EP4662308A1 - Fucanases et leur utilisation pour hydrolyser des polysaccharides - Google Patents

Fucanases et leur utilisation pour hydrolyser des polysaccharides

Info

Publication number
EP4662308A1
EP4662308A1 EP24703559.5A EP24703559A EP4662308A1 EP 4662308 A1 EP4662308 A1 EP 4662308A1 EP 24703559 A EP24703559 A EP 24703559A EP 4662308 A1 EP4662308 A1 EP 4662308A1
Authority
EP
European Patent Office
Prior art keywords
fuc
sulfated
seq
sequence
enzyme
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24703559.5A
Other languages
German (de)
English (en)
Inventor
Jasna NIKOLIC
Gurvan Michel
Elizabeth FICKO-BLEAN
Robert LAROCQUE
Lauralee PIERRE
David ROPARTZ
Mathieu FANUEL
Hélène ROGNIAUX
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Sorbonne Universite
Institut National de Recherche pour lAgriculture lAlimentation et lEnvironnement
Original Assignee
Centre National de la Recherche Scientifique CNRS
Sorbonne Universite
Institut National de Recherche pour lAgriculture lAlimentation et lEnvironnement
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Sorbonne Universite, Institut National de Recherche pour lAgriculture lAlimentation et lEnvironnement filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP4662308A1 publication Critical patent/EP4662308A1/fr
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/24Hydrolases (3) acting on glycosyl compounds (3.2)
    • C12N9/2402Hydrolases (3) acting on glycosyl compounds (3.2) hydrolysing O- and S- glycosyl compounds (3.2.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/02Monosaccharides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/04Polysaccharides, i.e. compounds containing more than five saccharide radicals attached to each other by glycosidic bonds
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/14Preparation of compounds containing saccharide radicals produced by the action of a carbohydrase (EC 3.2.x), e.g. by alpha-amylase, e.g. by cellulase, hemicellulase
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y302/00Hydrolases acting on glycosyl compounds, i.e. glycosylases (3.2)
    • C12Y302/01Glycosidases, i.e. enzymes hydrolysing O- and S-glycosyl compounds (3.2.1)

Definitions

  • the present invention relates to a novel glycoside hydrolase enzyme, in particular to at least one novel fucanase, to nucleic acid sequences encoding this enzyme, to a vector comprising said coding sequence, to a method for manufacturing this glycoside hydrolase enzyme, as well as to a method for degrading sulfated fucans using this enzyme.
  • the present invention finds application mainly in the field of agriculture, animal and human nutrition, cosmetics, pharmacy, etc., but also in the field of laboratory research, in particular for the production of molecules or for the fine analysis of the structure and compositions of sulfated fucan polysaccharides of various natures and origins.
  • references in square brackets ([ ]) refer to the list of references presented at the end of the text.
  • FCSPs fucose-containing sulfated polysaccharides
  • Sulfated fucans are homopolymers of L-fucose with many substitutions, e.g. sulfate, acetyl, branching groups, while fucoidans are heteropolymers containing sulfated L-fucoses, but whose main chain is made up of various neutral and/or uronic monosaccharides, e.g. xylofucoglucuromannans, fucoglucuronans, fucogalactans [1].
  • FCSPs play essential roles in brown algae, connecting the cellulose fibers of cell walls and being involved in many cellular processes e.g.
  • FCSPs FCSPs and their derived oligosaccharides on animal and human cells have been described, including antioxidant and anti-inflammatory activities (Pomin VH: Sulfated glycans in inflammation.
  • FCSPS oligosaccharides and/or monomers
  • hydrolysis processes there are many hydrolysis processes in the state of the art. For example, acid or radical hydrolysis are chemical methods or processes frequently used to fragment a polysaccharide. However, these hydrolysis processes or methods are random, namely that the cleavage can be done on all or part of the compound to be hydrolyzed, for example a polysaccharide and can in particular alter the structure of the oligosaccharides obtained after hydrolysis.
  • the alteration of compounds obtained, for example oligosaccharides obtained causes in particular a modification or even the suppression of the biological properties of said compounds/oligosaccharides.
  • GHs specific glycoside hydrolases
  • An endo-fucanase was identified in 2006 in a marine fucanolytic bacterium (Mariniflexile fucanivorans SI/l/5) isolated from a plant alginate extraction plant (Landerneau, Brittany, France) (Barbeyron T, L'Haridon S, Michel G, Czjzek M: Mariniflexile fucanivorans sp. nov., a marine member of the Flavobacteriaceae that degrades sulphated fucans from brown algae.
  • FcnA definition of a novel glycoside hydrolase family specific for sulfated fucans 2006, 16:1021-1032 [9]). FcnA specifically cleaves the ⁇ -1,4 bond in sulfated fucans of brown algae of the order Fucales (EC 3.2.1.212).
  • This enzyme is the founding member of the GH107 family [9] and its use is described in particular in a patent document (Yvin JC, Colin S, Cloarec B, Barbeyron T: Recombinant endofucanase., WO 2006/008379 [10]).
  • a second family of glycoside hydrolases containing endo-fucanases has also been described, the GH168 family including the FunA enzyme (Shen J, Chang Y, Zhang Y, Mei X, Xue C: Discovery and Characterization of an Endo-1,3-Fucanase From Marine Bacterium Wenyingzhuangia fucanilytica: A Novel Glycoside Hydrolase Family. Frontiers in Microbiology 2020, 11:1674 [13]).
  • the FunA enzyme from the marine bacterium Wenyingzhuangia fucanilytica is an endo-a-1,3-fucanase (EC 3.2.1.211).
  • the present invention aims precisely to meet this need by providing a glycoside hydrolase enzyme, for example a fucanase, for example an endo-a-1,4-fucanase.
  • a glycoside hydrolase enzyme for example a fucanase, for example an endo-a-1,4-fucanase.
  • a glycoside hydrolase enzyme for example an endo-fucanase, in particular an endo-a-1,4-fucanase, advantageously makes it possible to hydrolyze polysaccharides from brown algae.
  • this enzyme can be useful for the degradation of sulfated fucans and can advantageously allow the production of oligosaccharides of fucans (or oligo-fucans) having a unique chemical structure, sulfated. These sulfated oligosaccharides can be potentially interesting for applications in biomedical, cosmetic, nutrition, plant elicitation, etc.
  • the inventors have also demonstrated that these enzymes belong to a novel family of glycoside hydrolases.
  • the inventors have demonstrated that the enzymes according to the invention are distinct from the GH107 family containing other endo-a-1,4-fucanases.
  • the inventors have surprisingly and unexpectedly identified and isolated two enzymes, designated FcnB and FcnC, from the marine bacterium M. fucanivorans SW5.
  • the inventors have also isolated and produced recombinant proteins which have enzymatic activity and which endolytically hydrolyze the ⁇ -1,4-linkages of brown algae, for example brown algae of the order Fucales, for example Pelvetia canaliculata, Fucus vesiculosus and Ascophylum nodosum.
  • brown algae of the order Fucales for example Pelvetia canaliculata, Fucus vesiculosus and Ascophylum nodosum.
  • novel fucanases in particular novel endo- ⁇ -1,4-fucanases.
  • the inventors also demonstrated that the isolated enzymes endolytically hydrolyze the ⁇ -1,4-glycosidic bond of sulfated fucans from brown algae, e.g., brown algae of the order Fucales, e.g., Pelvetia canaliculata, Fucus vesiculosus, and Ascophylum nodosum.
  • brown algae e.g., brown algae of the order Fucales, e.g., Pelvetia canaliculata, Fucus vesiculosus, and Ascophylum nodosum.
  • recombinant proteins are two new endo-a-1,4-fucanases belonging to a new family of glycoside hydrolase and that these recombinant enzymes advantageously allow:
  • sulfated fucan means a sulfated polysaccharide comprising a main chain of L-fucose, which is a sugar with 6 carbon atoms whose chemical formula is C6H12O5, and comprising at least one substitution by ester-sulfate groups.
  • the sulfated fucans can, for example, designate sulfated fucans derived from brown algae. They can, for example, be sulfated fucans originating from brown algae, for example from brown algae of the order Fucales. They can, for example, be sulfated fucans whose main chain comprises L-fucose residues alternately linked by ⁇ -1,3 and ⁇ -1,4 bonds.
  • fucans may for example be sulfated fucans as described in Deniaud-Bouet E, Hardouin K, Potin P, Kloareg B, Herve C: A review about brown algal cell walls and fucose-containing sulfated polysaccharides: Cell wall context, biomedical properties and key research challenges.
  • sulfated fucans comprising disaccharide units comprising one to three sulfates as shown in Figure 1, for example comprising a disaccharide unit comprising a sulfate group: unit of type A: [ ⁇ 4)-aL-fucopyranose-2-sulfate-(1 ⁇ 3)-aL-fucopyranose-(1 ⁇ ], a disaccharide unit comprising two sulfate groups: unit of type B: [ ⁇ 4)-aL-fucopyranose-2-sulfate-(1 ⁇ 3)-aL-fucopyranose-2-sulfate-(1 ⁇ ] and/or a disaccharide unit comprising three sulfate groups: unit type C: [4 ⁇ )aL-fucopyranose-2,3-disulfate-(1 ⁇ 3)-aL-fucopyranose- 2-sulfate-(1 ⁇ ].
  • the present invention relates to an isolated glycoside hydrolase enzyme of amino acid sequence comprising or consisting of the sequence VSNADFYVSNKGSDNWSGTLANPNPQGTDGPFATLEKAKNAVRILKKSK SEDIWLIRDGVYKLNKTWFGLEDSGEGKSTITYAAYPNEQPVFSSGKEI KGWQKVTTDIPGLPNAAKGHIMVAHVSDKFLTLYDDEGMLPRAQSKGIIT GDGGNSKNKLQFPDGFLKNWSNVTDVEIKVRPHHAWISNILPLTSVDEKT STATTSIDATYAMNRLHFLPETENAVWENVLEVLDEKGEWVLN(TKEGKV YLWPRNDSQWAPQLFELIRVEGKIDKEGPTDVPVRNLHFKGLTFKHGER YTIKPNDAGLQHDWDMHDKDNALVRLRGTENCVIEQCHFLDSGSGAIRV DLYGMNNTISNNHIEHLGGGGILLCGYGPGTKDVNKKNTIYNNNIHHVG
  • amino acids are represented by their one-letter code according to the following nomenclature: A: alanine; C: cysteine; D: aspartic acid; E: glutamic acid; F: phenylalanine; G: glycine; H: histidine; I: isoleucine; K: lysine; L: leucine; M: methionine; N: asparagine; P: proline; Q: glutamine; R: arginine; S: serine; T: threonine; V: valine; W: tryptophan and Y: tyrosine.
  • the present invention relates to an isolated glycoside hydrolase enzyme of amino acid sequence comprising or consisting of a sequence having at least 65% sequence identity with the sequence SEQ ID NO: 1 or SEQ ID NO: 2. It may be, for example, an isolated glycoside hydrolase enzyme of amino acid sequence comprising or consisting of a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity with the sequence SEQ ID NO: 1 or SEQ ID NO: 2. It may be, for example, an isolated glycoside hydrolase enzyme of amino acid sequence comprising or consisting of the sequence
  • the percentage of sequence identity or similarity can be determined by any method known to those skilled in the art. It can be determined for example by the use of BLASTP and BLASTN, for example using default parameters, the sequence analysis software "needle", which uses the global alignment algorithm “Needleman-Wunsch” to find the optimal alignment (with gaps) of two sequences over their entire length available on the site ebi.ac.uk.
  • the present invention also relates to an isolated glycoside hydrolase enzyme with an amino acid sequence comprising or consisting of a sequence chosen from:
  • the glycoside hydrolase enzyme may be a fucanase, for example an endo-a-1,4-fucanase.
  • An isolated glycoside hydrolase enzyme according to the invention also comprises an isolated glycoside hydrolase enzyme derived from the sequence SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6 it being understood that this derived glycoside hydrolase enzyme retains the fucanase activity, preferably endo-a-1,4-fucanase.
  • a derived glycoside hydrolase enzyme comprises or consists of a sequence selected from: a) a sequence having at least 65% identity, for example at least 75% identity, at least 80% identity with the sequence of the residues:
  • fucanase means a protein having a catalytic function, for example an enzyme, capable of hydrolyzing fucans, for example sulfated fucans. It may be, for example, an enzyme capable of hydrolyzing sulfated polysaccharides, which are sulfated fucans.
  • endo-fucanase means a protein having a catalytic function, for example an enzyme, capable of hydrolyzing according to an endolytic mode of action the bonds of fucans, for example sulfated fucans, for example brown algae of the order Fucales. It may be endo-a-1,4-fucanase having a catalytic function, for example an enzyme, capable of hydrolyzing according to an endolytic mode of action the a-1,4 bonds of fucans, for example sulfated fucans, for example brown algae of the order Fucales.
  • Conservative substitutions are substitutions of amino acids of the same class, such as substitutions of amino acids with uncharged side chains, for example asparagine, glutamine, serine, cysteine, and tyrosine, of amino acids with basic side chains, for example lysine, arginine, and histidine, of amino acids with acidic side chains, for example aspartic acid and glutamic acid, of amino acids with nonpolar side chains, for example alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine and tryptophan.
  • amino acids with uncharged side chains for example asparagine, glutamine, serine, cysteine, and tyrosine
  • amino acids with basic side chains for example lysine, arginine, and histidine
  • amino acids with acidic side chains for example aspartic acid and glutamic acid
  • amino acids with nonpolar side chains for example alanine, valine, leucine, isoleucine, pro
  • the enzymes may further comprise, at their N-terminal end, a signal sequence or targeting sequence.
  • This signal sequence may be, for example, one of the signal sequences known to those skilled in the art so that the protein, when synthesized in a host cell, is directed to a particular organelle or area of the host cell. It may be, for example, a signal sequence found on sites specializing in the prediction of signal peptides, for example http://www.cbs.dtu.dk/services/SignalP/ [10].
  • This signal sequence may or may not be cleaved after synthesis of the protein. Cleavage methods known to those skilled in the art may be used, for example those involving proteases specific to a cleavage site. A signal sequence having such a site is then chosen.
  • glycoside hydrolase enzymes according to the invention can be prepared by any suitable method known to those skilled in the art. This may be, for example, a method comprising purification from their original organism or microorganism, by chemical synthesis or by genetic engineering, using techniques well known to those skilled in the art.
  • the glycoside hydrolase enzymes according to the invention are obtained by genetic engineering.
