed by restimulation with peptide pools spanning the amino acid sequence of AAV9 VP1. After 24 hours, IL-2 and IFN- ⁇ producing cells were detected by ELISpot assays.
  • IL-2 and IFN- ⁇ producing cells were detected by ELISpot assays.
  • FIG.1B Immunodominant peptides (SEQ ID NOs: 3-5) were identified in pool 9.
  • FIG.1C TNF- ⁇ and IFN- ⁇ producing cells were measured within the gated CD4 or CD8 T cells using intracellular flow cytometry staining.
  • FIG.1D CD4 or CD8 T cells in AAV9 stimulated PBMCs were depleted by microbeads and stimulated with peptides 103-105 or phytohemagglutinin (PHA).
  • PHA phytohemagglutinin
  • FIG.1E VP1 peptides 103-105 in AAV serotypes 1 to 13 were aligned using DNAstar software showing a high degree of conservation, except for amino acids R312, L313, N314, F315, and L317.
  • FIG.1F Binding affinity of peptides (SEQ ID NOs: 19-27) to 27 human leukocyte antigen 9531-109705-02 (HLA) class II alleles were predicted using the IEDB T cell epitope prediction tool. Predictions were generated using the IEDB consensus method.
  • FIGS.2A-2L The characteristics of chimeric AAV9 variants.
  • FIGS.2A-2B HEK293T were transduced with chimeric AAV9 variants harboring the GFP gene at the indicated multiplicity of infection (MOI; viral genomes (vg)/cell).
  • MOI multiplicity of infection
  • FIG.2A The percentage of GFP positive cells was determined by flow cytometry.
  • FIGGS. 2C-2D The chimeric AAV9 variants expressing NanoLuc were incubated with the indicated concentrations of pooled human serum for 1 hour.
  • HEK293T cells were transduced with the vectors at an MOI of 50000 vg/cell.
  • Transgene expression was determined by luminescence and expressed as transduction efficiency (%). Complete transduction (100%) was defined based on the result of the relative light unit (RLU) obtained from incubation of the AAV vector with fetal bovine serum. Inhibition of vector transduction by neutralizing antibody is expressed as the percentage of transduction.
  • RLU relative light unit
  • ND50 values were calculated as the dilutions needed to neutralize 50% vector transduction.
  • FIGS.2E-2H NanoLuc-expressing chimeric AAV9 variants (1 x 10 11 vg/mouse) were injected in Balb/c mice intravenously.
  • FIG.2E Representative image of NanoLuc expression in the mice 8 days after vector administration.
  • FIG.2F Quantification of NanoLuc signal in vector-injected mice on days 8, 17 and 29 days after vector administration.
  • FIGGS.2G-2H Representative images (FIG. 2G) and quantification (FIG.2H) of luciferase signal in various organs of vector-injected mice on day 29.
  • FIG.2I Quantification of viral genome in various organs of vector-injected mice on day 29.
  • FIG.2J PBMCs were stimulated with the indicated AAV vectors for 14 days. Cells were re- stimulated with individual peptide (X-axis; SEQ ID NOs: 19-27 from left to right), and the IFN- ⁇ producing cells were detected by ELISpot assays. Values are presented as mean ⁇ SD.
  • FIGGS.2K- 2L PBMCs were stimulated with the indicated AAV vectors for 14 days. Cells were re-stimulated with individual peptides (SEQ ID NO: 19, SEQ ID NO: 23 and SEQ ID NO: 27 from top to bottom), and the IFN- ⁇ (FIG.2K) and IL-2 (FIG.2L) producing cells were measured by ELISpot assays.
  • FIGS.3A-3D Representative pattern of IL-2 and IFN- ⁇ secretion in response to AAV9- derived peptides.
  • FIGS.3A-3B Healthy PBMCs were stimulated with empty AAV9 capsid for 14 days, followed by re-stimulation of AAV9 pools. After 24 hours, IFN- ⁇ (FIG.3A) and IL-2 (FIG.3B) 9531-109705-02 producing cells were detected by ELISpot assay.
  • FIGS.4A-4B Representative gating strategy.
  • FIG.4A Single cells (FSC-A/FSC-H), FSC- A versus viability dye within the single cells allow detection of live cells.
  • CD8 + or CD4 + cells within the CD3 + TCR ⁇ - population allow the identification of helper CD4 T cells or cytotoxic CD8 T cells.
  • FIG.4B Population of CD4 and CD8 T cells that were analyzed in FIG.1D.
  • FIG.5 Epitope 103-105 is HLA-DP restricted.
  • FIGS.6A-6C Comparing IFN- ⁇ secretion in response to AAV5 and AAV9 peptides.
  • FIGS.6A-6C A table listing peptides derived from AAV5 or AAV9 that are used in these assays.
  • FIGS.6B- 6C Healthy PBMCs were stimulated with empty AAV5 (FIG.6B) or AAV9 (FIG.6C) capsid for 14 days, followed by re-stimulation by indicated peptides. After 24 hours, IFN- ⁇ producing cells were detected by ELISpot assay. Fold change of spot number ⁇ size was calculated by comparing to respective media only control. Each bar shows the mean ⁇ SD.
  • FIG.7 Epitopes 103-105 are not found in functionally important amino acid sites. Functionally important amino-acid residues in AAV9 VP1 (SEQ ID NO: 1) are highlighted based on previously published data (Adachi et al., Nat Commun 5:3075, 2014).
  • FIGS.8A-8C Comparison of the transduction efficacy of chimeric AAV9 variants in other cell lines.
  • HeLa cells FIGS.8A and 8C
  • HEK293T cells FIG.8C
  • A375 cells FIGGS.8B and 8C
  • the percentage of GFP-positive cells was determined by flow cytometry.
  • Each bar shows the mean ⁇ SD. *p ⁇ 0.05, **p ⁇ 0.01, ***p ⁇ 0.001 and ****p ⁇ 0.0001.
  • P values were determined by ANOVA with Tukey's multiple comparisons test.
  • FIGS.9A-9C Comparison of the transduction efficacy of chimeric AAV9 variants with NanoLuc transgene.
  • HeLa cells (FIG.9A), HEK293T cells (FIG.9B), and A375 cells (FIG.9C) were transduced with the AAV9, AAV9-VI, AAV9-RSRVI, or AAV5 vectors that express NanoLuc at the indicated MOI. The next day, bioluminescence intensities of the cells were determined by luminometer. Each bar shows the mean ⁇ SD.
  • FIGS.10A-10B Neutralizing antibody analysis to chimeric AAV9 variants.
  • the chimeric AAV9 variants expressing NanoLuc was incubated with the indicated concentrations of human serum for 1 hour.
  • HeLa (FIG.10A) and A375 (FIG.10B) cells were transduced with the vectors at an MOI of 50,000 and AUC was calculated.
  • Transgene expressions were determined by luminescence and expressed as transduction efficiency (%).
  • FIG.12 Table showing HLA class II alleles for 12 responders.
  • FIG.13 Table showing predicted binding of modified AAV9 peptides (SEQ ID NOs: 19-27) to the IEDB major histocompatibility complex (MHC) class II alleles.
  • FIGS.14A-14C The second most prevalent epitope in pool 18 is not good a candidate for chimeric design.
  • Healthy PBMCs were stimulated with empty AAV9 capsid for 14 days, followed by re-stimulation of individual peptides (205-216) in pool 18 (FIG.14A) or AAV5 peptides that were aligned to AAV9 peptides (FIG.14B).
  • FIG.14C Binding affinity of peptides to 27 HLA class II alleles were predicted using the IEDB T cell epitope prediction tool. Predictions were generated using “the IEDB consensus method”. The number of alleles were counted if their percentile ranks predicted by the IEDB methods were below 10%.
  • FIG.15A Representative silver staining of WT and chimeric AAVs.
  • FIG.15B Representative UV chromatograms displaying the normalized UV intensities (solid line) with overlaid scatter plots showing the Full-Total Ratio (Vg/Cp) for WT and chimeric constructs.
  • SEQUENCES The nucleic acid and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and single letter code for amino acids, as defined in 37 C.F.R.1.822. Only one strand of each nucleic acid sequence is shown, but the 9531-109705-02 complementary strand is understood as included by any reference to the displayed strand.
  • SEQ ID NO: 1 is the amino acid sequence of AAV9 VP1.
  • Residues 307-327 corresponding to peptides 103-105, are underlined.
  • MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAAALEH DKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPVEQSP QEPDSSAGIGKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSS GNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFSPRDWQR LINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIP QYGYLTLNDGSQAVGRSSFY
  • SEQ ID NO: 4 is the amino acid sequence of peptide 104 (PKRLNFKLFNIQVKE).
  • SEQ ID NO: 5 is the amino acid sequence of peptide 105 (LNFKLFNIQVKEVTD).
  • SEQ ID NOs: 6-18 are the amino acid sequences of the peptides shown in FIG.1E.
  • AAV9 GFRPKRLNFKLFNIQVKEVTD SEQ ID NO: 6 9531-109705-02
  • AAV6 GFRPKRLNFKLFNIQVKEVTT SEQ ID NO: 12 AAV7 GFRPKKLRFKLFNIQVKEVTT SEQ ID NO: 13 SE G.1F, FIG.2J and FIG.13.
  • KRLNFKLFNIQVKEV SEQ ID NO: 19 KRLRFKLFNIQVKEV SEQ ID NO: 20
  • SEQ ID NOs: - an - are t e am no ac sequences o t e peptides shown in FIG.6A.
  • SEQ ID NO: 35 is the amino acid sequence of a modified AAV9 VP1 protein with F315V and L317I substitutions (AAV9-VI; substitutions indicated by bold underline).
  • the present disclosure describes studies to identify and eliminate immunodominant T cell epitopes within the AAV capsid. Elimination of capsid T cell epitopes enables the development of improved AAV gene therapy vectors that are less immunogenic.
  • circulating AAV capsid specific T cells increased concurrently with liver enzyme, resulting in transgene expression loss in a few weeks (Mingozzi et al., Nat Med 13:419-422, 2007).
  • the rational design of AAV vectors by replacing components that contain epitopes for T cell recognition has a direct benefit to many gene therapies.
  • AAV adeno-associated virus AUC area under the curve DLS dynamic light scattering HLA human leukocyte antigen IFN interferon IL interleukin ITR inverted terminal repeat MHC major histocompatibility complex MOI multiplicity of infection ND50 50% neutralization dose
  • ORF open reading frame PBMC peripheral blood mononuclear cell PHA phytohemagglutinin RLU relative light unit 9531-109705-02 TCR T cell receptor TLR toll-like receptor TNF tumor necrosis factor vg viral genome VP1 virion protein 1 WT wild type III. Summary of Terms Unless otherwise noted, technical terms are used according to conventional usage. Definitions of many common terms in molecular biology may be found in Krebs et al.
  • an antigen includes singular or plural antigens and can be considered equivalent to the phrase “at least one antigen.”
  • the term “comprises” means “includes.” It is further to be understood that any and all base sizes or amino acid sizes, and all molecular weight or molecular mass values, given for nucleic acids or polypeptides are approximate, and are provided for descriptive purposes, unless otherwise indicated.
  • Adeno-associated virus A small, replication-defective, non-enveloped virus that infects humans and some other primate species. AAV is not known to cause disease and elicits a mild immune response. Gene therapy vectors that utilize AAV can infect both dividing and quiescent cells and can persist in an extrachromosomal state without integrating into the genome of the host cell.
  • AAV vector refers to a nucleic acid AAV-based vector.
  • a disclosed AAV vector includes 5' and 3' inverted terminal repeats (ITRs), a heterologous promoter and/or a heterologous ORF (such as a therapeutic gene).
  • AAV vector particle refers to a viral particle made up of AAV capsid proteins, which include virion protein 1 (VP1), VP2 and VP3.
  • the AAV vector particle includes a VP1 protein lacking an immunodominant T cell epitope.
  • the AAV vector particle further includes an AAV genome, such as a genome including 5' and 3' ITRs, a heterologous promoter and/or a heterologous ORF (such as a therapeutic gene).
  • an agent such as a therapeutic agent (e.g., a recombinant AAV), by any effective route.
  • routes of administration include, but are not limited to, injection (such as subcutaneous, intramuscular, intradermal, intraperitoneal, intravenous, intratumoral, or renal vein injection), oral, intraductal, sublingual, rectal, transdermal, intranasal, vaginal and inhalation routes.
  • Codon-optimized A nucleic acid molecule encoding a protein (such as a modified AAV VP1) can be codon-optimized for expression of the protein in a particular organism by including the codon most likely to encode a particular amino acid at each position of the sequence. Codon usage bias is the difference in the frequency of occurrence of synonymous codons (encoding the same amino acid) in coding DNA.
  • a codon is a series of three nucleotides (a triplet) that encodes a specific amino acid residue in a polypeptide chain or for the termination of translation. There are 20 different naturally occurring amino acids, but 64 different codons (61 codons encoding for amino acids plus 3 stop codons).
  • a nucleic acid sequence can be optimized for expression in a particular organism (such as a human) by evaluating the codon usage bias in that organism and selecting the codon most likely to encode a particular amino acid.
  • Multivariate statistical methods such as correspondence analysis and principal component analysis, are widely used to analyze variations in codon usage.
  • Computer programs are available to implement the statistical analyses related to codon usage, such as Codon W, GCUA, and INCA.
  • Degenerate variant A polynucleotide encoding a protein (for example, a modified VP1 protein) that includes a sequence that is degenerate as a result of the genetic code.
  • heterologous Originating from a different genetic source. In the context of the present disclosure, a heterologous ORF refers to an ORF that is not native to AAV.
  • Host cells Cells in which a vector can be propagated and its nucleic acid expressed.
  • the term also includes any progeny of the subject host cell. It is understood that all progeny may not be identical to the parental cell since there may be mutations that occur during replication. However, such progeny are included when the term “host cell” is used.
  • the cell may be prokaryotic or eukaryotic, such as a mammalian cell, yeast cell, insect cell, or bacterial cell. In some aspects, the cell is a human cell.
  • Human leukocyte antigen (HLA) Proteins encoded by the MHC gene complex. HLAs from MHC Class I include HLA-A, HLA-B, and HLA-C genes.
  • HLAs from MHC Class II include 9531-109705-02 HLA-DM, HLA-DO, HLA-DP, HLA-DQ, and HLA-DR genes. HLA genes are highly variable, with up to hundreds of variant alleles at some loci.