  • the present invention also relates to a nucleic acid encoding a fucanase, for example an endo-a-1,4-fucanase according to the invention. It may be for example a nucleic acid selected from the group comprising the nucleic acid sequence comprising or consisting of the sequence: GTTTCAAACGCTGATTTTTATGTGTCTAACAAAGGGTCCGATAATTGGT CAGGAACATTGGCGAATCCAAATCCCCAAGGTACCGACGGCCCTTTT GCCACTTTGGAAAAAAGCAAAAAATGCAGTACGTATCTTGAAAAAAAGC
  • It may be a nucleic acid comprising or consisting of a sequence having at least 67% identity with the sequence SEQ ID NO 8, for example at least 70%, 80% %, 85%, 90%, 95%, 99% identity with the sequence SEQ ID NO 8 or having at least 67% identity with the sequence SEQ ID NO 9, for example at least 70%, 80%, 85%, 90%, 95%, 99% identity with the sequence SEQ ID NO 9.
  • the percent identity between two nucleotide sequences can be determined in the same way as the percent identity between two amino acid sequences.
  • “High stringency conditions” are conditions known to those skilled in the art, and may for example correspond to hybridization conditions on DNA bound to a filter in a 5X sodium citrate (SSC) saline buffer, 2% sodium dodecyl sulfate (SDS), 100 microgram mes/mL of single-stranded DNA, at 55-65°C for 8 hours, and washing in 0.2X SSC and 0.2% SDS at 60-65°C for 30 minutes.
  • SSC sodium citrate
  • SDS sodium dodecyl sulfate
  • sequences of the derived nucleic acids may include mutations such as nucleotide substitutions, deletions and/or insertions.
  • the substitutions may either be silent or lead to mutations in the protein encoded by the nucleic acid. preferably, substitutions, deletions and/or insertions at the nucleotide sequence level do not lead to a change in reading phase, nor to the introduction of a stop codon.
  • nucleic acid chosen from the group comprising a nucleic acid consisting of the sequence SEQ ID NO 8 or SEQ ID NO 9.
  • the nucleic acids may further comprise, at their 5’ end, a sequence coding for a signal sequence or targeting sequence.
  • a sequence coding for a signal sequence or targeting sequence may be, for example, any sequence coding for a suitable signal sequence or targeting sequence known to those skilled in the art.
  • the nucleic acids may further comprise, at their 5' end, a sequence coding for a purification tag.
  • a sequence coding for a purification tag may be, for example, a nucleic acid of sequence ATGGGCAGCAGCCACCATCACCATCACCATGGATCCCTCGAC (SEQ ID NO 14).
  • the present invention also relates to nucleotide probes and/or primers comprising or consisting of a fragment of SEQ ID NO: 12 or SEQ ID NO: 13.
  • probes and primers may for example comprise or consist of 15 to 50 consecutive nucleotides, preferably 18 to 35 consecutive nucleotides, of SEQ ID NO: 12 or SEQ ID NO: 13.
  • probes and primers do not encode a glycoside hydrolase enzyme according to the invention but are useful for the cloning, sequencing and/or detection of nucleic acids according to the invention.
  • the probes may optionally be labeled, for example using a radioactive label or a fluorophore.
  • the probes and primers may comprise, in addition to a fragment of the sequence SEQ ID NO: 12 or of SEQ ID NO: 13, a heterologous sequence such as the sequence of a restriction site or a sequence for binding to a marker.
  • the nucleic acids according to the invention can be prepared by chemical synthesis or by genetic engineering using techniques well known to those skilled in the art and described, inter alia, in Molecular Cloning - A Laboratory Manual [15]. Nucleic acids according to the invention can for example be obtained by amplification of the genes of Mariniflexile fucanivorans using the PCR (Polymerase Chain Reaction) method, for example as described in Example 1. The nucleic acid fragment thus amplified can then be cloned into an expression vector according to the techniques described in Molecular Cloning - A Laboratory Manual [15] and/or in Example 1.
  • nucleotide sequence(s) encoding the glycoside hydrolase enzyme for example fucanase or endo-a-1,4-fucanase may be contained independently in an expression vector suitable for their expression.
  • the present invention also relates to a vector comprising a nucleic acid according to the invention.
  • a vector comprising a nucleic acid selected from the group comprising a nucleic acid of sequence SEQ ID NO 8, a nucleic acid of sequence SEQ ID NO 9, a nucleic acid of sequence SEQ ID NO 10, a nucleic acid of sequence SEQ ID NO 11, a nucleic acid of sequence SEQ ID NO 11 and a nucleic acid of sequence SEQ ID NO 12.
  • it may be a vector comprising a nucleic acid selected from the group comprising a nucleic acid of sequence SEQ ID NO 8 and a nucleic acid of sequence SEQ ID NO 9.
  • the vector may be one of the vectors known to those skilled in the art for producing recombinant proteins. It is generally chosen in particular according to the cellular host used.
  • the vector may be, for example, a plasmid vector, for example the vector pF04 of sequence SEQ ID NO 17, for example as shown in FIG. 2. It may also be any suitable vectors known to those skilled in the art available commercially. It may be, for example, vectors of the pET series, for example marketed by the company Novagen or Merck, the vector pGEX, for example marketed by the company VWR international, the vector pMAL, for example marketed by the company New England Biolabs, etc.
  • the expression vector may be a plasmid vector comprising, in addition to the nucleic acid sequence according to the invention, the means necessary for its expression. These means may, for example, include a promoter and a transcription terminator.
  • the expression vector may also comprise other elements such as an origin of replication, a multiple cloning site, an enhancer, a signal peptide which may be fused in phase with the polypeptide of the invention during cloning, and one or more selection markers.
  • the vector may comprise a polynucleotide sequence, for example an expression cassette, comprising the following elements in 5' to 3' order: a promoter sequence; a nucleic acid sequence encoding an enzyme of the invention; and a polyadenylation (polyA) sequence.
  • a promoter sequence for example an expression cassette, comprising the following elements in 5' to 3' order: a promoter sequence; a nucleic acid sequence encoding an enzyme of the invention; and a polyadenylation (polyA) sequence.
  • polyA polyadenylation
  • the promoter may be any promoter known to those skilled in the art. It may be, for example, a constitutive promoter, a viral gene promoter, a tissue-specific promoter.
  • viral gene promoters selected from the group comprising the CMV promoter.
  • These may be, for example, the T7 promoter, for example the promoter contained in the commercial vector pET15B, for example marketed by the company Novagen [14] coding for T7 RNA polymerase.
  • the vector can be chosen according to the selected host cell.
  • the person skilled in the art taking into account his technical knowledge, will adapt the vector according to the host cell.
  • the host cell may be any suitable host for expression of the nucleic acids or vectors of the invention. It may be, for example, mammalian cells, E. coli, Pischia pastoris, Saccharomyces cerevisiae, or insect cells, for example an insect cell-baculovirus system, for example SF9 insect cells used in a baculovirus expression system. It may be, for example, Escherichia coli.
  • the nucleic acids of the present invention or the vectors of the present invention are usable in particular for the production of the glycoside hydrolase enzyme, for example fucanase or endo-a-1,4-fucanase according to the invention.
  • the present invention also relates to a host cell comprising a nucleic acid sequence encoding a glycoside hydrolase enzyme, for example a fucanase or endo-a-1,4-fucanase or a vector encoding a glycoside hydrolase enzyme, for example a fucanase or endo-a-1,4-fucanase.
  • the present invention also relates to a host cell comprising a nucleic acid according to the invention, or a vector according to the invention.
  • the host cell or cellular host may be any suitable host for the production of a glycoside hydrolase enzyme, for example fucanase or endo-a-1,4-fucanase of the present invention from the above vectors comprising a nucleotide sequence encoding a glycoside hydrolase enzyme, for example a fucanase or endo-a-1,4-fucanase of the invention.
  • a glycoside hydrolase enzyme for example fucanase or endo-a-1,4-fucanase of the present invention from the above vectors comprising a nucleotide sequence encoding a glycoside hydrolase enzyme, for example a fucanase or endo-a-1,4-fucanase of the invention.
  • the term "host cell” means a prokaryotic or eukaryotic cell.
  • Host cells commonly used for the expression of recombinant proteins include, in particular, bacterial cells such as Escherichia coli or Bacillus sp., yeast cells such as Saccharomyces cerevisiae, fungal cells such as Aspergillus niger, insect cells, and mammalian cells (in particular human) such as the HEK 293, PER-C6, CHO cell lines, etc. These may be, for example, Escherichia coli.
  • prokaryotic and eukaryotic cells are a technique well known to those skilled in the art, for example lipofection, electroporation, heat shock, or chemical methods. Depending on the cell to be transformed, those skilled in the art will be able to easily determine the means necessary for the transformation of the chosen host cell.
  • the expression vector and the method of introducing the expression vector into the host cell will be selected according to the chosen host cell.
  • the host cell transformed by an expression vector will produce a corresponding protein, for example in recombinant form.
  • the host cell transformed by an expression vector or a nucleic acid according to the invention preferentially expresses the enzyme or protein according to the invention in a stable manner. A person skilled in the art can easily verify that the host cell produces the enzyme or protein, for example recombinant, for example using the Western blot technique.
  • the host cells according to the invention are in particular useful for producing glycoside hydrolase enzymes according to the invention.
  • the invention therefore relates to a method for producing a glycoside hydrolase enzyme according to the invention comprising the step of culturing a host cell according to the invention under conditions allowing the expression of said glycoside hydrolase enzyme according to the invention.
  • This method may further comprise a step of purifying said glycoside hydrolase enzyme according to the invention.
  • the culture and purification steps may for example be carried out as described in Example 2.
  • the present invention also relates to a method of manufacturing a glycoside hydrolase enzyme according to the invention by genetic recombination using a nucleic acid according to the invention, or a vector according to the invention.
  • the genetic recombination method may be any suitable genetic recombination method known to those skilled in the art.
  • the host cell may be any suitable cell known to those skilled in the art.
  • it may be host cells as defined above.
  • the transformation can be carried out by any method known to those skilled in the art.
  • the transformation of prokaryotic and eukaryotic cells is a technique well known to those skilled in the art, for example lipofection, electroporation, heat shock, or chemical methods.
  • lipofection for example lipofection, electroporation, heat shock, or chemical methods.
  • those skilled in the art will be able to easily determine the means necessary for the transformation of the chosen host cell.
  • the incubation can be carried out by any method known to those skilled in the art.
  • the incubation/cultivation of prokaryotic and eukaryotic cells is a technique well known to those skilled in the art. Depending on the cell, those skilled in the art will be able to easily determine the necessary means, culture medium, time and temperature conditions required for the incubation/cultivation of the chosen host cell.
  • the manufacturing method may comprise a step, after transformation and culture/incubation of the transformed cell, of purification of the glycoside hydrolase enzyme.
  • glycoside hydrolase enzyme produced can be carried out by any means known to those skilled in the art. This may be, for example, a technique chosen from electrophoresis, sieving molecular, ultracentrifugation, differential precipitation, for example with ammonium sulfate, ultrafiltration, membrane or gel filtration, ion exchange, separation by hydrophobic interactions, or affinity chromatography, for example of the IMAC type.
  • the manufacturing method may also comprise a step, after transformation and culture/incubation of the transformed cell, a step of recovering the glycoside hydrolase enzymes.
  • This recovery or isolation step may be carried out by any means known to those skilled in the art. It may be, for example, a technique chosen from electrophoresis, molecular sieving, ultracentrifugation, differential precipitation, for example with ammonium sulfate, by ultrafiltration, membrane or gel filtration, ion exchange, elution on hydroxyapatite, separation by hydrophobic interactions, or any other known means.
  • the present invention also relates to a method for degrading sulfated fucans comprising a step of bringing the sulfated fucans into contact with a glycoside hydrolase enzyme isolated according to the invention, or with a host cell according to the invention, under conditions allowing the degradation of the sulfated fucans by enzymatic digestion by said glycoside hydrolase enzyme or said host cell.
  • the determination of the degradation of sulfated fucans or the fucanolytic activity of the glycoside hydrolase enzymes isolated according to the invention can be determined or measured by any suitable method known to those skilled in the art. This may be, for example, the method described in the document Zabkackis and Perez (Zablackis E, Perez J: A partially pyruvated Carrageenan from Hawaiian Grateloupia filicina (Cryptonemiales, Rhodophyta). Botanica Marina 1990, 33:273-276.
  • [20] comprising the determination and/or monitoring of the release of sulfated fucan oligosaccharides, also called olio-fucans, by C-PAGE (Carbohydrate-PolyAcrylamide Gel Electrophoresis) or the method described in Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021 - 1032 [9],
  • the concentration of glycoside hydrolase enzyme for example fucanase, for example endo-a-1,4-fucanase used and the concentration of sulfated fucans for the degradation of sulfated fucans in the medium in which they are found or in the medium in which they have been placed.
  • the pH may preferably be between 6.5 and 8.5, preferably 7.5. This is in fact the optimum pH range.
  • the temperature is preferably between 15 and 30°C, for example 20°C.
  • the enzymatic digestion step may be carried out for a time of 12 to 36 hours, for example 24 hours.
  • the sulfated fucans may be any sulfated fucans known to those skilled in the art regardless of the origin and/or commercially available. They may be, for example, sulfated fucans comprising a main chain comprising L-fucoses linked alternately by ⁇ -1,4 and ⁇ -1,3 bonds. They may be, for example, sulfated fucans originating from algae, for example brown algae. They may be, for example, sulfated fucans originating from algae of the order Fucales, for example belonging to the class Phaeophyceae.
  • They may be, for example, sulfated fucans originating from algae selected from the group comprising Pelvetia sp., for example Pelvetia canaliculata, Ascophylum sp., for example Ascophylum nodosum, Fucus sp., for example Fucus vesiculosus.
  • the process may comprise a prior step of extraction and purification of said sulfated fucans.
  • This may be, for example, any purification and extraction process known to a person skilled in the art. to the extraction and purification of sulfated fucans from algae.
  • This may be, for example, the process described in the document Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata. International Journal of Biological Macromolecules 2021 , 201:143-157. [18].
  • the method may further comprise, after the enzymatic digestion step, a step of recovering and purifying the sulfated fucan fragments and/or oligosaccharides obtained from the enzymatic digestion of sulfated fucans.