  • Immune tolerance The prevention or inhibition of an immune response against a particular antigen.
  • Immunomodulatory agent An agent that stimulates or suppresses the immune system. Immunosuppressive agents can be used to reduce immune responses against foreign antigens, transplanted tissue/organs and to treat some types of autoimmune disease.
  • immunosuppressive agents include, for example, cyclosporine A, tacrolimus, sirolimus, prednisone, dexamethasone, azathioprine, cyclophosphamide, and certain types of monoclonal antibodies.
  • immunostimulatory agents enhance the immune system, such as for promoting immune responses against infectious agents and tumors.
  • immunostimulatory agents include, but are not limited to, BCG, LPS, recombinant cytokines (e.g., IL-2, IL-1, IL-12 and IFN- ⁇ ), and antigen- specific antibodies (such as tumor-specific antibodies, such as 3F8, Abagovomab, Adecatumumab, Afutuzumab, Alacizumab , Alemtuzumab, Altumomab pentetate, Anatumomab mafenatox, Apolizumab, Arcitumomab, basiliximab, Bavituximab, Bectumomab, Belimumab, Besilesomab, Bevacizumab, Bivatuzumab mertansine, Blinatumomab, Brentuximab vedotin, Cantuzumab mertansine, Capromab pendetide, Catumaxoma
  • ITR Inverted terminal repeat
  • Nucleic acid molecules and proteins that have been “isolated” include those purified by standard purification methods. The term also embraces nucleic acid molecules and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acid molecules and proteins. Isolated does not require absolute purity, and can include proteins, peptides, nucleic acids, viruses, or cells that are at least 50% pure, such as at least 75%, 80%, 90%, 95%, 98%, 99%, or even 99.9% pure.
  • a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
  • a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
  • operably linked DNA sequences are contiguous and, where necessary to join two protein-coding regions, in the same reading frame.
  • Pharmaceutically acceptable carrier Remington: The Science and Practice of Pharmacy, 22 nd ed., London, UK: Pharmaceutical Press, 2013), describes compositions and formulations suitable for pharmaceutical delivery of one or more therapeutic compounds, molecules or agents (e.g., AAV vectors).
  • parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle.
  • pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
  • Promoter A region of DNA that directs/initiates transcription of a nucleic acid (e.g., a gene).
  • a promoter includes necessary nucleic acid sequences near the start site of transcription. Typically, promoters are located near the genes they transcribe. A promoter also optionally includes distal enhancer or repressor elements which can be located as much as several thousand base pairs from the start site of transcription. Promoters can be constitutive, inducible, tissue-specific and/or ubiquitous.
  • Recombinant A recombinant nucleic acid molecule is one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination can be accomplished by chemical synthesis or by the artificial manipulation of isolated segments of nucleic acid molecules, such as by genetic engineering techniques.
  • a recombinant virus is a virus comprising sequence (such as genomic sequence) that is non-naturally occurring or made by artificial combination of at least two sequences of different origin.
  • sequence such as genomic sequence
  • the term “recombinant” also includes nucleic acids, proteins and 9531-109705-02 viruses that have been altered solely by addition, substitution, or deletion of a portion of a natural nucleic acid molecule, protein, or virus.
  • Sequence identity The identity or similarity between two or more nucleic acid sequences, or two or more amino acid sequences, is expressed in terms of the identity or similarity between the sequences. Sequence identity can be measured in terms of percentage identity; the higher the percentage, the more identical the sequences are.
  • Sequence similarity can be measured in terms of percentage similarity (which takes into account conservative amino acid substitutions); the higher the percentage, the more similar the sequences are.
  • Homologs or orthologs of nucleic acid or amino acid sequences possess a relatively high degree of sequence identity/similarity when aligned using standard methods. Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith & Waterman, Adv. Appl. Math.2:482, 1981; Needleman & Wunsch, J. Mol. Biol.48:443, 1970; Pearson & Lipman, Proc. Natl. Acad. Sci.
  • Biol.215:403- 10, 1990 is available from several sources, including the National Center for Biological Information (NCBI) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. Additional information can be found at the NCBI web site.
  • Serotype A group of closely related microorganisms (such as viruses) distinguished by a characteristic set of antigens.
  • AAV has at least 13 known natural serotypes, designated AAV1 to AAV13.
  • Subject Living multi-cellular vertebrate organisms, a category that includes human and non- human mammals (such as mice, rats, cats, dogs, rabbits, sheep, horses, cows, goats, pigs, and non- human primates).
  • RNA molecule e.g., a microRNA or short hairpin RNA (shRNA)
  • a therapeutic gene can inhibit, reduce or eliminate one or more signs or symptoms of a disease, disorder or condition, or can increase survival and/or life expectancy of a subject treated with the therapeutic gene.
  • Therapeutic genes are further described in section VI.
  • a vector is a nucleic acid molecule allowing insertion of foreign nucleic acid without disrupting the ability of the vector to replicate and/or integrate in a host cell.
  • a vector can include nucleic acid sequences that permit it to replicate in a host cell, such as an origin of replication.
  • a vector can also include one or more selectable marker genes and other genetic elements.
  • An expression vector is a vector that contains the necessary regulatory sequences to allow transcription and translation of inserted gene or genes.
  • the vector is an AAV vector.
  • Virion protein 1 (VP1) One of three capsid proteins of AAV. The AAV cap gene encodes VP1, VP2 and VP3, which assemble to form a protein shell of 60 subunits. IV.
  • AAV adeno-associated virus
  • the modified AAV VP1 protein has an amino acid sequence at least 75% identical to the wild type AAV9 VP1 protein set forth herein as SEQ ID NO: 1 and includes one or more amino acid substitutions that result in a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314, a
  • the modified VP1 includes a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1.
  • reference to positions 311, 312, 314, 315 and 317 means the positions that correspond to positions 311, 312, 314, 315 and 317 of SEQ ID NO: 1.
  • the AAV is AAV1, AAV2, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV13.
  • the AAV is AAV9.
  • the AAV vector is a hybrid of two or more AAV serotypes (such as, but not limited to, AAV2/1, AAV2/7, AAV2/8 or AAV2/9). 9531-109705-02 The selection of AAV serotype will depend in part on the cell type(s) that are targeted for gene therapy.
  • the amino acid sequence of the modified VP1 protein is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 1, and has a valine at position 315 and an isoleucine at position 317 (and may also have an arginine at position 311, a serine at position 312, and/or an arginine at position 314, such as 1, 2 or all 3 of these) all with reference to SEQ ID NO: 1.
  • the amino acid sequence of the modified VP1 protein includes or consists of SEQ ID NO: 35 (AAV9-VI) or SEQ ID NO: 36 (AAV9-RSRVI).
  • the amino acid sequence of the modified VP1 protein is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 1, and has an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314,
  • the nucleic acid molecule is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 37 or SEQ ID NO: 38, and encodes a valine at position 315 and an isoleucine at position 317 (and may also encode an arginine at position 311, a serine at position 312, and/or an arginine at position 314, such as 1, 2 or all 3 of these) all with reference to SEQ ID NO: 1.
  • the nucleic acid molecule includes or consists of the sequence of SEQ ID NO: 37 (or a degenerate variant thereof) or SEQ ID NO: 38 (or a degenerate variant thereof).
  • the nucleic acid sequence is codon-optimized for expression in mammalian cells, such as in human cells, dog cells, pig cells, cat cells, or non-human primate cells.
  • vectors that include an isolated nucleic acid molecule described herein.
  • the isolated nucleic acid molecule is operably linked to a promoter.
  • the promoter is a tissue-specific promoter.
  • tissue-specific promoters include, for example, thyroxin binding globulin (TBG) promoter, insulin promoter, glucagon promoter, somatostatin promoter, mucin-2 promoter, pancreatic polypeptide (PPY) promoter, synapsin-1 (Syn) promoter, retinoschisin promoter, K12 promoter, CC10 promoter, surfactant protein C (SP-C) promoter, PRC1 promoter, RRM2 promoter, uroplakin 2 (UPII) promoter, or lactoferrin promoter.
  • TSG thyroxin binding globulin
  • PPY pancreatic polypeptide
  • Syn synapsin-1
  • K12 promoter CC10 promoter
  • SP-C surfactant protein C
  • PRC1 promoter PRC1 promoter
  • RRM2 uroplakin 2
  • UPII uroplakin 2
  • the promoter is a constitutive promoter, such as the Rous sarcoma virus LTR promoter, cytomegalovirus (CMV) promoter, SV40 promoter, dihydrofolate reductase promoter, ⁇ - actin promoter, phosphoglycerol kinase (PGK) promoter or EF1 ⁇ promoter.
  • the 9531-109705-02 promoter is an inducible promoter.
  • inducible promoters examples include the zinc-inducible sheep metallothionine (MT) promoter, the dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter, the T7 polymerase promoter system, the tetracycline-repressible system, the tetracycline-inducible system, the RU486-inducible system, and the rapamycin-inducible system.
  • the vector further includes other regulatory sequences, such as one or more enhancers.
  • the vector is an AAV vector, such as an AAV1, AAV2, AAV3, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV13 vector.
  • the AAV vector is an AAV9 vector.
  • the AAV vector is a hybrid of two or more AAV serotypes (such as, but not limited to, AAV2/1, AAV2/7, AAV2/8 or AAV2/9).
  • the AAV vector includes 5' and 3' ITRs.
  • the AAV vector further includes a heterologous open reading frame (ORF), such as a therapeutic gene.
  • ORF heterologous open reading frame
  • the therapeutic gene can be any nucleic acid sequence (such as a DNA or cDNA sequence) encoding a protein or an inhibitory nucleic acid molecule (such as an inhibitory RNA molecule, e.g., a microRNA or shRNA) that is useful in the treatment or prevention of a disease, disorder, or condition.
  • an inhibitory nucleic acid molecule such as an inhibitory RNA molecule, e.g., a microRNA or shRNA
  • therapeutic genes are provided in section VI.
  • isolated host cells that include a nucleic acid molecule or vector disclosed herein.
  • the isolated host cell is a cell (or cell line) appropriate for production of recombinant AAV.
  • the host cell is a mammalian cell, such as a HEK-293, BHK, Vero, RD, HT-1080, A549, Cos-7, ARPE-19, or MRC-5 cell.
  • the cells are 293 cells or a derivative thereof (e.g., FREESTYLE 293-F cells).
  • FREESTYLE 293-F cells Also provided herein are recombinant AAV vector particles that include a nucleic acid molecule encoding a VP1 protein as disclosed herein.
  • recombinant AAV vector particles that include a modified VP1 protein having an amino acid sequence at least 75% identical to SEQ ID NO: 1, wherein the modified VP1 protein has includes one or more amino acid substitutions that result in a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1; an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314, a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes a valine at position 315 and an isoleucine at position 317 of SEQ ID NO: 1.
  • the modified VP1 includes an arginine at position 311, a serine at position 312, an arginine at position 314, a valine at position 315, and an isoleucine at position 317 of SEQ ID NO: 1.
  • reference to positions 311, 312, 314, 315 and 317 means the positions that correspond to positions 311, 312, 314, 315 and 317 of SEQ ID NO: 1.
  • the AAV is AAV1, AAV2, AAV6, AAV7, AAV8, AAV9, AAV10 or AAV13.
  • the AAV is AAV9.
  • the AAV vector is a hybrid of two or more AAV serotypes (such as, but not limited to, AAV2/1, AAV2/7, AAV2/8 or AAV2/9). The selection of AAV serotype will depend in part on the cell type(s) that are targeted for gene therapy.
  • the amino acid sequence of the modified VP1 protein is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 1, and has a valine at position 315 and an isoleucine at position 317 (and may also have an arginine at position 311, a serine at position 312, and/or an arginine at position 314, such as 1, 2 or all 3 of these) all with reference to SEQ ID NO: 1.
  • the amino acid sequence of the modified VP1 protein includes or consists of SEQ ID NO: 35 (AAV9-VI) or SEQ ID NO: 36 (AAV9-RSRVI).
  • the amino acid sequence of the modified VP1 protein is at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 1, and has an arginine at position 314 of SEQ ID NO: 1; an arginine at position 314 and a valine at position 315 of SEQ ID NO: 1; an arginine at position 314 and an isoleucine at position 317 of SEQ ID NO: 1; or an arginine at position 314,
  • the recombinant AAV vector particle further includes an AAV genome.
  • the AAV genome includes 5' and 3' ITRs.
  • the AAV vector further includes a heterologous ORF, such as a therapeutic gene.
  • the therapeutic gene can be any nucleic acid sequence (such as a DNA or cDNA sequence) encoding a protein or an inhibitory nucleic acid molecule (such as an inhibitory RNA molecule, e.g., a microRNA or shRNA) useful in the treatment or prevention of a disease, disorder, or condition.
  • Non-limiting examples of therapeutic genes are provided in section VI.
  • the recombinant AAV vector particles are administered at a dose of about 1 x 10 10 to about 1 x 10 14 viral particles (vp)/kg. In some examples, the AAV vector particles are administered at a dose of about 1 x 10 11 to about 1 x 10 13 vp/kg or at a dose of about 1 x 10 12 vp/kg.
  • compositions that include a disclosed recombinant AAV vector particle and a pharmaceutically acceptable carrier, such as water or saline.
  • a pharmaceutically acceptable carrier such as water or saline.
  • the composition is a liquid, frozen, or lyophilized.
  • the compositions are formulated for intravenous, transdermal, intraocular, intrathecal, intracerebral, oral, subcutaneous, intranasal, inhalation or intramuscular administration. Suitable pharmaceutical formulations for administration of AAV can be found, for example, in U.S.
  • isolated peptides that contain the immunodominant CD4 T cell epitope (or a portion thereof) disclosed herein.
  • the isolated peptide is no more than 40 amino acids in length and includes the amino acid sequence of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6.
  • the peptide is no more than 39, no more than 38, no more than 37, nor more than 36, no more than 35, no more than 34, no more than 33, no more than 32, no more than 31, no more than 30, no more than 29, no more than 28, no more than 27, no more than 26, no more than 25, no more than 24, no more than 23, no more than 22 or no more than 21 amino acids in length.
  • the isolated peptide is 21-40, 25-40, 30-40, or 35-40 amino acids in length.
  • the amino acid sequence of the peptide consists of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5 or SEQ ID NO: 6. Further provided are methods of inducing immune tolerance against AAV in a subject.