  • This may be any suitable recovery and purification method known to those skilled in the art. This may be, for example, a method chosen from electrophoresis, molecular sieving, ultracentrifugation, differential precipitation, for example with ammonium sulfate, by ultrafiltration, membrane or gel filtration, ion exchange, elution on hydroxyapatite, separation by hydrophobic interactions, or any other known means.
  • the present invention also relates to the use of a glycoside hydrolase enzyme for the production of sulfated fucan oligosaccharides.
  • the enzyme glycoside hydrolase is as defined above.
  • sulfated fucan oligosaccharide also called oligo-fucans
  • oligo-fucans an oligosaccharide obtained by cleavage of the a-1,4 bonds within sulfated fucans comprising a main chain comprising L-fucoses linked alternately by a-1,4 and a-1,3 bonds. It may be for example an oligosaccharide composed or consisting of disaccharide repeat units of type A, B and/or C as described in Figure 1.
  • the present invention advantageously makes it possible to mobilize the very large resource of algae that is currently unexploited, in particular brown algae.
  • the invention also makes it possible to promote the biodegradation of algae, particularly brown algae, to produce original molecules, which are fragments of sulfated fucans, and to offer a new source of rare monosaccharides/oligosaccharides for cosmetic, agri-food and drug applications or pharmaceutical and parapharmaceutical formulations.
  • the invention also makes it possible to produce original molecules, which are fragments of sulfated fucans, for example oligosaccharides.
  • the present invention therefore also relates to a sulfated fucan oligosaccharide obtained according to the fucan degradation process according to the invention or the use of a glycoside hydrolase enzyme according to the invention for the production of sulfated fucan oligosaccharides.
  • the sulfated fucan oligosaccharides obtained according to the method of the invention and/or the use according to the invention may be at least one oligosaccharide comprising from 2 to 10 fucose monomers and/or comprising from 2 to 10 sulfate groups.
  • sulfated fucan oligosaccharides chosen from the group comprising oligosaccharides consisting of 4 fucose monomers comprising 4 to 7 sulfate groups, for example 4 fucose monomers comprising 4 sulfate groups, 4 fucose monomers comprising 5 sulfate groups, 4 fucoses comprising 6 sulfate groups, 4 fucoses comprising 7 sulfate groups.
  • sulfated fucan oligosaccharides selected from the group comprising oligosaccharides consisting of 6 fucose monomers comprising 6 to 10 sulfate groups, for example 6 fucose monomers comprising 6 sulfate groups, 6 fucose monomers comprising 7 sulfate groups, 6 fucose monomers comprising 8 sulfate groups, 6 fucose monomers comprising 9 sulfate groups, 6 fucose monomers comprising 9 sulfate groups and 6 fucose monomers comprising 10 sulfate groups.
  • sulfated fucan oligosaccharides selected from the group comprising oligosaccharides consisting of 8 fucose monomers comprising 6 to 10 sulfate groups, for example 8 fucose monomers comprising 6 sulfate groups, 8 fucose monomers comprising 7 sulfate groups, 8 fucose monomers comprising 8 sulfate groups, 8 fucose monomers comprising 9 sulfate groups, 8 fucose monomers comprising 9 sulfate groups and 8 fucose monomers comprising 10 sulfate groups.
  • the degradation products of sulfated fucans provide access to new products that can be food, cosmetic, pharmaceutical and parapharmaceutical active ingredients that can be used in the agri-food, cosmetic, pharmaceutical and parapharmaceutical sectors. These new products can also be non-active products but with a neutrality and/or stability that is very interesting for use in each of these sectors.
  • the present invention also opens new perspectives for the use of brown algae for applications in bioenergy and chemistry.
  • the production of oligosaccharides can provide basic molecules for the manufacture of other molecules.
  • the depolymerization of sulfated fucans should facilitate fermentation by microorganisms leading to the production of bioethanol for example.
  • Figure 1 shows diagrams of disaccharide units comprising one to three sulfates constituting the main chain of sulfated fucans from brown algae of the order Fucales including the species Pelvetia canaliculata.
  • Figure 1 A shows a diagram of a disaccharide unit comprising a sulfate group: Type A unit: [ ⁇ 4)- aL-fucopyranose-2-sulfate-(1 ⁇ 3)-aL-fucopyranose-(1 ⁇ ].
  • Figure 1 B shows a diagram of another disaccharide unit comprising two sulfate groups: type B motif: [ ⁇ 4)-aL-fucopyranose-2-sulfate-(1 ⁇ 3)-aL-fucopyranose-2-sulfate-(1 ⁇ ].
  • Figure 1 C shows a schematic of another disaccharide motif comprising three sulfate groups: type C motif: [4 ⁇ )aL-fucopyranose-2,3-disulfate-(1 ⁇ 3)-aL- fucopyranose-2-sulfate-(1 ⁇ ] (Ropartz et al.
  • Figure 2 shows a schematic of the plasmid pFO4.
  • FIG 3 shows a photograph of a C-PAGE gel obtained from samples obtained after incubation of sulfated fucans designated FCSPs (FCSP: fucose containing sulfated polysaccharides in English) from the brown algae Pelvetia canaliculata (P. canaliculata), Ascophyllum nodosum (A. nodosum) and Fucus vesiculosus (F. vesiculosus) incubated with active (even lanes) or heat-inactivated (“control”) recombinant proteins pMF8 and pMF9 (odd lanes).
  • FCSP fucose containing sulfated polysaccharides in English
  • RT means retention time
  • the y-axis corresponds to an arbitrary intensity (without unit)
  • the x-axis the mass/charge ratio (m/z)
  • the RT value indicates the order of elution of different oligosaccharides on liquid chromatography.
  • Figure 5 shows mass spectra of the oligosaccharides obtained ( Figures 5 A - P), in particular sulfated fucan oligosaccharides also called oligo-fucans, after enzymatic digestion by a glycoside hydrolase enzyme, in particular an endo-a-1,4-fucanase, in particular the recombinant protein pMF9, obtained by ultra-high performance liquid chromatography coupled with high resolution mass spectrometry (UPLC-MS).
  • a glycoside hydrolase enzyme in particular an endo-a-1,4-fucanase, in particular the recombinant protein pMF9
  • RT means retention time
  • the y-axis corresponds to an arbitrary intensity (without unit)
  • the x-axis the mass/charge ratio (m/z)
  • the RT value indicates the order of elution of the different oligosaccharides on the chromatography.
  • Figure 6A represents an MS/MS mass spectrum obtained on the product ions in the form [M+4.HxA] + at the mass to charge ratio m/z 955.6 of the oligo-fucans of degree of polymerization 2 obtained by hydrolysis of fucan by a glycoside hydrolase enzyme, in particular an endo-a-1,4-fucanases, in particular the recombinant protein pMF8.
  • Figure 6B represents a diagram of the structures of the products obtained. The nomenclature of the annotations, on the spectrum and the structures corresponds to the standard introduced in Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397- 409 [30].
  • Figure 7A represents an MS/MS mass spectrum obtained on the ions produced in the form [M+4.HxA] + at the mass to charge ratio m/z 955.6 of the oligo-fucans of degree of polymerization 2 obtained by hydrolysis of fucan by a glycoside hydrolase enzyme, in in particular an endo-a-1,4-fucanase, in particular the recombinant protein pMF9.
  • Figure 7B shows a schematic of the structures of the products obtained. The nomenclature of the annotations, on the spectrum and the structures corresponds to the standard introduced in Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397- 409 [30],
  • Figure 8 shows a bar graph corresponding to the mean intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 4 with 4, 5, 6 and 7 sulfate functions (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) without the distinction of the different isomers produced.
  • Figure 9 shows a bar graph corresponding to the average intensities) measured on analytical triplicates for oligosaccharides of degree of polymerization 6 with 6, 7, 8, 9 and 10 sulfate functions (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, 6.Fuc+10.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) without the distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Figure 10 shows a bar graph corresponding to the relative percentage of intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 4 with 4, 5, 6 and 7 sulfate functions (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) without distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Figure 11 shows a bar graph corresponding to the relative percentage of intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 6 with 6, 7, 8, 9 and 10 sulfate functions (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, 6.Fuc+ 10.
  • S produced by the digestion of the 3 enzymes pMF 4 (Fnc4) (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) without distinction of the different isomers produced.
  • Figure 12 shows a bar graph corresponding to the mean intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 4 with 4, 5, 6 and 7 sulfate functions (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) without distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Figure 13 shows a bar graph corresponding to the mean intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 6 with 6, 7, 8, 9 and 10 sulfate functions (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, 6.Fuc+10.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) with the distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Figure 14 shows a bar graph corresponding to the relative percentage of intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 4 with 4, 5, 6 and 7 sulfate functions (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) with the distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Figure 15 shows a bar graph corresponding to the relative percentage of intensities measured on analytical triplicates for oligosaccharides of degree of polymerization 6 with 6, 7, 8, 9 and 10 sulfate functions (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, 6.Fuc+10.S) produced by the digestion of the 3 pMF 4 (Fnc4) enzymes (black and white diagonals) by pMF8 (gray filling) or pMF9 (black filling) with the distinction of the different isomers produced.
  • Fnc4 3 pMF 4
  • Example 1 Identification and cloning of genes coding for glycoside hydrolase enzymes, in particular endo-a-1, 4-fucanases.
  • fcnB and FcnC Open reading frames encoding glycoside hydrolase enzymes, particularly endo- ⁇ -1,4-fucanases, designated FcnB and FcnC were identified based on the complete genome sequence of Mariniflexile fucanivorans (NCBI Accession No. NZ_SLUP00000000.1). These genes were identified and selected from a pool of candidate genes located in the M. fucanivorans genome. The enzymatic activity of the recombinant candidate proteins was then screened by C-PAGE using sulfated fucan from P. canaliculata [18]. Surprisingly and unexpectedly, two genes were shown to have endo- ⁇ -1,4-fucanase activity, which were named fcnB and fcnC.
  • the recombinant proteins obtained were respectively designated pMF8 and pMF9.
  • PCR polymerase chain reaction
  • the primers used were respectively:
  • FcnB w TTTTTTGTCGACGTTTCAAACCGTGATTTTTATGTGTC (SEQ ID NO 15)
  • FcnB_rev TTTTTTGTCGACGTTTCAAACCGTGATTTTTATGTGTC (SEQ ID NO 15)
  • FcnC w TTTTTTGTCGACAAAAGTAGTACAACTCAAACTGCTTC (SEQ ID NO 17)
  • FcnC_rev AAAAAACTGCAGTTACTTAGACCTACGTAAACCAATCT (SEQ ID NO 18)
  • the PCR cycle was as follows: 98°C for 2 minutes, then 98°C for 10 seconds, then 60°C for 15 seconds, then 72°C for 3 minutes, the cycle being repeated 30 times, finally 72°C for minutes.
  • the enzyme used is Q5 High Fidelity DNA Polymerase marketed by the company New England Biolabs (catalog reference M0491 L)
  • the recombinant proteins obtained in Example 2 above were used in a method to determine whether they had enzymatic activity, in particular whether they were effective in depolymerizing sulfated fucans.
  • FCSPs P. canaliculata The sulfated fucan from Pelvetia canaliculata, named FCSPs P. canaliculata in Figure 3, FCSP meaning “fucose containing sulfated polysaccharides” in English was extracted and purified according to a protocol described in the bibliographic reference Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata.
  • reaction mixtures were independently produced: the three types of sulfated fucans, namely FCSPs from P. canaliculate, ⁇ nodosum and F. vesiculosus, were placed in the presence of each enzyme (pMF8 or pMF9), in active form or in heat-inactivated form (10 min at 95 °C; negative control).
  • Each reaction mixture contained 2% weight/volume (w/v) of sulfated fucans dissolved in 50 mM ammonium bicarbonate and 0.2 mg/mL of recombinant protein (pMF8 or pMF9, active or inactivated forms, in buffer C: 20 mM Tris pH 7.5, 500 mM NaCl).
  • the sulfated fucans and the released oligo-fucans were thus separated on a polyacrylamide gel comprising an upper concentration zone at 6% (w/v) (called “stacking gel” in English) and a lower separation zone at 27% (w/v) (called “running gel” in English).
  • the electrophoresis took place at 200 V, at room temperature, namely 20 ° C for 2 h.
  • the polysaccharides and oligosaccharides were visualized by staining with Alcian blue followed by staining with silver nitrate as described in Min H.
  • FIG. 1 is a photograph of the C-PAGE gel thus obtained.
  • Lanes 1, 3, 5, 7, 9 and 11 are the negative controls corresponding respectively to the presence of the sulfated fucans of P. canaliculata, A. nodosum and F. vesiculosus with the recombinant proteins inactivated by heating (inactivated pMF8: lanes 1, 3 and 5; inactivated pMF9: lanes 7, 9 and 11).
  • Lanes 2, 4, 6, 8, 10 and 12 correspond respectively to the result of enzymatic digestions of sulfated fucans from P. canaliculata, A. nodosum and F. vesiculosus by the active recombinant proteins pMF8 (lanes 2, 4 and 6) and pMF9 (lanes 8, 10 and 12).
  • lanes 2, 4, 8, 10 and 12 clearly show distinct bands in the gel separation zone ("running gel") corresponding to sulfated fucan oligosaccharides of different molecular sizes that migrate in the gel under the action of the electric field.
  • oligosaccharide profiles obtained at the different lanes demonstrate that pMF8 and pMF9 release populations of oligo-fucans varying in size, e.g., large oligosaccharides, i.e., with a degree of polymerization of 20 or more at the top of the separation gel and small oligosaccharides, i.e., with a degree of polymerization of less than 10, at the bottom of the gel and not a small single-sized oligosaccharide as would be expected from an exolytic enzyme. Therefore, it appears clearly that pMF8 and pMF9 proteins are hydrolytic enzymes acting in an endolytic mode of action. In other words, the results clearly demonstrate that pMF8 and pMF9 proteins are endofucanases.
  • Structural analysis of oligofucans obtained by hydrolysis of sulfated fucan from P. canaliculata by pMF8 and pMF9 was performed. This is an analysis of samples corresponding to the products of lanes 2 and 8 of Figure 3, respectively. Structural analysis was performed by ultra-high performance liquid chromatography-mass spectrometry (UHPLC-MS).
  • the mass spectra obtained are shown in Figures 4 and 5.
  • the RT value indicates the order of elution of the different oligosaccharides on the liquid chromatography allowing them to be analyzed separately and, in particular, to separate the isomeric species, for example with the same exact masses but different retention times.
  • the exact mass measurement and the isotopic profile were used for identification purposes.