  • the method includes administering to the subject one or more of the isolated peptides disclosed herein.
  • the peptides can be administered in multiple doses, such as 2, 3, 4 or 5 doses.
  • the method further includes administering to the subject one or more immunomodulatory agents.
  • the immunomodulatory agent is cyclosporine A, tacrolimus, sirolimus, prednisone, dexamethasone, azathioprine, cyclophosphamide, or a monoclonal antibody.
  • the peptide(s) is/are encapsulated in a nanoparticle or a microparticle.
  • kits that include one or more isolated peptides disclosed herein.
  • kits can be used, for example, for immune monitoring assays.
  • a kit includes one or more recombinant AAV vector particles disclosed herein, for example for use with the therapeutic methods provided herein.
  • the kit further includes solid support(s), buffer(s), syringe(s), container(s) and/or instructional material(s).
  • the instructional materials may be written, in an electronic form or may be visual (such as video files).
  • V. Recombinant AAV for Gene Therapy Applications AAV belongs to the family Parvoviridae and the genus Dependovirus. AAV is a small, non- enveloped virus that packages a linear, single-stranded DNA genome.
  • the AAV genome is characterized by two inverted terminal repeats (ITRs) that flank two open reading frames (ORFs).
  • ITRs inverted terminal repeats
  • ORFs open reading frames
  • the first 125 nucleotides of the ITR are a palindrome, which folds upon itself to maximize base pairing and forms a T-shaped hairpin 9531-109705-02 structure.
  • the other 20 bases of the ITR called the D sequence, remain unpaired.
  • the ITRs are cis- acting sequences important for AAV DNA replication; the ITR is the origin of replication and serves as a primer for second-strand synthesis by DNA polymerase.
  • the double-stranded DNA formed during this synthesis which is called replicating-form monomer, is used for a second round of self- priming replication and forms a replicating-form dimer.
  • These double-stranded intermediates are processed via a strand displacement mechanism, resulting in single-stranded DNA used for packaging and double-stranded DNA used for transcription.
  • Located within the ITR are the Rep binding elements and a terminal resolution site (TRS). These features are used by the viral regulatory protein Rep during AAV replication to process the double-stranded intermediates.
  • the ITR is also needed for AAV genome packaging, transcription, negative regulation under non-permissive conditions, and site-specific integration (Daya and Berns, Clin Microbiol Rev 21(4):583-593, 2008).
  • the left ORF of AAV contains the Rep gene, which encodes four proteins – Rep78, Rep 68, Rep52 and Rep40.
  • the right ORF contains the Cap gene, which produces three viral capsid proteins (VP1, VP2 and VP3).
  • the AAV capsid contains 60 viral capsid proteins arranged into an icosahedral symmetry. VP1, VP2 and VP3 are present in a 1:1:10 molar ratio (Daya and Berns, Clin Microbiol Rev 21(4):583-593, 2008).
  • AAV is a frequently used virus for gene therapy. Although AAV infects humans and some other primate species, it is not known to cause disease and elicits a mild immune response. Gene therapy vectors that utilize AAV can infect both dividing and quiescent cells and persist in an extrachromosomal state without integrating into the genome of the host cell. AAV possesses several desirable features for a gene therapy vector, including the ability to bind and enter target cells, enter the nucleus, the ability to be expressed in the nucleus for a prolonged period of time, and relatively low toxicity. However, the small size of the AAV genome limits the size of heterologous DNA that can be incorporated. To minimize this obstacle, AAV vectors have been constructed that do not encode Rep and the integration efficiency element (IEE).
  • IEE integration efficiency element
  • the ITRs are retained as they are cis signals needed for packaging (Daya and Berns, Clin Microbiol Rev 21(4):583- 593, 2008).
  • Methods for producing rAAV suitable for gene therapy are well known (see, for example, U.S. Patent Application Nos.2012/0100606; 2012/0135515; 2011/0229971; and 2013/0072548; U.S. Patent No.11,578,340; and Ghosh et al., Gene Ther 13(4):321-329, 2006), and can be utilized with the recombinant nucleic acid molecules, vectors and methods disclosed herein. VI.
  • the recombinant AAV vectors disclosed herein can optionally include a heterologous ORF, such as a therapeutic gene, for use in gene therapy.
  • the therapeutic gene can encode any protein (or functional fragment thereof) that is useful in the treatment, inhibition, gene editing, or prevention of a 9531-109705-02 disease, disorder or condition.
  • the therapeutic gene can encode an inhibitory nucleic acid molecule, such as an inhibitory RNA (e.g., a microRNA or shRNA).
  • an inhibitory RNA e.g., a microRNA or shRNA
  • Non-limiting examples of therapeutic genes that can be used in the AAV vectors and vector particles disclosed herein are listed below (see also U.S. Patent No.11,578,340).
  • the therapeutic gene encodes a growth factor, interleukin, interferon, anti- apoptosis factor, cytokine, anti-diabetic factor, anti-apoptosis agent, coagulation factor, or anti-tumor factor.
  • the therapeutic gene is the BDNF, CNTF, CSF, EGF, FGF, G-SCF, GM- CSF, gonadotropin, IFN, IFG-1, M-CSF, NGF, PDGF, PEDF, TGF, VEGF, TGF-B2, TNF, prolactin, somatotropin, XIAP1, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-10 (187A), viral IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16 IL-17, or IL-18 gene.
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene is a gene for treating a disease associated with the reduced expression, loss of expression or dysfunctional expression of a gene.
  • genes include genes encoding, for example, glucose-6-phosphatase, phosphoenolpyruvate-carboxykinase, galactose- 1 phosphate uridyl transferase, phenylalanine hydroxylase, branched chain alpha-ketoacid dehydrogenase, fumarylacetoacetate hydrolase, methylmalonyl-CoA mutase, medium chain acyl CoA dehydrogenase, ornithine transcarbamylase, argininosuccinic acid synthetase, low density lipoprotein receptor protein, UDP-glucouronosyltransferase, adenosine deaminase, hypoxanthine guanine phosphoribosyl transferase, biotinidase, beta-glucocerebrosidase, beta-glucuronidase, peroxisome membrane protein 70 kDa, porphobilinogen deamina
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene is useful in the treatment of a disease, condition or disorder associated with the central nervous system.
  • the therapeutic gene is DRD2, GRIA1, GRIA2, GRIN1, SLC1A1, SYP, SYT1, CHRNA7, 3 Rtau/4 rTUS, APP, BAX, BCL- 2, GRIK1, GFAP, IL-1, AGER, UCH-L1, SKP1, EGLN1, Nurr-1, BDNF, TrkB, gstm1, S106 ⁇ , IT15, PRNP, JPH3, TBP, ATXN1, ATXN2, ATXN3, Atrophin 1, FTL, TITF-1, FXN, ASPA, DMD, SMN1, UBE1, or DYNC1H1.
  • the therapeutic gene is a gene useful in the treatment of a disease, disorder or condition associated with the cardiovascular system.
  • the gene is VEGF, FGF, SDF-1, connexin 40, connexin 43, SCN4a, HIF1 ⁇ , SERCa2a, ADCY1, or ADCY6.
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene is a gene useful in the treatment of a disease, disorder or condition associated with the pulmonary system.
  • the gene is TNF ⁇ , TGF ⁇ 1, SFTPA1, SFTPA2, SFTPB, SFTPC, HPS1, HPS3, HPS4, ADTB3A, IL1A, IL1B, LTA, IL6, CXCR1, or CXCR2.
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene is a gene useful in the treatment of a disease, disorder or condition associated with the liver (e.g., ⁇ 1-AT, HFE, ATP7B, fumarylacetoacetate hydrolase (FAH), glucose-6-phosphatase, NCAN, GCKR, LYPLAL1, or PNPLA3), kidney (e.g., PKD1, PKD2, PKHD1, NPHS1, NPHS2, PLCE1, CD2AP, LAMB2, TRPC6, WT1, LMX1B, SMARCAL1, COQ2, PDSS2, SCARB3, FN1, COL4A5, COL4A6, COL4A3, COL4A4, FOX1C, RET, UPK3A, BMP4, SIX2, CDC5L, USF2, ROBO2, SLIT2, EYA1, MYOG, SIX1, SIX5, FRAS1, FREM2, GATA3, KAL1, PAX2, TCF2, or SALL1), eye (e.g., CFH,
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene is a gene useful in the treatment of a cancer.
  • the gene is AARS, ABCB1, ABCC4, ABI2, ABL1, ABL2, ACK1, ACP2, ACY1, ADSL, AK1, AKR1C2, AKT1, ALB, ANPEP, ANXA5, ANXA7, AP2M1, APC, ARHGAP5, ARHGEF5, ARID4A, ASNS, ATF4, ATM, ATP5B, ATP5O, AXL, BARD1, BAX, BCL2, BHLHB2, BLMH, BRAF, BRCA1, BRCA2, BTK, CANX, CAP1, CAPN1, CAPNS1, CAV1, CBFB, CBLB, CCL2, CCND1, CCND2, CCND3, CCNE1, CCT5, CCYR61, CD24, CD44, CD
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • the therapeutic gene that modulates apoptosis such as RPS27A, ABL1, AKT1, APAF1, BAD, BAG1, BAG3, BAG4, BAK1, BAX, BCL10, BCL2, BCL2A1, BCL2L1, BCL2L10, BCL2L11, BCL2L12, BCL2L13, BCL2L2, BCLAF1, BFAR, BID, BIK, NAIP, BIRC2, BIRC3, XIAP, BIRC5, BIRC6, BIRC7, BIRC8, BNIP1, BNIP2, BNIP3, BNIP3L, BOK, BRAF, CARD10, CARD11, NLRC4, CARD14, NOD2, NOD1, CARD6, CARDS, CARDS, CASP1, CASP10, CASP14, CASP2, C
  • the therapeutic gene encodes an inhibitory nucleic acid molecule that modulates (such as inhibits) expression of one of the above-listed genes.
  • EXAMPLES The following examples are provided to illustrate particular features of certain aspects of the disclosure, but the scope of the claims should not be limited to those features exemplified.
  • Example 1 Materials and Methods This example describes the materials and experimental procedures used for the studies described in Example 2.
  • Plasmid and DNA mutagenesis For production of rAAV, plasmids pAAV2/9n (112865, Addgene, Watertown, MA), pAAV2/5n (104964, Addgene), pHelper vector (340202, Cell Biolabs, San Diego, CA), pscAAV- GFP (AAV-410, Cell Biolabs), and pAAV-CMV-NanoLuc-Halotag (Promega, Madison, WI) were used. Empty capsids were produced by transfecting pHelper and pAAV2/9n or pAAV2/5n. Plasmid mutagenesis was performed by Gene Universal (Newark, DE).
  • AAV particles in the lysates and medium were recovered by polyethylene glycol (PEG) precipitation.
  • PEG polyethylene glycol
  • GFP-expressing and NanoLuc-expressing AAVs were generated using the standard triple transfection method (Bing et al., Mol Ther Methods Clin Dev 24:255-267, 2022). Briefly, Viral Production Cells 2.0 (Thermo Fisher Scientific) were transfected and harvested 72 hours thereafter. After three freeze-thaw cycles, sonication and BENZONASE TM treatment, AAVs were purified using two successive ultracentrifugation rounds in iodixanol gradients. For sham control, all procedures were identical except for the presence of the Rep/Cap plasmid.
  • the capsid protein in the vectors was quantified using an AAV5 or AAV9 ELISA kit (Progen, Wayne, PA).
  • the copy titers of vector 9531-109705-02 genomes were determined using Taqman quantitative PCR (qPCR) as previously described (Bing et al., Mol Ther Methods Clin Dev 24:255-267, 2022).
  • qPCR Taqman quantitative PCR
  • Peptide synthesis A total of 24215-mer peptides overlapping 12 amino acids as well as chimeric and AAV5 VP1 derived peptides were purchased from GenScript Biotech (Piscataway, NJ). The peptides cover the entire sequence of VP1 from the AAV9 capsid.
  • PBMC samples Peripheral mononuclear cells (PBMCs) were collected from apheresis samples of 52 healthy donors. Samples were isolated using gradient-density separation by Ficoll-Hypaque (GE Healthcare, Chicago, IL) according to the manufacturer’s instructions, and cryopreserved in liquid nitrogen until assayed.
  • DMSO dimethyl sulfoxide
  • PBMCs Peripheral mononuclear cells
  • HLA typing was performed as described previously by Scisco Genetics (Seattle, WA) (Puig et al., Front Immunol 11:629399, 2020).
  • PBMCs were thawed and resuspended at a concentration of 5 ⁇ 10 6 cells/mL in RPMI media containing 5% heat-inactivated human serum, 1% GLUTAMAX TM (Thermo Fisher Scientific), 1 mM sodium pyruvate (Thermo Fisher Scientific), 10 mM HEPES (Thermo Fisher Scientific), MEM Non- Essential Amino Acids (Thermo Fisher Scientific), and 1% penicillin/streptomycin (Thermo Fisher Scientific).
  • PBMCs were stimulated with heated empty AAV9 capsid, empty AAV5 capsid, or mutated AAVs (2 x 10 10 vp/mL).
  • cells were supplemented with fresh assay medium containing 20 units of IL-2 (MilliporeSigma, Burlington, MA), 5 ⁇ g/mL of IL-7 (Biolegend, San Diego, CA), and 25 ⁇ g/mL of IL-15 (Biolegend) every 3-4 days after initial antigenic stimulation.
  • IL-2 International Reactive intestinal polypeptide
  • IL-7 Biolegend, San Diego, CA
  • IL-15 Biolegend
  • ELISpot assay The secretion of IL-2 and IFN- ⁇ was analyzed using an ELISpot assay according to the manufacturer’s recommendations (Mabtech, Cincinnati, OH). After in vitro expansion, cells were harvested, and incubated at a density of 100,000 cells/well either with peptide pools or individual peptides (10 ⁇ g/mL) in plates pre-coated with anti-human IL-2 or IFN- ⁇ antibodies. Negative controls were treated with medium, and positive controls were treated with CEF, CEFT (PANATecs, Baden- Wuerttemberg, Germany) or PHA (MilliporeSigma).
  • spots were developed with 9531-109705-02 biotin-conjugated anti-IL-2 or anti-IFN- ⁇ antibody (Mabtech, Nacka Strand, Sweden), streptavidin alkaline phosphate (Mabtech), and nitro blue tetrazolium and 5-bromo-4-chloro-3'-indolyl phosphate (BCIP/NBT) substrate (KPL, Thermo Fisher Scientific).