  • the obtained mass spectra clearly demonstrate the production of oligosaccharides by enzymatic digestion with pmF9 of fucans, namely disaccharides consisting of 2 di or tri sulfated fucoses (2.Fuc+2.S, 2.Fuc+3.S, peaks 570.16 and 650.12 ( Figures 5 A, B, C)).
  • Oligosaccharides consisting of 4 fucoses comprising 4 to 7 sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S peaks 460.04, 550.58, 641.12, 731.66 ( Figures 5 D, E, F, G, J, K, O)); of 6 fucoses comprising 7 to 9 sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, peaks 888.30, 928.28, 1069.38, 1160.42 ( Figures 5 H, I, L, M, P)); of 8 fucoses comprising 9 sulfates (8.Fuc+9.S, peaks 1306.48 ( Figure 5 N).
  • a fine structural analysis of the limiting forms of oligo-fucans obtained by pMF8 and pMF9 of polymerization degree 2 was performed.
  • the fine structural analysis was performed by tandem mass spectrometry (MS/MS) by high-energy fragmentation by charge transfer dissociation (CTD).
  • the apparatus used was an ion trap mass spectrometer modified in the laboratory as described in Ropartz, D.; Fanuel, M.; Ollivier, S.; Lissarrague, A.; Benkoulouche, M.; Mulard, LA; André, I.; Guieysse, D.; Rogniaux, H.
  • the electrospray source parameters were as follows: capillary voltage: 4.5 kV; nebulizer gas: 6 psi; and drying gas: 4 L/min (80 °C). Mass spectra were recorded in positive ionization mode in the m/z range 250–1000. Precursor ions were isolated with a window width of 10 Daltons (Da). The activation time was 200 ms. Data were processed using Data Analysis 4.4 (Bruker Daltonics, Bremen, Germany), MSConvert 3.0.18261, and mMass 5.5.0.
  • the fragmentation spectra of the two limit products of the enzymes pMF 8 and pMF9 are identical to the measurement error allowed on an ion trap in MS/MS by a person skilled in the art (less than 100 ppm), clearly demonstrating that their catalytic activity is identical.
  • the fragments 1 % (m/z 535.4), 14 Ai (m/z 556.3), Bi (m/z 610.4) and Ci (m/z 628.3) demonstrate that the Fucose subunit at the non-reducing end of the DP2 carries 2 sulfate functions in position 2 and 3.
  • the fragments 15 Xi (m/z 475.2), Yi (m/z 447.3) and Zi (m/z 429.2) show that the fucose subunit at the reducing end of the DP2 carries a sulfate function. Fragments 35 A2 (m/z 898.5), and 04 A2 (m/z 912.5) demonstrate the branching between the subunits in 1-3 and the localization of the sulfate function in position 2. The complete structure of this DP2-3S therefore corresponds perfectly to the structure of the compound in Figure 1 C.
  • the recombinant proteins pMF8 and pMF9 are endo-a-1,4-fucanases, in particular endo-a-1,4-fucanases capable of hydrolyzing different types of sulfated fucans, in particular whatever their origins, and for example sulfated fucans from brown algae, for example from the Fucales family.
  • Example 4 Enzymatic hydrolysis/degradation of sulfated fucans from brown algae by glycoside hydrolase enzymes: endo-a-1,4-fucanases
  • the recombinant proteins obtained in Example 2 above (pMF8 and pMF9) and FcnA (pMF4), which has been previously produced and characterized, known to specifically cleave the ⁇ -1,4 bond in sulfated fucans from brown algae of the order Fucales (EC 3.2.1.212)
  • the source of sulfated fucans from brown algae (order Fucales) used was sulfated fucan from Pelvetia canaliculata, extracted and purified according to a protocol described in the bibliographic reference Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata. International Journal of Biological Macromolecules 2021, 201:143-157.
  • Reaction mixtures were independently produced: sulfated fucans were placed in the presence of each enzyme (pMF4, pMF8 or pMF9), in active form or in heat-inactivated form (10 min at 95 °C; negative control). Each reaction mixture contained 2% weight/volume (w/v) of sulfated fucans dissolved in 50 mM ammonium bicarbonate and 0.2 mg/mL of recombinant proteins (pMF4, pMF8 or pMF9, active or inactivated forms, in buffer C: 20 mM Tris pH 7.5, 500 mM NaCl). Each enzymatic digestion took place at 20 °C for 5 days. The reactions were stopped by inactivating the enzymes by heating at 95 °C for 10 min.
  • Each enzymatic reaction was carried out in at least three copies (triplicate), each of the reaction mixtures having been analyzed by reversed-phase ultra-high performance liquid chromatography by ion pairing (IIHPLC) coupled with a mass spectrometer.
  • IIHPLC reversed-phase ultra-high performance liquid chromatography by ion pairing
  • the separation of products/elements/oligosaccharides present in the obtained samples was performed by reversed-phase ultra-high performance liquid chromatography by ion pairing (IIHPLC, Acquity H-Class plus® Waters, Wilmslow, UK).
  • the system was equipped with a BEH C18 column (100 mm x 1 mm, packed with 1.7 pm porosity particles; Waters, Wilmslow, UK) heated to 45 °C.
  • the flow rate was 0.15 mL.min' 1 .
  • a ternary gradient was used with A, pure water (Ultrapure water produced by a Milli-Q apparatus (Millipore); B, pure ACN (acetonitrile (ACN) HPLC grade (Carlo-Erba Reagents, Val de Reuil, France), and C, 20 mM Hexylamine 99% (HxA) (Sigma-Aldrich Co., Saint Quentin Fallavier, France) dissolved in water (pH value adjusted to 6 by addition of acetic acid (Acetic acid 98% (Fluka, distributed by Sigma-Aldrich Co., Saint Quentin Fallavier, France).
  • the source parameters were as follows: Capillary voltage 2.5 kV; Cone voltage: 40 V; Source temperature: 100°C; Desolvation temperature: 280°C; Desolvation gas: 500 L/h; Nebulization gas: 5.5 bar. Data were recorded with Quartz software (Waters Integrated Software, version 5) and processed using Mass Lynx 4.2 (Waters, Wilmslow, UK) and MzMine software (Pluskal T, Castillo S, Villar-Briones A, Oresic M. 2010. MZmine 2: Modular framework for processing, visualizing, and analyzing mass spectrometry-based molecular profile data. BMC Bioinformatics. 11:395 [32]). The parameters used in MzMine are shown in the following Table 1.
  • Mourao PA Perspective on the use of sulfated polysaccharides from marine organisms as a source of new antithrombotic drugs. Marine Drugs 2015, 13:2770-2784.
  • Rabanal M Ponce NM, Navarro DA, Gomez RM, Stortz CA: The system of fucoidans from the brown seaweed Dictyota dichotoma: chemical analysis and antiviral activity. Carbohydrate Polymers 2014, 101:804-811.
  • Zablackis E, Perez J A partially pyruvated Carrageenan from Hawaiian Grateloupia filicina (Cryptonemiales, Rhodophyta). Botanica Marina 1990, 33:273-276.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Medicinal Chemistry (AREA)
  • Enzymes And Modification Thereof (AREA)

Abstract

La présente invention se rapporte à une nouvelle enzyme glycoside hydrolase, en particulier à une nouvelle fucanase, à des séquences d'acides nucléiques codant pour cet enzyme, à un vecteur comprenant ladite séquence codante, à un procédé de fabrication de cette enzyme glycoside hydrolase, ainsi qu'à un procédé de dégradation de fucanes sulfatés utilisant cet enzyme et aux polysaccharides obtenus. La présente invention trouve une application principalement dans le domaine de l'agriculture, de la nutrition animale et humaine, de la cosmétique, de la pharmacie, de la recherche en laboratoire, notamment pour la production de molécules ou pour l'analyse fine de la structure et des compositions de polysaccharides de fucanes sulfatés de nature et provenance variées.

Description

FUCANASES ET LEUR UTILISATION POUR HYDROLYSER DES POLYSACCHARIDES
DESCRIPTION
Domaine de l’invention
La présente invention se rapporte à une nouvelle enzyme glycoside hydrolase, en particulier à au moins une nouvelle fucanase, à des séquences d’acides nucléiques codant pour cette enzyme, à un vecteur comprenant ladite séquence codante, à un procédé de fabrication de cette enzyme glycoside hydrolase, ainsi qu’à un procédé de dégradation de fucanes sulfatés utilisant cet enzyme.
La présente invention trouve une application principalement dans le domaine de l’agriculture, de la nutrition animale et humaine, de la cosmétique, de la pharmacie, etc., mais également dans le domaine de la recherche en laboratoire, notamment pour la production de molécules ou pour l’analyse fine de la structure et des compositions de polysaccharides de fucanes sulfatés de nature et provenance variées.
Dans la description ci-dessous, les références entre crochets ([ ]) renvoient à la liste des références présentées à la fin du texte.
Etats de la technique
Les algues brunes sont présentes dans la plupart des régions du monde et jouent un rôle essentiel dans la production primaire des écosystèmes côtiers. Elles constituent ainsi une énorme biomasse, qui est composée à environ 50% par des polysaccharides. Après les alginates, les polysaccharides sulfatés contenant des fucoses (fucose-containing sulfated polysaccharides en anglais, (FCSPs)) représentent la deuxième famille de polysaccharides la plus abondante de la paroi cellulaire des algues brunes. Les FCSPs se divisent en deux catégories de polysaccharides hautement divers et complexes : les fucanes sulfatés et les fucoïdanes (Deniaud-Bouet E, Hardouin K, Potin P, Kloareg B, Herve C: A review about brown algal cell walls and fucose-containing sulfated polysaccharides: Cell wall context, biomedical properties and key research challenges. Carbohydrate Polymers 2017, 175:395-408 [1]). Les fucanes sulfatés sont des homopolymères de L-fucose présentant de nombreuses substitutions, par exemples des groupements sulfates, acétyles, branchements, tandis que les fucoïdanes sont des hétéropolymères contenant des L-fucoses sulfatés, mais dont la chaîne principale est constituée de divers monosaccharides neutres et/ou uroniques, par exemple xylofucoglucuromannanes, fucoglucuronanes, fucogalactanes [1], Les FCSPs jouent des rôles essentiels chez les algues brunes, connectant les fibres de celluloses des parois cellulaires et étant impliqués dans de nombreux processus cellulaires par exemple l’adaptation aux variations de salinité et au stress oxydatif, le développement, la différenciation cellulaire, etc. (Kloareg B, Badis Y, Cock JM, Michel G: Role and Evolution of the Extracellular Matrix in the Acquisition of Complex Multicellularity in Eukaryotes: A Macroalgal Perspective. Genes 2021 , 12 [2]). De nombreuses propriétés bioactives des FCSPs et de leurs oligosaccharides dérivés sur les cellules animales et humaines ont été décrites, il s’agit notamment d’activités anti-oxydantes et anti-inflammatoires (Pomin VH: Sulfated glycans in inflammation. European Journal of Medicinal Chemistry 2015, 92:353-369 [3]), de rôles dans la régulation de la réponse immunitaire (Ferreira SS, Passos CP, Madureira P, Vilanova M, Coimbra MA: Structure-function relationships of immunostimulatory polysaccharides: A review. Carbohydrate Polymers 2015, 132:378-396 [4]), dans l’hémostase (Mourao PA: Perspective on the use of sulfated polysaccharides from marine organisms as a source of new antithrombotic drugs. Marine Drugs 2015, 13:2770-2784 [5]), d’actions/d’activités antiinfectieuses (Rabanal M, Ponce NM, Navarro DA, Gomez RM, Stortz CA: The system of fucoidans from the brown seaweed Dictyota dichotoma: chemical analysis and antiviral activity. Carbohydrate Polymers 2014, 101 :804-811 [6]) et anti-cancéreuses (Wu L, Sun J, Su X, Yu Q, Yu Q, Zhang P: A review about the development of fucoidan in antitumor activity: Progress and challenges. Carbohydrate Polymers 2016, 154:96-111 [7]).
Toutefois, la structure des FCSPS et/ou les procédés permettant d’hydrolyser ces FCSPS, par exemple en oligosaccharides et/ou en monomères sont peu caractérisés et reste à déterminer.
Il existe donc un réel besoin d’un procédé et/ou d’une méthode permettant notamment de déterminer et/ou caractériser la structure des FCSPS. Il existe également un réel besoin d’un procédé et/ou d’une méthode permettant notamment de déterminer et/ou d’identifier un procédé d’hydrolyse de FCSPS.
Il existe dans l’état de la technique de nombreux procédés d’hydrolyse. Par exemple l’hydrolyse acide ou radicalaire sont des méthodes ou procédés chimiques fréquemment utilisé(e)s pour fragmenter un polysaccharide. Toutefois, ces procédés ou méthodes d’hydrolyses sont aléatoires, à savoir que le clivage peut être fait sur tout ou partie du composé à hydrolyser, par exemple d’un polysaccharide et peuvent notamment altérer la structure des oligosaccharides obtenus après hydrolyse. L’altération de composés obtenus, par exemple des oligosaccharides obtenus provoque notamment une modification voire la suppression des propriétés biologiques desdits composés/oligosaccharides.
Il existe donc un réel besoin d’un procédé et/ou d’une méthode permettant notamment une hydrolyse précise de composé, en particulier d’oligo- et/ou de poly-saccharides, par exemple de FCSPS.
Il existe dans l’état de la technique des procédés comprenant l’utilisation d’enzymes, par exemple de glycoside hydrolases (GH) spécifiques permettant de libérer des oligosaccharides tout en préservant leurs structures et activités biologiques. Toutefois, peu de GHs ont été identifiées, en particulier de GHs susceptibles d’hydrolyser des fucanes sulfatés, par exemple des endo-a-1 ,4-fucanases.
Une endo-fucanase (FcnA) a été identifiée en 2006 chez une bactérie marine fucanolytique (Mariniflexile fucanivorans SI/l/5) isolée d’une usine d’extraction d’alginate (Landerneau, Bretagne, France) (Barbeyron T, L'Haridon S, Michel G, Czjzek M: Mariniflexile fucanivorans sp. nov., a marine member of the Flavobacteriaceae that degrades sulphated fucans from brown algae. International Journal of Systematic and Evolutionary Microbiology 2008, 58:2107-2113 [8], Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021-1032 [9]). FcnA clive spécifiquement la liaison a-1 ,4 dans les fucanes sulfatés des algues brunes de l’ordre des Fucales (EC 3.2.1.212). Cette enzyme est le membre fondateur de la famille GH107 [9] et son utilisation est décrite notamment dans un document brevet (Yvin JC, Colin S, Cloarec B, Barbeyron T: Recombinant endofucanase., WO 2006/008379 [10]). Il existe également deux autres endo-a-1 ,4-fucanases de la famille GH107 (Boraston AB, Vickers C, Salama-Alber O, Abe K: Enzymatic hydrolysis of fucans., WO 2020024403 [11], Vickers C, Liu F, Abe K, Salama-Alber O, Jenkins M, Springate CMK, Burke JE, Withers SG, Boraston AB: Endo-fucoidan hydrolases from glycoside hydrolase family 107 (GH107) display structural and mechanistic similarities to alpha-l-fucosidases from GH29. Journal of Biological Chemistry 2018, 293:18296-18308 [12]). Une deuxième famille de glycoside hydrolases contenant des endo-fucanases a été également décrite, il s’agit de la famille GH168 comprenant l’enzyme FunA (Shen J, Chang Y, Zhang Y, Mei X, Xue C: Discovery and Characterization of an Endo-1 ,3-Fucanase From Marine Bacterium Wenyingzhuangia fucanilytica: A Novel Glycoside Hydrolase Family. Frontiers in Microbiology 2020, 11 :1674 [13]). L’enzyme FunA de la bactérie marine Wenyingzhuangia fucanilytica est une endo-a-1 ,3-fucanase (EC 3.2.1.211 ). Elle clive les liaisons glycosidiques a-1 ,3 au sein du fucane sulfaté de concombre de mer (Holothurie). Cependant, cette enzyme n’est pas active sur les fucanes sulfatés d’algues brunes (Shen J, Chang Y, Zhang Y, Mei X, Xue C: Discovery and Characterization of an Endo-1 ,3-Fucanase From Marine Bacterium Wenyingzhuangia fucanilytica: A Novel Glycoside Hydrolase Family. Frontiers in Microbiology 2020, 11 :1674 [13]).
Il existe donc un réel besoin de trouver un moyen et/ou un procédé et/ou une méthode permettant notamment une hydrolyse précise de fucanes sulfatés, en particulier de fucanes sulfatés issus d’algues brunes.
Il existe un réel besoin de trouver un nouveau moyen et/ou procédé permettant de dépolymériser les fucanes sulfatés, en particulier de manière fiable et reproductible, permettant avantageusement l’obtention d’oligosaccharides, par exemple d’oligo-fucanes particuliers.
Il existe en outre un réel besoin de trouver un nouveau moyen et/ou procédé permettant de dépolymériser et/ou hydrolyser les fucanes sulfatés afin de valoriser cette bio-ressource, issue notamment des algues brunes, et ainsi libérer de façon contrôlée et reproductible de nouveaux oligo- fucanes de structures définies.
Il existe également un réel besoin de trouver un nouveau moyen et/ou procédé permettant de dépolymériser et/ou hydrolyser les fucanes sulfatés et ce en préservant la structure fine des oligosaccharides, par exemple des oligo-fucanes obtenus, et donc avantageusement les propriétés biologiques desdits oligosaccharides, par exemple dans la perspective d’applications cosmétiques, agroalimentaires et médicales.
Description de l’invention
La présente invention a précisément pour but de répondre à ce besoin en fournissant une enzyme glycoside hydrolase, par exemple une fucanase, par exemple une endo-a-1 ,4-fucanase.
En particulier, les inventeurs ont démontré de manière surprenante qu’une enzyme glycoside hydrolase, par exemple une endo-fucanase, en particulier une endo-a-1 ,4-fucanase, permet avantageusement d’hydrolyser des polysaccharides issus d’algues brunes.
Les inventeurs ont également démontré de manière surprenante que cette enzyme peut être utile pour la dégradation de fucanes sulfatés et peut avantageusement permettre la production d’oligosaccharides de fucanes (ou oligo-fucanes) ayant une structure chimique unique, sulfatée. Ces oligosaccharides sulfatés peuvent être potentiellement intéressants pour des applications en biomédical, cosmétique, nutrition, élicitation de plantes, etc...
Les inventeurs ont également démontré que ces enzymes appartiennent à une nouvelle famille de glycoside hydrolases. En particulier, les inventeurs ont démontré que les enzymes selon l’invention sont distinctes de la famille GH107 contentant d’autres endo-a-1 , 4- fucanases . En particulier, les inventeurs ont identifié et isolé de manière surprenante et inattendue deux enzymes, désignée FcnB et FcnC, à partir de la bactérie marine M. fucanivorans SW5.
Les inventeurs ont également isolé et produit des protéines recombinantes qui ont une activité enzymatique et qui hydrolysent de façon endolytique les liaisons a-1 ,4 des algues brunes, par exemple des algues brunes de l’ordre des Fucales, par exemple Pelvetia canaliculata, Fucus vesiculosus et Ascophylum nodosum. En d’autres termes, les inventeurs ont produit et isolé de nouvelles fucanases, en particulier de nouvelles endo-a-1 ,4-fucanases.
Les inventeurs ont également démontré que les enzymes isolées hydrolysent de façon endolytique la liaison glycosidique a-1 ,4 des fucanes sulfatés d’algues brunes, par exemple des algues brunes de l’ordre des Fucales, par exemple Pelvetia canaliculata, Fucus vesiculosus et Ascophylum nodosum.
Les inventeurs ont également démontré de manière surprenante que des protéines recombinantes sont deux nouvelles endo-a-1 , 4-fucanases appartenant à une nouvelle famille de glycoside hydrolase et que ces enzymes recombinantes permettent avantageusement :
(i) de dépolymériser les fucanes sulfatés des algues brunes permettant avantageusement de libérer des oligosaccharides à activité biologique en préservant leur structure native ; (ii) de dégrader directement des macroalgues brunes pour générer des fractions contenant des oligosaccharides à activité biologique ; et
(iii) d’augmenter le rendement d’extraction d’autres composés (e.g. protéines, pigments, alginates etc... ) à partir de macroalgues brunes.
Dans la présente, par fucane sulfaté on entend un polysaccharide sulfaté comprenant une chaîne principale de L-fucose, qui est un sucre à 6 atomes de carbone dont la formule chimique est C6H12O5, et comprenant au moins une substitution par des groupements ester-sulfates. Les fucanes sulfatés peuvent par exemple, désigner des fucanes sulfatés dérivés d'algues brunes. Il peut s’agir par exemple de fucanes sulfatés provenant d'algues brunes, par exemple d’algues brunes de l’ordre des Fucales. Il peut s’agir par exemple de fucanes sulfatés dont la chaîne principale comprend des résidus L-fucose alternativement liés par des liaisons a-1 ,3 et a-1 ,4. Il peut s’agir par exemple de fucanes sulfatés tels que décrits dans Deniaud-Bouet E, Hardouin K, Potin P, Kloareg B, Herve C: A review about brown algal cell walls and fucose-containing sulfated polysaccharides: Cell wall context, biomedical properties and key research challenges. Carbohydrate Polymers 2017, 175:395-408 [1] et/ou dans Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021- 1032. [9], Il peut s’agir par exemple de fucanes sulfatés comprenant des motifs de disaccharides comprenant un à trois sulfates tels que représenté sur la figure 1 , par exemple comprenant un motif disaccharides comprenant un groupement sulfate : motif de type A : [^4)-a-L- fucopyranose-2-sulfate-(1^3)-a-L-fucopyranose-(1^], un motif disaccharides comprenant deux groupements sulfates: motif de type B : [^4)-a-L-fucopyranose-2-sulfate-(1^3)-a-L-fucopyranose-2-sulfate-(1^] et/ou un motif disaccharides comprenant trois groupements sulfates : motif de type C : [4^)a-L-fucopyranose-2,3-disulfate-(1^3)-a-L-fucopyranose- 2-sulfate-(1^]. Dans la présente, le terme "fucane" comprend les molécules polymères ayant les motifs chimiques et structurels des fucanes quelle que soit la ou les sources des fucanes.
La présente invention a pour objet une enzyme glycoside hydrolase isolée de séquence d'acides aminés comprenant ou consistant en la séquence VSNADFYVSNKGSDNWSGTLANPNPQGTDGPFATLEKAKNAVRILKKSK SEDIWLIRDGVYKLNKTWFGLEDSGEGKSTITYAAYPNEQPVFSSGKEI KGWQKVTTDIPGLPNAAKGHIMVAHVSDKFLTLYDDEGMLPRAQSKGIIT GDGGNSKNKLQFPDGFLKNWSNVTDVEIKVRPHHAWISNILPLTSVDEKT STATTSIDATYAMNRLHFLPETENAVWENVLEVLDEKGEWVLN(TKEGKV YLWPRNDSQWAPQLFELIRVEGKIDKEGPTDVPVRNLHFKGLTFKHGER YTIKPNDAGLQHDWDMHDKDNALVRLRGTENCVIEQCHFLDSGSGAIRV DLYGMNNTISNNHIEHLGGGGILLCGYGPGTKDVNKKNTIYNNNIHHVGQI YWHSPGIFVWQSGENQISNNLIHHTDYTAIILSGCMTDFFAKSPNGRELT RTIRRNEVPKFSKDVSLADVLPYLHTHHNWENNEIHHAMERLGDGNAIYI RGAGRDNIIRRNYIHHMVADMIMQAAIRTDGGQTGTLITENLIYKCTSQGIL TKLDNKVENNIVADIIAPPRGYYLSLREGPLTGGTIKRNILYSVTEMGSFID ELPPGKEGASEDRRGRVIASAKDADTDYNIYFNKADLSKGKELIEKNQND GVDKHSRAVDPLFVDPENGDFTFKPGSPALEMGIVPIDFSMIGLRTK (SEQ ID NO : 1 ) ou
KSSTTQTASNIEADFYVSTKGSDTWSGTLESPNAQGTDGPFATLER AKDAVRILKKKKSKNIVVLIREGVYKLNETWFGLEDSGDDKSTITYAAYPN EIAVFSSGQEIKGWKKVTTDLPGLAEEAKGKLLVAEVSNKFLTLYDEEGM LPRAQSEPYKSLKKSTENDLYFSKGELKNWPNVEDVEILVRPTREWIVNM LPLASVDEEKGWRVGVEATYAMQSKGYWVENVLEVLDKPGEWVLNTK EGKVYLWPRNDSPIWAPKLLELIRVEGKIDFDGSKDIPVRNLHFKGLTFKH AERYTLTKDDAGLQHDWDMLDKNNAMVRFRGTENCGIEDCHFLHGGSG AIRVDLHGINNKISNNHIEYMGGGGILLCGYGPGTKDVNKHNTVYNNNIHH VGEIYWQSPGIFLWNSGENRVANNLIHDTNYCGLIVSGCVIRFFEHADKR EQYRAIRWHEIGELPEELTADVVRPYWHSRNNIIEYNEIHNVMKKLGDGN GIYIRAAGAGNIIRRNYVHHLVAETGKQSGIRTDGGQMDALISENIIYKCTS QGMTLKLNNRFENNIIADVIAPPRGVYLKIVEGPMNGASNKKNIFYSTTDE CTFISEPSPGSGLVDEDSRGREPAQMKDIASDYNIYYCKADNRIAEKTLK ELQNKGVDANSQILDPMFVDPENGDFSFKPDSPALKMGIVPIDVSKIGLR RSK (SEQ ID NO 2).
Dans la présente, dans les séquences peptidiques divulguées ici, les acides aminés sont représentés par leur code à une lettre selon la nomenclature suivante : A : alanine ; C : cystéine ; D : acide aspartique ; E : acide glutamique ; F : phénylalanine ; G : glycine ; H : histidine ; I : isoleucine ; K : lysine ; L : leucine ; M : méthionine ; N : asparagine ; P : proline ; Q : glutamine ; R : arginine ; S : sérine ; T : thréonine ; V : valine ; W : tryptophane et Y : tyrosine.
La présente invention a pour objet une enzyme glycoside hydrolase isolée de séquence d'acides aminés comprenant ou consistant une séquence ayant au moins 65% d’identité de séquence avec la séquence SEQ ID NO : 1 ou SEQ ID NO : 2. Il peut d’agir par exemple d’enzyme glycoside hydrolase isolée de séquence d'acides aminés comprenant ou consistant une séquence ayant au moins 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% d’identité de séquence avec la séquence SEQ ID NO : 1 ou SEQ ID NO : 2. Il peut s’agir par exemple une enzyme glycoside hydrolase isolée de séquence d'acides aminés comprenant ou consistant en la séquence
MKQRLIIVLTLIFGCLISTAQTTAVSNADFYVSNKGSDNWSGTLANPNPQG TDGPFATLEKAKNAVRILKKSKSEDIWLIRDGVYKLNKTWFGLEDSGEG KSTITYAAYPNEQPVFSSGKEIKGWQKVTTDIPGLPNAAKGHIMVAHVSD KFLTLYDDEGMLPRAQSKGIITGDGGNSKNKLQFPDGFLKNWSNVTDVEI KVRPHHAWISNILPLTSVDEKTSTATTSIDATYAMNRLHFLPETENAWVEN VLEVLDEKGEWVLNTKEGKVYLWPRNDSQVVAPQLFELIRVEGKIDKEG PTDVPVRNLHFKGLTFKHGERYTIKPNDAGLQHDWDMHDKDNALVRLR GTENCVIEQCHFLDSGSGAIRVDLYGMNNTISNNHIEHLGGGGILLCGYG PGTKDVNKKNTIYNNNIHHVGQIYWHSPGIFVWQSGENQISNNLIHHTDY TAIILSGCMTDFFAKSPNGRELTRTIRRNEVPKFSKDVSLADVLPYLHTHH NWENNEIHHAMERLGDGNAIYIRGAGRDNIIRRNYIHHMVADMIMQAAIR TDGGQTGTLITENLIYKCTSQGILTKLDNKVENNIVADIIAPPRGYYLSLRE GPLTGGTIKRNILYSVTEMGSFIDELPPGKEGASEDRRGRVIASAKDADT DYNIYFNKADLSKGKELIEKNQNDGVDKHSRAVDPLFVDPENGDFTFKPG SPALEMGIVPIDFSMIGLRTK (SEQ ID NO 3) ou
MKQLLIAIFVLIIGCKSSTTQTASNIEADFYVSTKGSDTWSGTLESPNAQGT DGPFATLERAKDAVRILKKKKSKNIWLIREGVYKLNETVVFGLEDSGDDK STITYAAYPNEIAVFSSGQEIKGWKKVTTDLPGLAEEAKGKLLVAEVSNKF LTLYDEEGMLPRAQSEPYKSLKKSTENDLYFSKGELKNWPNVEDVEILVR PTREWIVNMLPLASVDEEKGWRVGVEATYAMQSKGYWVENVLEVLDK PGEWVLNTKEGKVYLWPRNDSPIWAPKLLELIRVEGKIDFDGSKDIPVRN LHFKGLTFKHAERYTLTKDDAGLQHDWDMLDKNNAMVRFRGTENCGIE DCHFLHGGSGAIRVDLHGINNKISNNHIEYMGGGGILLCGYGPGTKDVNK HNTVYNNNIHHVGEIYWQSPGIFLWNSGENRVANNLIHDTNYCGLIVSGC VIRFFEHADKREQYRAIRWHEIGELPEELTADVVRPYWHSRNNIIEYNEIH NVMKKLGDGNGIYIRAAGAGNIIRRNYVHHLVAETGKQSGIRTDGGQMD ALISENIIYKCTSQGMTLKLNNRFENNIIADVIAPPRGVYLKIVEGPMNGAS NKKNIFYSTTDECTFISEPSPGSGLVDEDSRGREPAQMKDIASDYNIYYC KADNRIAEKTLKELQNKGVDANSQILDPMFVDPENGDFSFKPDSPALKM GIVPIDVSKIGLRRSK (SEQ ID NO 4),
MGSSHHHHHHGSLDVSNADFYVSNKGSDNWSGTLANPNPQGTDGPFA TLEKAKNAVRILKKSKSEDIVVLIRDGVYKLNKTVVFGLEDSGEGKSTITYA AYPNEQPVFSSGKEIKGWQKVTTDIPGLPNAAKGHIMVAHVSDKFLTLYD DEGMLPRAQSKGIITGDGGNSKNKLQFPDGFLKNWSNVTDVEIKVRPHH AWISNILPLTSVDEKTSTATTSIDATYAMNRLHFLPETENAWVENVLEVLD EKGEWVLNTKEGKVYLWPRNDSQVVAPQLFELIRVEGKIDKEGPTDVPV RNLHFKGLTFKHGERYTIKPNDAGLQHDWDMHDKDNALVRLRGTENCVI EQCHFLDSGSGAIRVDLYGMNNTISNNHIEHLGGGGILLCGYGPGTKDVN KKNTIYNNNIHHVGQIYWHSPGIFVWQSGENQISNNLIHHTDYTAIILSGC MTDFFAKSPNGRELTRTIRRNEVPKFSKDVSLADVLPYLHTHHNWENNE IHHAMERLGDGNAIYIRGAGRDNIIRRNYIHHMVADMIMQAAIRTDGGQTG TLITENLIYKCTSQGILTKLDNKVENNIVADIIAPPRGYYLSLREGPLTGGTI KRNILYSVTEMGSFIDELPPGKEGASEDRRGRVIASAKDADTDYNIYFNKA DLSKGKELIEKNQNDGVDKHSRAVDPLFVDPENGDFTFKPGSPALEMGI VPIDFSMIGLRTK (SEQ ID NO 5),
MGSSHHHHHHGSLDKSSTTQTASNIEADFYVSTKGSDTWSGTLESPNA QGTDGPFATLERAKDAVRILKKKKSKNIWLIREGVYKLNETVVFGLEDSG DDKSTITYAAYPNEIAVFSSGQEIKGWKKVTTDLPGLAEEAKGKLLVAEVS NKFLTLYDEEGMLPRAQSEPYKSLKKSTENDLYFSKGELKNWPNVEDVEI LVRPTRE Wl VN M LP LAS VD E E KG WRVGVEATYAM QS KGYWVE N VLE VL DKPGEWVLNTKEGKVYLWPRNDSPIWAPKLLELIRVEGKIDFDGSKDIPV RNLHFKGLTFKHAERYTLTKDDAGLQHDWDMLDKNNAMVRFRGTENCG IEDCHFLHGGSGAIRVDLHGINNKISNNHIEYMGGGGILLCGYGPGTKDV NKHNTVYNNNIHHVGEIYWQSPGIFLWNSGENRVANNLIHDTNYCGLIVS GCVIRFFEHADKREQYRAIRWHEIGELPEELTADWRPYWHSRNNIIEYN EIHNVMKKLGDGNGIYIRAAGAGNIIRRNYVHHLVAETGKQSGIRTDGGQ MDALISENIIYKCTSQGMTLKLNNRFENNIIADVIAPPRGVYLKIVEGPMNG ASNKKNIFYSTTDECTFISEPSPGSGLVDEDSRGREPAQMKDIASDYNIYY CKADNRIAEKTLKELQNKGVDANSQILDPMFVDPENGDFSFKPDSPALK MGIVPIDVSKIGLRRSK (SEQ ID NO 6).
Le pourcentage d'identité ou de similarité de séquence peut être déterminé par toute méthode connue de l'homme du métier. Il peut être déterminé par exemple par l'utilisation de BLASTP et BLASTN, par exemple en utilisant des paramètres par défaut, le logiciel d’analyse de séquences « needle », qui fait appel à l’algorithme d’alignement global « Needleman-Wunsch » pour trouver l’alignement optimal (avec gaps) de deux séquences sur la totalité de leur longueur disponible sur le site ebi.ac.uk.
La présente invention a également pour objet, une enzyme glycoside hydrolase isolée de séquence d'acides aminés comprenant ou consistant en une séquence choisie parmi :
• les résidus 21 à 725 de la séquence SEQ ID NO : 3 ;
• les résidus 1 à 725 de la séquence SEQ ID NO : 3 ;
• les résidus 15 à 717 de la séquence SEQ ID NO : 4 ; • les résidus 1 à 717 de la séquence SEQ ID NO : 4 ;
• les résidus 15 à 715 de la séquence SEQ ID NO : 5 ;
• les résidus 1 à 715 De la séquence SEQ ID NO : 5 ;
• les résidus 15 à 716 de la séquence SEQ ID NO : 6 ;
• les résidus 1 à 716 de la séquence SEQ ID NO : 6.
Avantageusement, l’enzyme glycoside hydrolase peut être une fucanase, par exemple une endo-a-1 ,4-fucanase.
Une enzyme glycoside hydrolase isolée selon l’invention comprend également une enzyme glycoside hydrolase isolée dérivée de la séquence SEQ ID NO : 1 , SEQ ID NO : 2, SEQ ID NO : 3, SEQ ID NO : 4, SEQ ID NO 5, SEQ ID NO 6 étant entendu que cette enzyme glycoside hydrolase dérivée conservent l’activité fucanase, de préférence endo-a-1 ,4-fucanase. Une enzyme glycoside hydrolase dérivée comprend ou consiste en une séquence choisie parmi : a) une séquence ayant au moins 65 % d’identité, par exemple au moins 75% d’identité, au moins 80% d’identité avec la séquence des résidus :
• 1 à 701 de la séquence SEQ ID NO 1 ;
• 1 .à 702.de la séquence SEQ ID NO 2 ;
• 21 à 725 de la séquence SEQ ID NO : 3;
• 1 à 725 de la séquence SEQ ID NO : 3;
• 15 à 717 de la séquence SEQ ID NO : 4;
• 1 à 717 de la séquence SEQ ID NO : 4;
• les résidus 15 à 715 de la séquence SEQ ID NO : 5 ;
• les résidus 1 à 715 de la séquence SEQ ID NO : 5 ;
• les résidus 15 à 716 de la séquence SEQ ID NO : 6 ;
• les résidus 15 à 716 de la séquence SEQ ID NO : 6. b) un fragment d’au moins 20 acides aminés consécutifs des séquences SEQ ID NO : 1 , SEQ ID NO : 2, SEQ ID NO : 3, SEQ ID NO : 4, SEQ ID NO 5, SEQ ID NO 6.
Selon l’invention, l’enzyme glycoside hydrolase, par exemple une fucanase, par exemple une endo-a-1 ,4-fucanase, peut-être une protéine et/ou enzyme isolée et purifiée. En d’autres termes, les enzymes glycosides hydrolases, par exemple les fucanases, par exemple les endo- a-1 ,4-fucanases selon l’invention peuvent être sous forme isolée et purifiée.
Selon l’invention, l’enzyme glycoside hydrolase, par exemple la fucanase, par exemple l’endo- a-1 ,4-fucanase isolée peut être une protéine recombinante. En d’autres termes, les enzymes glycosides hydrolases, par exemple les fucanases, par exemple les endo- a-1 ,4- fucanases selon l’invention peuvent être une protéine recombinante.
Dans la présente, par fucanase on entend une protéine possédant une fonction catalytique, par exemple une enzyme, capable d’hydrolyser des fucanes, par exemple des fucanes sulfatés. Il peut s’agir par exemple d’enzyme capable d’hydrolyser des polysaccharides sulfatés que sont les fucanes sulfatés.
Dans la présente, par endo-fucanase on entend une protéine possédant une fonction catalytique, par exemple une enzyme, capable d’hydrolyser selon un mode d’action endo-lytique les liaisons des fucanes, par exemple des fucanes sulfatés, par exemple des algues brunes de l’ordre des Fucales. Il peut s’agir d’endo-a-1 ,4-fucanase possédant une fonction catalytique, par exemple une enzyme, capable d’hydrolyser selon un mode d’action endo-lytique les liaisons a-1 ,4 des fucanes, par exemple des fucanes sulfatés, par exemple des algues brunes de l’ordre des Fucales.
Dans la présente, les enzymes glycosides hydrolases dérivées peuvent différer des séquences de référence, par exemple de la séquence choisie parmi la séquence SEQ ID NO 1 , SEQ ID NO 2, SEQ ID NO 3, SEQ ID NO 4, SEQ ID NO 5, SEQ ID NO 6 par la présence de mutations de type délétion, insertion et/ou substitution d’acides aminés. Les substitutions peuvent être conservatives ou non conservatives. Par exemple, les enzymes glycosides hydrolases dérivées peuvent différer des séquences de référence uniquement par la présence de substitutions conservatives. Les substitutions conservatives sont des substitutions d’acides aminés de même classe, telles que des substitutions d’acides aminés aux chaînes latérales non chargées, par exemple l'asparagine, la glutamine, la serine, la cystéine, et la tyrosine, d’acides aminés aux chaînes latérales basiques, par exemple la lysine, l'arginine, et l'histidine, d’acides aminés aux chaînes latérales acides, par exemple l'acide aspartique et l'acide glutamique, d’acides aminés aux chaînes latérales apolaires, par exemple l'alanine, la valine, la leucine, l'isoleucine, la proline, la phénylalanine, la méthionine et le tryptophane.
Dans la présente, les enzymes glycosides hydrolases dérivées peuvent également correspondre à des variants alléliques de l’enzyme glycoside hydrolase de séquence choisi parmi SEQ ID NO : 3 ou de la séquence SEQ ID NO : 4, à des protéines homologues aux protéines de séquence SEQ ID NO 3 ou SEQ ID NO 4 chez d’autres espèces que Mariniflexile fucanivorans SI /5, ou à des fragments de tels variants alléliques ou protéines homologues, tous conservant l’activité fucanase, de préférence endo-a-1 ,4-fucanase.
Selon invention, les enzymes, quelle que soit leurs séquences, peuvent comprendre en outre, à leur extrémité N-terminale, une séquence signal ou séquence d’adressage. Cette séquence signal peut être, par exemple une des séquences signal connues de l’homme du métier pour que la protéine, lorsqu’elle est synthétisée dans une cellule hôte, soit dirigée vers un organite ou une zone particulière de la cellule hôte. Il peut s’agir par exemple d’une séquence signal trouvée dans les sites spécialisés dans la prédiction de peptides signaux, par exemple http://www.cbs.dtu.dk/services/SignalP/ [10], Cette séquence signal peut être clivée après synthèse de la protéine ou non. Les procédés de clivage connus de l’Homme du métier peuvent être utilisés, par exemple ceux impliquant des protéases spécifiques d’un site de clivage. On choisit alors une séquence signal présentant un tel site.
Selon invention, les enzymes, quelle que soit leurs séquences, peuvent comprendre en outre, à leur extrémité N-terminale, une séquence correspondant à une étiquette de purification (« purification tag » en anglais). Il peut s’agir par exemple de la séquence MGSSHHHHHHGSLD SEQ ID NO : 7, par exemple en N-terminale de la séquence SEQ ID NO : 1 , du listage de séquences annexé et/ou par exemple en N-terminale de la séquence SEQ ID NO : 2, du listage de séquences annexé.
Les enzymes glycosides hydrolases selon l’invention peuvent être préparés par tout procédé adapté connu de l’homme du métier. Il peut s’agir par exemple d’un procédé comprenant une purification à partir de leur organisme ou microorganisme d’origine, par synthèse chimique ou par génie génétique, et ce en utilisant les techniques bien connues de l’homme du métier. Avantageusement, les enzymes glycosides hydrolases selon l’invention sont obtenues par génie génétique.
Dans la présente invention l’enzyme glycoside hydrolase, par exemple la fucanase ou endo-a-1 ,4-fucanase, peut être obtenue à partir d’une séquence nucléotidique codant ladite enzyme.
La présente invention se rapporte donc également à un acide nucléique codant pour une enzyme glycoside hydrolase selon l’invention.
Selon l’invention, l’acide nucléique peut être sous forme isolé et purifié. Il peut s’agir par exemple d’un acide nucléique isolé. Il peut s’agir par exemple d’un acide nucléique synthétisé.
Le terme « acide nucléique » se réfère aussi bien à des molécules d’ADN qu’à des molécules d’ARN, et inclus notamment des molécules d’ADNc et des molécules d’ARNm. L’acide nucléique peut être sous forme double brin (par exemple dans le cas d’un acide nucléique compris dans un vecteur d’expression) ou sous forme simple brin (par exemple dans le cas de sondes ou d’amorces).
La présente invention se rapport également à un acide nucléique codant pour une fucanase, par exemple une endo-a-1 ,4- fucanase selon l’invention. Il peut s’agir par exemple d’un acide nucléique choisi dans le groupe comprenant la séquence d’acides nucléiques comprenant ou consistant en la séquence : GTTTCAAACGCTGATTTTTATGTGTCTAACAAAGGGTCCGATAATTGGT CAGGAACATTGGCGAATCCAAATCCCCAAGGTACCGACGGCCCTTTT GCCACTTTGGAAAAAGCAAAAAATGCAGTACGTATCTTGAAAAAAAGC
AAATCTGAAGATATTGTGGTTTTGATTCGCGATGGCGTTTACAAACTG
AACAAGACCGTTGTATTCGGTTTAGAGGATTCTGGTGAAGGTAAATCT
ACTATTACATACGCTGCTTATCCAAATGAACAACCCGTGTTTAGTTCAG
GGAAAGAAATTAAAGGTTGGCAAAAAGTGACGACAGATATTCCGGGA
TTACCAAATGCTGCTAAAGGTCATATTATGGTAGCCCATGTTTCAGATA
AGTTTTTAACCCTTTATGATGACGAAGGTATGTTACCACGAGCACAAT
CAAAAGGCATCATCACAGGAGATGGTGGTAATAGTAAAAATAAACTTC
AATTTCCTGATGGGTTTTTGAAAAATTGGTCCAATGTCACCGATGTTGA
AATAAAAGTAAGACCACATCATGCTTGGATTTCAAATATACTGCCATTA
ACATCGGTTGATGAAAAAACAAGCACTGCAACCACTTCTATTGACGCT
ACCTATGCCATGAACAGACTCCATTTTTTACCAGAAACAGAGAATGCT
TGGGTTGAAAATGTGTTGGAAGTATTGGATGAAAAGGGCGAATGGGT
GTTAAATACAAAAGAAGGCAAAGTGTACCTTTGGCCACGAAACGATTC
TCAAGTTGTAGCTCCACAGTTGTTTGAGTTAATCCGTGTAGAAGGTAA
GATTGATAAAGAAGGTCCAACAGATGTTCCGGTTCGTAACCTTCATTT
TAAAGGGCTTACTTTTAAACATGGCGAACGTTATACAATAAAACCAAAT
GATGCTGGTTTGCAGCACGATTGGGATATGCACGATAAAGATAATGCT
TTAGTGCGTCTCCGTGGAACAGAAAATTGCGTGATTGAGCAGTGCCA
TTTTCTTGATAGCGGCAGTGGTGCTATTCGTGTGGATCTATATGGGAT
GAATAATACTATTTCAAATAACCATATAGAACATCTTGGAGGCGGTGG
TATTTTGCTTTGCGGTTATGGACCAGGCACAAAAGATGTGAACAAAAA
GAATACCATTTACAACAATAATATCCATCATGTAGGGCAAATTTATTGG
CATTCACCGGGAATCTTTGTTTGGCAAAGTGGTGAAAATCAAATCTCA
AATAATTTGATTCATCATACCGATTATACGGCCATTATTCTATCGGGTT
GTATGACTGATTTCTTTGCAAAAAGTCCTAACGGTCGAGAATTAACAC
GTACAATACGTCGTAATGAAGTACCTAAATTCTCGAAAGATGTAAGTC
TTGCGGACGTTTTACCTTATTTGCATACCCATCATAACGTTGTTGAAAA
CAATGAAATCCATCACGCCATGGAAAGGTTGGGAGATGGGAATGCGA
TTTATATTCGTGGAGCAGGTAGAGATAATATCATTCGTCGTAATTATAT
CCATCACATGGTAGCAGATATGATTATGCAAGCAGCCATTCGTACAGA
TGGTGGACAAACGGGTACTTTAATTACAGAAAATTTAATTTACAAATGT ACCTCGCAAGGCATTCTTACCAAGCTAGATAACAAAGTGGAAAATAAC
ATTGTTGCGGACATCATTGCACCACCCCGAGGCTATTATTTATCATTA
CGAGAAGGTCCTTTAACTGGCGGAACCATTAAACGGAATATTTTATAT
AGTGTCACAGAAATGGGCAGTTTTATAGATGAATTGCCTCCTGGGAAA
GAGGGGGCTTCTGAAGACCGAAGAGGACGCGTAATAGCAAGCGCCA
AGGATGCTGATACCGATTATAATATTTATTTTAATAAAGCAGACTTGAG
CAAAGGAAAGGAACTTATAGAAAAGAATCAAAATGATGGTGTGGATAA
GCATAGTAGAGCAGTGGATCCTCTATTTGTTGATCCGGAAAATGGTGA
TTTTACATTTAAACCAGGTTCTCCTGCTCTAGAAATGGGCATTGTTCCT
ATTGATTTTTCCATGATAGGATTACGTACAAAATAA (SEQ ID NO 8), AAAAGTAGTACAACTCAAACTGCTTCCAACATAGAGGCAGATTTTTAT GTATCTACAAAAGGATCCGATACTTGGTCTGGCACGTTGGAAAGTCCC
AATGCACAAGGCACAGATGGGCCTTTCGCTACCTTGGAACGTGCAAA
GGATGCGGTACGTATTTTGAAAAAAAAGAAATCAAAAAATATAGTGGT
GCTCATTCGTGAGGGCGTTTATAAACTTAATGAAACCGTAGTTTTCGG
TTTAGAAGATTCTGGTGATGATAAATCAACTATCACCTATGCTGCTTAT
CCAAATGAAATAGCTGTATTCAGTTCAGGACAAGAAATCAAAGGTTGG
AAAAAAGTGACTACTGATCTTCCCGGATTAGCAGAAGAAGCCAAAGGA
AAGTTGTTGGTTGCAGAAGTTTCGAATAAATTTTTAACGCTTTATGATG
AAGAAGGTATGTTGCCACGAGCCCAATCAGAGCCATACAAATCTTTAA
AGAAAAGTACAGAAAATGATCTTTATTTTTCGAAAGGCGAGCTAAAAAA
CTGGCCAAATGTTGAAGATGTAGAAATTTTAGTGCGCCCTACCAGAGA
ATGGATTGTAAACATGTTGCCATTGGCATCGGTTGATGAAGAAAAAGG
AGTAGTTCGTGTGGGAGTTGAGGCCACCTATGCGATGCAAAGTAAAG
GATATTGGGTAGAGAATGTTTTGGAAGTACTAGATAAACCAGGGGAAT
GGGTGTTGAATACCAAGGAAGGAAAAGTGTACCTGTGGCCACGGAAC
GATTCACCTATATGGGCACCAAAGCTTTTAGAACTCATTCGTGTAGAA
GGTAAAATTGATTTCGATGGCTCAAAGGATATTCCCGTTCGAAATCTT
CATTTTAAAGGACTCACTTTTAAACATGCCGAACGCTATACTTTAACCA
AGGATGATGCGGGCCTCCAACACGATTGGGACATGCTCGACAAGAAT
AATGCGATGGTACGCTTTAGAGGTACCGAAAATTGCGGGATTGAAGA
TTGTCATTTTTTACATGGTGGAAGTGGAGCCATCCGTGTAGATTTACA TGGAATCAATAATAAAATATCCAATAACCATATCGAATATATGGGCGGA GGCGGCATACTACTTTGCGGTTATGGCCCTGGAACAAAAGACGTAAA TAAGCATAATACAGTGTATAATAATAATATACATCATGTTGGGGAAATC TATTGGCAATCCCCGGGCATTTTCCTTTGGAATAGTGGTGAAAACCGA GTAGCCAACAACCTGATACATGATACTAATTATTGTGGACTCATTGTTT CTGGCTGTGTGATTCGTTTTTTTGAGCATGCTGATAAACGTGAACAAT ATAGAGCCATCAGGTGGCATGAAATTGGTGAATTGCCCGAAGAATTG ACCGCCGATGTGGTGCGACCTTATTGGCACAGTAGAAATAATATTATT GAATACAACGAAATTCATAACGTGATGAAAAAGTTGGGTGATGGTAAC GGCATTTACATTCGTGCCGCTGGCGCTGGTAACATCATCCGTCGTAAT TATGTGCATCATCTCGTTGCCGAAACAGGAAAACAAAGTGGTATTAGG ACCGATGGTGGACAAATGGATGCACTCATTTCAGAAAACATTATCTAC
AAATGTACCTCACAAGGAATGACCTTAAAATTGAACAACCGTTTTGAAA ATAATATTATAGCAGATGTTATTGCACCACCCCGAGGTGTCTATTTAAA AATTGTTGAAGGTCCGATGAACGGTGCCAGCAATAAAAAAAATATTTT TTATTCAACTACAGATGAATGCACGTTTATTTCTGAACCATCCCCCGG ATCCGGATTGGTAGATGAAGATAGCAGAGGCAGAGAACCTGCACAAA TGAAGGATATTGCATCAGACTATAATATCTATTACTGTAAAGCAGATAA TCGTATTGCTGAAAAAACCTTGAAGGAATTGCAAAACAAAGGTGTAGA TGCAAATAGTCAAATTCTCGACCCCATGTTTGTAGATCCAGAAAATGG CGATTTTAGTTTTAAACCAGATTCTCCAGCGCTTAAAATGGGCATCGTT CCTATTGATGTGTCGAAGATTGGTTTACGTAGGTCTAAGTAA (SEQ ID NO 9),
ATGAAACAACGATTGATTATAGTTTTAACCCTAATATTTGGATGTCTAA TCAGTACAGCCCAAACAACAGCGGTTTCAAACGCTGATTTTTATGTGT
CTAACAAAGGGTCCGATAATTGGTCAGGAACATTGGCGAATCCAAATC CCCAAGGTACCGACGGCCCTTTTGCCACTTTGGAAAAAGCAAAAAATC AGTACGTATCTTGAAAAAAAGCAAATCTGAAGATATTGTGGTTTTGATT CGCGATGGCGTTTACAAACTGAACAAGACCGTTGTATTCGGTTTAGAG GATTCTGGTGAAGGTAAATCTACTATTACATACGCTGCTTATCCAAATG AACAACCCGTGTTTAGTTCAGGGAAAGAAATTAAAGGTTGGCAAAAAG TGACGACAGATATTCCGGGATTACCAAATGCTGCTAAAGGTCATATTA TGGTAGCCCATGTTTCAGATAAGTTTTTAACCCTTTATGATGACGAAG
GTATGTTACCACGAGCACAATCAAAAGGCATCATCACAGGAGATGGT
GGTAATAGTAAAAATAAACTTCAATTTCCTGATGGGTTTTTGAAAAATT
GGTCCAATGTCACCGATGTTGAAATAAAAGTAAGACCACATCATGCTT
GGATTTCAAATATACTGCCATTAACATCGGTTGATGAAAAAACAAGCA
CTGCAACCACTTCTATTGACGCTACCTATGCCATGAACAGACTCCATT
TTTTACCAGAAACAGAGAATGCTTGGGTTGAAAATGTGTTGGAAGTAT
TGGATGAAAAGGGCGAATGGGTGTTAAATACAAAAGAAGGCAAAGTG
TACCTTTGGCCACGAAACGATTCTCAAGTTGTAGCTCCACAGTTGTTT
GAGTTAATCCGTGTAGAAGGTAAGATTGATAAAGAAGGTCCAACAGAT
GTTCCGGTTCGTAACCTTCATTTTAAAGGGCTTACTTTTAAACATGGC
GAACGTTATACAATAAAACCAAATGATGCTGGTTTGCAGCACGATTGG
GATATGCACGATAAAGATAATGCTTTAGTGCGTCTCCGTGGAACAGAA
AATTGCGTGATTGAGCAGTGCCATTTTCTTGATAGCGGCAGTGGTGCT
ATTCGTGTGGATCTATATGGGATGAATAATACTATTTCAAATAACCATA
TAGAACATCTTGGAGGCGGTGGTATTTTGCTTTGCGGTTATGGACCAG
GCACAAAAGATGTGAACAAAAAGAATACCATTTACAACAATAATATCCA
TCATGTAGGGCAAATTTATTGGCATTCACCGGGAATCTTTGTTTGGCA
AAGTGGTGAAAATCAAATCTCAAATAATTTGATTCATCATACCGATTAT
ACGGCCATTATTCTATCGGGTTGTATGACTGATTTCTTTGCAAAAAGTC
CTAACGGTCGAGAATTAACACGTACAATACGTCGTAATGAAGTACCTA
AATTCTCGAAAGATGTAAGTCTTGCGGACGTTTTACCTTATTTGCATAC
CCATCATAACGTTGTTGAAAACAATGAAATCCATCACGCCATGGAAAG
GTTGGGAGATGGGAATGCGATTTATATTCGTGGAGCAGGTAGAGATA
ATATCATTCGTCGTAATTATATCCATCACATGGTAGCAGATATGATTAT
GCAAGCAGCCATTCGTACAGATGGTGGACAAACGGGTACTTTAATTAC
AGAAAATTTAATTTACAAATGTACCTCGCAAGGCATTCTTACCAAGCTA
GATAACAAAGTGGAAAATAACATTGTTGCGGACATCATTGCACCACCC
CGAGGCTATTATTTATCATTACGAGAAGGTCCTTTAACTGGCGGAACC
ATTAAACGGAATATTTTATATAGTGTCACAGAAATGGGCAGTTTTATAG
ATGAATTGCCTCCTGGGAAAGAGGGGGCTTCTGAAGACCGAAGAGGA
CGCGTAATAGCAAGCGCCAAGGATGCTGATACCGATTATAATATTTAT TTTAATAAAGCAGACTTGAGCAAAGGAAAGGAACTTATAGAAAAGAAT CAAAATGATGGTGTGGATAAGCATAGTAGAGCAGTGGATCCTCTATTT GTTGATCCGGAAAATGGTGATTTTACATTTAAACCAGGTTCTCCTGCT
CTAGAAATGGGCATTGTTCCTATTGATTTTTCCATGATAGGATTACGTA
CAAAATAA (SEQ ID NO 10),
ATGAAACAACTGTTGATTGCAATTTTTGTGCTAATTATTGGGTGTAAAA
GTAGTACAACTCAAACTGCTTCCAACATAGAGGCAGATTTTTATGTATC
TACAAAAGGATCCGATACTTGGTCTGGCACGTTGGAAAGTCCCAATG CACAAGGCACAGATGGGCCTTTCGCTACCTTGGAACGTGCAAAGGAT
GCGGTACGTATTTTGAAAAAAAAGAAATCAAAAAATATAGTGGTGCTC
ATTCGTGAGGGCGTTTATAAACTTAATGAAACCGTAGTTTTCGGTTTA GAAGATTCTGGTGATGATAAATCAACTATCACCTATGCTGCTTATCCAA ATGAAATAGCTGTATTCAGTTCAGGACAAGAAATCAAAGGTTGGAAAA
AAGTGACTACTGATCTTCCCGGATTAGCAGAAGAAGCCAAAGGAAAG TTGTTGGTTGCAGAAGTTTCGAATAAATTTTTAACGCTTTATGATGAAG
AAGGTATGTTGCCACGAGCCCAATCAGAGCCATACAAATCTTTAAAGA
AAAGTACAGAAAATGATCTTTATTTTTCGAAAGGCGAGCTAAAAAACTG
GCCAAATGTTGAAGATGTAGAAATTTTAGTGCGCCCTACCAGAGAATG
GATTGTAAACATGTTGCCATTGGCATCGGTTGATGAAGAAAAAGGAGT
AGTTCGTGTGGGAGTTGAGGCCACCTATGCGATGCAAAGTAAAGGAT
ATTGGGTAGAGAATGTTTTGGAAGTACTAGATAAACCAGGGGAATGG
GTGTTGAATACCAAGGAAGGAAAAGTGTACCTGTGGCCACGGAACGA
TTCACCTATATGGGCACCAAAGCTTTTAGAACTCATTCGTGTAGAAGG
TAAAATTGATTTCGATGGCTCAAAGGATATTCCCGTTCGAAATCTTCAT
TTTAAAGGACTCACTTTTAAACATGCCGAACGCTATACTTTAACCAAGG
ATGATGCGGGCCTCCAACACGATTGGGACATGCTCGACAAGAATAAT
GCGATGGTACGCTTTAGAGGTACCGAAAATTGCGGGATTGAAGATTG
TCATTTTTTACATGGTGGAAGTGGAGCCATCCGTGTAGATTTACATGG
AATCAATAATAAAATATCCAATAACCATATCGAATATATGGGCGGAGG
CGGCATACTACTTTGCGGTTATGGCCCTGGAACAAAAGACGTAAATAA GCATAATACAGTGTATAATAATAATATACATCATGTTGGGGAAATCTAT TGGCAATCCCCGGGCATTTTCCTTTGGAATAGTGGTGAAAACCGAGTA GCCAACAACCTGATACATGATACTAATTATTGTGGACTCATTGTTTCTG GCTGTGTGATTCGTTTTTTTGAGCATGCTGATAAACGTGAACAATATA GAGCCATCAGGTGGCATGAAATTGGTGAATTGCCCGAAGAATTGACC GCCGATGTGGTGCGACCTTATTGGCACAGTAGAAATAATATTATTGAA TACAACGAAATTCATAACGTGATGAAAAAGTTGGGTGATGGTAACGGC ATTTACATTCGTGCCGCTGGCGCTGGTAACATCATCCGTCGTAATTAT GTGCATCATCTCGTTGCCGAAACAGGAAAACAAAGTGGTATTAGGAC CGATGGTGGACAAATGGATGCACTCATTTCAGAAAACATTATCTACAA ATGTACCTCACAAGGAATGACCTTAAAATTGAACAACCGTTTTGAAAAT AATATTATAGCAGATGTTATTGCACCACCCCGAGGTGTCTATTTAAAAA TTGTTGAAGGTCCGATGAACGGTGCCAGCAATAAAAAAAATATTTTTTA TTCAACTACAGATGAATGCACGTTTATTTCTGAACCATCCCCCGGATC CGGATTGGTAGATGAAGATAGCAGAGGCAGAGAACCTGCACAAATGA AGGATATTGCATCAGACTATAATATCTATTACTGTAAAGCAGATAATCG TATTGCTGAAAAAACCTTGAAGGAATTGCAAAACAAAGGTGTAGATGC AAATAGTCAAATTCTCGACCCCATGTTTGTAGATCCAGAAAATGGCGA TTTTAGTTTTAAACCAGATTCTCCAGCGCTTAAAATGGGCATCGTTCCT ATTGATGTGTCGAAGATTGGTTTACGTAGGTCTAAGTAA (SEQ ID NO 11 ),
ATGGGCAGCAGCCACCATCACCATCACCATGGATCCCTCGACGTTTC AAACGCTGATTTTTATGTGTCTAACAAAGGGTCCGATAATTGGTCAGG AACATTGGCGAATCCAAATCCCCAAGGTACCGACGGCCCTTTTGCCA
CTTTGGAAAAAGCAAAAAATGCAGTACGTATCTTGAAAAAAAGCAAAT CTGAAGATATTGTGGTTTTGATTCGCGATGGCGTTTACAAACTGAACA AGACCGTTGTATTCGGTTTAGAGGATTCTGGTGAAGGTAAATCTACTA
TTACATACGCTGCTTATCCAAATGAACAACCCGTGTTTAGTTCAGGGA AAGAAATTAAAGGTTGGCAAAAAGTGACGACAGATATTCCGGGATTAC CAAATGCTGCTAAAGGTCATATTATGGTAGCCCATGTTTCAGATAAGT
TTTTAACCCTTTATGATGACGAAGGTATGTTACCACGAGCACAATCAA
AAGGCATCATCACAGGAGATGGTGGTAATAGTAAAAATAAACTTCAAT TTCCTGATGGGTTTTTGAAAAATTGGTCCAATGTCACCGATGTTGAAAT AAAAGTAAGACCACATCATGCTTGGATTTCAAATATACTGCCATTAACA TCGGTTGATGAAAAAACAAGCACTGCAACCACTTCTATTGACGCTACC
TATGCCATGAACAGACTCCATTTTTTACCAGAAACAGAGAATGCTTGG
GTTGAAAATGTGTTGGAAGTATTGGATGAAAAGGGCGAATGGGTGTTA
AATACAAAAGAAGGCAAAGTGTACCTTTGGCCACGAAACGATTCTCAA
GTTGTAGCTCCACAGTTGTTTGAGTTAATCCGTGTAGAAGGTAAGATT
GATAAAGAAGGTCCAACAGATGTTCCGGTTCGTAACCTTCATTTTAAA
GGGCTTACTTTTAAACATGGCGAACGTTATACAATAAAACCAAATGAT
GCTGGTTTGCAGCACGATTGGGATATGCACGATAAAGATAATGCTTTA
GTGCGTCTCCGTGGAACAGAAAATTGCGTGATTGAGCAGTGCCATTTT
CTTGATAGCGGCAGTGGTGCTATTCGTGTGGATCTATATGGGATGAAT
AATACTATTTCAAATAACCATATAGAACATCTTGGAGGCGGTGGTATTT
TGCTTTGCGGTTATGGACCAGGCACAAAAGATGTGAACAAAAAGAATA
CCATTTACAACAATAATATCCATCATGTAGGGCAAATTTATTGGCATTC
ACCGGGAATCTTTGTTTGGCAAAGTGGTGAAAATCAAATCTCAAATAA
TTTGATTCATCATACCGATTATACGGCCATTATTCTATCGGGTTGTATG
ACTGATTTCTTTGCAAAAAGTCCTAACGGTCGAGAATTAACACGTACA
ATACGTCGTAATGAAGTACCTAAATTCTCGAAAGATGTAAGTCTTGCG
GACGTTTTACCTTATTTGCATACCCATCATAACGTTGTTGAAAACAATG
AAATCCATCACGCCATGGAAAGGTTGGGAGATGGGAATGCGATTTAT
ATTCGTGGAGCAGGTAGAGATAATATCATTCGTCGTAATTATATCCAT
CACATGGTAGCAGATATGATTATGCAAGCAGCCATTCGTACAGATGGT
GGACAAACGGGTACTTTAATTACAGAAAATTTAATTTACAAATGTACCT
CGCAAGGCATTCTTACCAAGCTAGATAACAAAGTGGAAAATAACATTG
TTGCGGACATCATTGCACCACCCCGAGGCTATTATTTATCATTACGAG
AAGGTCCTTTAACTGGCGGAACCATTAAACGGAATATTTTATATAGTGT
CACAGAAATGGGCAGTTTTATAGATGAATTGCCTCCTGGGAAAGAGG
GGGCTTCTGAAGACCGAAGAGGACGCGTAATAGCAAGCGCCAAGGA
TGCTGATACCGATTATAATATTTATTTTAATAAAGCAGACTTGAGCAAA
GGAAAGGAACTTATAGAAAAGAATCAAAATGATGGTGTGGATAAGCAT
AGTAGAGCAGTGGATCCTCTATTTGTTGATCCGGAAAATGGTGATTTT
ACATTTAAACCAGGTTCTCCTGCTCTAGAAATGGGCATTGTTCCTATT
GATTTTTCCATGATAGGATTACGTACAAAATAA (SEQ ID NO 12) et ATGGGCAGCAGCCACCATCACCATCACCATGGATCCCTCGACAAAAG
TAGTACAACTCAAACTGCTTCCAACATAGAGGCAGATTTTTATGTATCT
ACAAAAGGATCCGATACTTGGTCTGGCACGTTGGAAAGTCCCAATGC
ACAAGGCACAGATGGGCCTTTCGCTACCTTGGAACGTGCAAAGGATG
CGGTACGTATTTTGAAAAAAAAGAAATCAAAAAATATAGTGGTGCTCAT
TCGTGAGGGCGTTTATAAACTTAATGAAACCGTAGTTTTCGGTTTAGA
AGATTCTGGTGATGATAAATCAACTATCACCTATGCTGCTTATCCAAAT
GAAATAGCTGTATTCAGTTCAGGACAAGAAATCAAAGGTTGGAAAAAA
GTGACTACTGATCTTCCCGGATTAGCAGAAGAAGCCAAAGGAAAGTT
GTTGGTTGCAGAAGTTTCGAATAAATTTTTAACGCTTTATGATGAAGAA
GGTATGTTGCCACGAGCCCAATCAGAGCCATACAAATCTTTAAAGAAA
AGTACAGAAAATGATCTTTATTTTTCGAAAGGCGAGCTAAAAAACTGG
CCAAATGTTGAAGATGTAGAAATTTTAGTGCGCCCTACCAGAGAATGG
ATTGTAAACATGTTGCCATTGGCATCGGTTGATGAAGAAAAAGGAGTA
GTTCGTGTGGGAGTTGAGGCCACCTATGCGATGCAAAGTAAAGGATA
TTGGGTAGAGAATGTTTTGGAAGTACTAGATAAACCAGGGGAATGGG
TGTTGAATACCAAGGAAGGAAAAGTGTACCTGTGGCCACGGAACGAT
TCACCTATATGGGCACCAAAGCTTTTAGAACTCATTCGTGTAGAAGGT
AAAATTGATTTCGATGGCTCAAAGGATATTCCCGTTCGAAATCTTCATT
TTAAAGGACTCACTTTTAAACATGCCGAACGCTATACTTTAACCAAGG
ATGATGCGGGCCTCCAACACGATTGGGACATGCTCGACAAGAATAAT
GCGATGGTACGCTTTAGAGGTACCGAAAATTGCGGGATTGAAGATTG
TCATTTTTTACATGGTGGAAGTGGAGCCATCCGTGTAGATTTACATGG
AATCAATAATAAAATATCCAATAACCATATCGAATATATGGGCGGAGG
CGGCATACTACTTTGCGGTTATGGCCCTGGAACAAAAGACGTAAATAA
GCATAATACAGTGTATAATAATAATATACATCATGTTGGGGAAATCTAT
TGGCAATCCCCGGGCATTTTCCTTTGGAATAGTGGTGAAAACCGAGTA
GCCAACAACCTGATACATGATACTAATTATTGTGGACTCATTGTTTCTG
GCTGTGTGATTCGTTTTTTTGAGCATGCTGATAAACGTGAACAATATA
GAGCCATCAGGTGGCATGAAATTGGTGAATTGCCCGAAGAATTGACC
GCCGATGTGGTGCGACCTTATTGGCACAGTAGAAATAATATTATTGAA
TACAACGAAATTCATAACGTGATGAAAAAGTTGGGTGATGGTAACGGC ATTTACATTCGTGCCGCTGGCGCTGGTAACATCATCCGTCGTAATTAT GTGCATCATCTCGTTGCCGAAACAGGAAAACAAAGTGGTATTAGGAC CGATGGTGGACAAATGGATGCACTCATTTCAGAAAACATTATCTACAA ATGTACCTCACAAGGAATGACCTTAAAATTGAACAACCGTTTTGAAAAT AATATTATAGCAGATGTTATTGCACCACCCCGAGGTGTCTATTTAAAAA TTGTTGAAGGTCCGATGAACGGTGCCAGCAATAAAAAAAATATTTTTTA TTCAACTACAGATGAATGCACGTTTATTTCTGAACCATCCCCCGGATC CGGATTGGTAGATGAAGATAGCAGAGGCAGAGAACCTGCACAAATGA AGGATATTGCATCAGACTATAATATCTATTACTGTAAAGCAGATAATCG TATTGCTGAAAAAACCTTGAAGGAATTGCAAAACAAAGGTGTAGATGC AAATAGTCAAATTCTCGACCCCATGTTTGTAGATCCAGAAAATGGCGA TTTTAGTTTTAAACCAGATTCTCCAGCGCTTAAAATGGGCATCGTTCCT ATTGATGTGTCGAAGATTGGTTTACGTAGGTCTAAGTAA (SEQ ID NO 13). Il peut s’agir d’un acide nucléique comprenant ou consistant en une séquence ayant au moins 67% d’identité avec la séquence SEQ ID NO 8, par exemple au moins 70%, 80%, 85%, 90%, 95%, 99% d’identité avec la séquence SEQ ID NO 8 ou ayant au moins 67% d’identité avec la séquence SEQ ID NO 9, par exemple au moins 70%, 80%, 85%, 90%, 95%, 99% d’identité avec la séquence SEQ ID NO 9.
Le pourcentage d’identité entre deux séquences nucléotidiques peut être déterminé de la même manière que le pourcentage d’identité entre deux séquences d’acides aminés.
Les « conditions de forte stringence » sont des conditions connues de l’homme du métier, et peuvent par exemple correspondre des conditions d'hybridations sur ADN lié à un filtre dans un tampon salin citrate de sodium (SSC) 5X, dodécyl sulfate de sodium (SDS) 2%, 100 microgram mes/mL d'ADN simple-brin, à 55-65°C pendant 8 heures, et lavage dans SSC 0,2X et SDS 0,2% à 60-65°C pendant 30 minutes.
Les séquences des acides nucléiques dérivés peuvent inclure des mutations telles que des substitutions, délétions et/ou insertions de nucléotides. Les substitutions peuvent soit être silencieuses, soit conduire à des mutations au niveau de la protéine codée par l’acide nucléiques. De préférence, les substitutions, délétions et/ou insertions au niveau de la séquence nucléotidique ne conduisent pas à un changement de phase de lecture, ni à l’introduction d’un codon-stop.
Il peut s’agir par