  • Computer software (Immunospot 7.0; Cellular Technology Limited, Cleveland, OH) was used to enumerate spots forming cells (SFC). For IFN- ⁇ analysis, spot size was incorporated into the analysis by multiplying the spot counts by the average spot size per well.
  • CD4 T cells were purified by negative selection using magnetic beads and LD columns (Miltenyi Biotec, Bergisch Gladbach, Germany), and CD8 T cells were isolated by positive selection using magnetic beads and LS columns (Miltenyi Biotec) according to the manufacturer’s protocol.
  • HLA restriction assay expanded PBMC with AAVs were incubated with 20 ⁇ g/mL monoclonal Abs against HLA Class I (W6/32), HLA-DR (G46-6), HLA-DQ (SPV-L3), or HLA-DP (B7/21) 30 minutes prior to peptide addition. Cytokine production against positive peptides was then measured by ELISpot assay as described above. FACS After in vitro expansion, cells were restimulated with 10 ⁇ g/mL peptides for 24 hours at 37°C.
  • Cytokine secretion in cell cultures was blocked by the addition of GolgiPlug/GolgiStop (BD Biosciences, San Jose, CA) for 5 hours prior to cell harvesting and staining.
  • Cells were stained for surface markers CD3 (clone UCHT1), CD4 (clone SK3), CD8 (clone RPA-T8), CD56 (clone HCD56), and TCR ⁇ (clone 11F2). After washing, cells were fixed and permeabilized using CYTOFIX/CYTOPERM solution (BD Biosciences) and then stained for IFN- ⁇ (clone B27), and TNF- ⁇ (clone MAb11).
  • HLA binding ranking was predicted for each 9-mer peptide with 27 HLA class I alleles (Weiskopf et al., Proc Natl Acad Sci USA 110:E2046-2053, 2013), and 15-mer peptide with 27 HLA class II alleles (Wang et al., BMC Bioinformatics 11:568, 2010). These alleles represent binding specificities that are shared by the majority of the world's population (Wang et al., BMC Bioinformatics 11:568, 2010; Weiskopf et al., Proc Natl Acad Sci USA 110:E2046-2053, 2013). Percentile rank offers a consistent scale that enables comparisons between various predictors.
  • affinities are indicated by a lower 9531-109705-02 percentile rank value.
  • Potential binders in AAV9 VP1 were identified using an initial cutoff of percentile ranks less than 1% or 10% for HLA class I or class II allele, respectively.
  • HeLa, HEK293T or A375 cells were seeded in 96-well plates at a final density of 2 ⁇ 10 4 cells/well in DMEM (Thermo Fisher) media containing 10% fetal bovine serum (FBS, Millipore sigma), and penicillin/streptomycin.
  • Wyatt Technology) were attached in series with the HPLC.
  • the MALS detector was fitted with an internal dynamic light scattering fiber for simultaneous in-line DLS measurements (detection angle of 135°).
  • the system was equipped with a XBridge Premier GTx BEH size exclusion column (7.8 mm x 30 cm, 2.5 ⁇ m particle size, 450 ⁇ pore size, Waters Corporation, Milford, MA).
  • the mobile phase used for all injections was 10 mM sodium phosphate, 350 mM sodium chloride, 0.001 vol/vol% Pluronic® F-68, pH 7.4.
  • Flow rate was maintained at 0.5 mL/min for all injections. Injections were performed using VISION® 3.2.0.67 9531-109705-02 (Waters
  • mice On days 8, 17, and 29, mice were injected with 0.44 ⁇ mol of fluorofurimazine (Promega), anesthetized with isoflurane, and imaged after 3 ⁇ 1 minutes using an IVIS spectrum imager (PerkinElmer, Waltham, MA). On day 29, mouse organs were extracted and rinsed in PBS before being analyzed with an IVIS imager. By subtracting the signal from the same organ of the sham controls, signal quantification in specific regions of interest (ROIs) were corrected for background.
  • ROIs regions of interest
  • Example 2 Identification of immunodominant epitopes in the AAV9 capsid To identify the immunodominant epitopes in the AAV9 capsid, 242 overlapping peptides that span the sequence of AAV9 VP1, and human PBMCs from a cohort of 52 donors with a distribution of HLA alleles comparable to that in the North American population, were used. The peptides were put into pools, each containing 12 overlapping peptides. Only pools that tested positive on the IL-2 and IFN- ⁇ ELISpot assays were deconvoluted to determine which specific peptides contained the epitopes.
  • FIG.1A shows heat maps of the responses of the 52 donors.
  • IL-2 and IFN- ⁇ response rates to pool 9 were 17% and 23%, respectively; and to pool 18, 23% and 19%, respectively.
  • Stimulation with the individual peptides that constitute these pools revealed that pool 9 contained most immunodominant epitope (peptide 103-105) in AAV9 capsid protein (FIG.1A and FIGS.3A-3D) while pool 18 contained the second and third most immunodominant epitopes (FIG.14A and Table 2).
  • the immunodominant epitope in AAV9 was identified as containing between 307 and 327 amino acids (FIG.1B) and immune response to this epitope was found in 23% (12 of 52) of donor samples (Table 1).
  • Reacted T cell types is defined by intracellular flow cytometry, if the number of IL-2, IFN- ⁇ , or TNF- ⁇ producing cells were more than 1.5 fold changes compared to media only controls, and confirmed by ELISpot assay. 3 HLA binding predictions were using IEDB class I and class II prediction tools. To phenotype this epitope, cells were restimulated with peptides 103-105 and intracellular cytokine flow cytometry was used to distinguish between CD4 and CD8 activation, as shown in FIG. 4A, and it was found that peptides 103-105 stimulated IFN- ⁇ and TNF- ⁇ secretion in CD4 but not in CD8 T cells (FIG.1C).
  • Non-conserved amino acids were found in the AAV5 serotype (R299, S300, R312, V313, and I315), which is the most distantly related to AAV9 in the AAV phylogeny tree.
  • PBMCs 3 donors were chosen at random from 12 donors) were expanded with AAV5 empty capsid and restimulated with AAV5 peptides that were aligned to epitope 307-327 (peptides 103-105) in AAV9.
  • the AAV5 peptide did not stimulate cells to produce IFN- ⁇ , indicating that epitope 307-327 does not exist in AAV5 (FIGS.6A-6C).
  • AAV9-VI variant two residues were replaced with corresponding AAV5 amino acids (F315V and L317I), and AAV9-RSRVI was designed by replacing five residues with AAV5 sequences (K311R, R312S, N314R, F315V, and L317I). These mutations have a low risk of affecting transduction efficacy or cell interaction because they are not located on the surface of the AAV9 capsid or on known functionally critical amino acids (FIG.1G and FIG.7).
  • AAV9, AAV9-VI and AAV9-RSRVI transduced cells with similar efficiency and significantly better than the AAV5 vector with 80% higher AUC (FIGS.2A, 2B and 8C) indicating that the rational design in AAV9-VI and AAV9-RSRVI did not compromise the ability of the vector to transduce cells. Similar results were observed in other cell lines (HeLa and A375) or with a different transgene (Hall et al., ACS Chem Biol 7:1848-1857, 2012) (NanoLuc) (FIGS.8A-8B and 9A-9C). It was then investigated whether AAV9 mutations affected the vector neutralization by anti-AAV antibodies.
  • the vectors containing the NanoLuc transgene were incubated with a series of dilutions of pooled human serum and 50% neutralization dose (ND50) was calculated.
  • the ND50 among the AAV9 and mutant vectors were not different in any of three cell lines, indicating that the mutations had no effect on vector neutralization (FIGS.2C-2D and 10A-10B).
  • vectors with the 9531-109705-02 NanoLuc transgene or a sham control were injected intravenously into Balb/c mice.
  • AAV9 showed strong expression in the liver, heart, muscle, and thymus, which is consistent with previously published data (Zincarelli et al., Mol Ther 16:1073-1080, 2008), whereas expression with AAV5 was weak and mostly restricted to the liver and lung (FIG.2G). Additional analysis for viral genome biodistribution using droplet digital PCR (ddPCR) showed the strong infection of AAV ITR in the liver, spleen, kidney, and thymus of AAV9 group (FIG.2I). Unlike the transgene expression data, AAV9-RSRVI was transduced less in the liver and spleen, while AAV9-VI did not show any difference in the genome expressions in the tissues (FIG.2I).
  • ddPCR droplet digital PCR
  • AAV9-RSRVI showed reduced transduction efficiency in the liver and spleen
  • AAV9-VI still had similar biodistribution of transgene and vector genome to that of the parental AAV vector (AAV9), indicating that the rational design had no effect on vector tropism (FIGS.2G-2I).
  • the rational design eliminated the immunodominant epitope 307-327 (peptides 103-105). Restimulation of PBMCs with mutated peptides after expansion with mutated vectors did not activate the cells to produce IFN- ⁇ , in contrast to the AAV9 expanded group, suggesting that the rational design successfully silenced the immunodominant epitope in the AAV9 capsid (FIGS.2K-2L).
  • FIG.11 shows that none of the peptide pools activated the PBMCs when cells were expanded with mutated chimeric vectors, indicating that immune silencing resulted in complete elimination of the epitope without the generation of subdominant epitopes.
  • a further study investigated engineering of the second most prevalent epitope in pool 18 using the chimeric design strategy. Deconvolution of the individual peptides in pool 18 showed two distinct and strong epitopes in peptides 215-216 and in peptides 205-206 (FIG.14A and Table 2).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Medicinal Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Virology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Plant Pathology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
EP24716481.7A 2023-02-22 2024-02-21 Rekombinante adeno-assoziierte virusvektoren ohne immundominantes t-zell-epitop und verwendung davon Pending EP4669654A1 (de)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202363486299P 2023-02-22 2023-02-22
PCT/US2024/016716 WO2024178113A1 (en) 2023-02-22 2024-02-21 Recombinant adeno-associated virus vectors lacking an immunodominant t cell epitope and use thereof

Publications (1)

Publication Number Publication Date
EP4669654A1 true EP4669654A1 (de) 2025-12-31

Family

ID=90718530

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24716481.7A Pending EP4669654A1 (de) 2023-02-22 2024-02-21 Rekombinante adeno-assoziierte virusvektoren ohne immundominantes t-zell-epitop und verwendung davon

Country Status (3)

Country Link
EP (1) EP4669654A1 (de)
JP (1) JP2026508221A (de)
WO (1) WO2024178113A1 (de)

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6759050B1 (en) 1998-12-03 2004-07-06 Avigen, Inc. Excipients for use in adeno-associated virus pharmaceutical formulations, and pharmaceutical formulations made therewith
US7261544B2 (en) 2003-05-21 2007-08-28 Genzyme Corporation Methods for producing preparations of recombinant AAV virions substantially free of empty capsids
ES2751999T3 (es) 2008-01-29 2020-04-02 Applied Genetic Tech Corporation Producción recombinante de virus adeno-asociados usando células BHK en suspensión
WO2010114948A2 (en) 2009-04-02 2010-10-07 University Of Florida Research Foundation, Inc. An inducible system for highly efficient production of recombinant adeno-associated virus (raav) vectors
WO2011094198A1 (en) 2010-01-28 2011-08-04 The Children's Hospital Of Philadelphia Research Institute, Abramson Research Center A scalable manufacturing platform for viral vector purification and viral vectors so purified for use in gene therapy
WO2015164757A1 (en) * 2014-04-25 2015-10-29 Oregon Health & Science University Methods of viral neutralizing antibody epitope mapping
AU2017341849B2 (en) 2016-10-13 2024-03-21 University Of Massachusetts AAV capsid designs
CN116547008A (zh) * 2020-09-23 2023-08-04 艾柏力维亚生技有限公司 用于增加病毒载体的效力的化合物

Also Published As

Publication number Publication date
JP2026508221A (ja) 2026-03-10
WO2024178113A1 (en) 2024-08-29

Similar Documents

Publication Publication Date Title
RU2683497C2 (ru) Композиция и способы высокоэффективного переноса генов с помощью вариантов капсида aav
JP6348064B2 (ja) 効率の高いトランスジーン送達のためのウイルスベクター
US6962815B2 (en) AAV2 vectors and methods
EP1696036B1 (de) Rekombinante AAV zur Herstellung eines Medikaments für die Gentherapie von Muskelzellen
US7749492B2 (en) AAV vectors and methods
US20170007720A1 (en) Methods and compositions for gene delivery to on bipolar cells
JP2009535339A (ja) 低下されたキャプシド免疫原性を有する改変aavベクターおよびその使用
CN115151648A (zh) 用于治疗cdkl5缺陷障碍的基因疗法
TW201741458A (zh) 治療a型血友病之基因治療
HU230406B1 (hu) Eljárás adeno-asszociált vírus(AAV)szekvenciák detektálására és/vagy azonosítására és az azzal azonosított új szekvenciák izolálására
US20010006955A1 (en) Method for recombinant adeno-associated virus-directed gene therapy
JP2007535550A (ja) アデノウイルスおよびアデノ随伴ウイルス媒介投与を介する免疫原性分子の連続的な送達
TW202229315A (zh) 改良的腺相關病毒(aav)載體及其用途
JP2025527658A (ja) 組換えアデノ随伴ウイルス及びその使用
RU2761879C1 (ru) Вакцина на основе AAV5 для индукции специфического иммунитета к вирусу SARS-CoV-2 и/или профилактики коронавирусной инфекции, вызванной SARS-CoV-2
RU2760301C1 (ru) Вакцина на основе AAV5 для индукции специфического иммунитета к вирусу SARS-CoV-2 и/или профилактики коронавирусной инфекции, вызванной SARS-CoV-2
US20230250422A1 (en) Cpg-free itrs for aav gene therapy
WO2024178113A1 (en) Recombinant adeno-associated virus vectors lacking an immunodominant t cell epitope and use thereof
Choules et al. Prospective approaches to gene therapy computational modeling–spotlight on viral gene therapy
CN115244181B (zh) 阿司匹林化合物在增加核酸表达中的新型用途
CN117947040A (zh) 用于目的基因的表达盒及其应用
HK40013015A (en) Virus vectors for highly efficient transgene delivery
Zaiss et al. 745. Innate Immune Responses to Adeno-Associated Virus Vectors
NZ792477A (en) Aav capsid designs

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20250915

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR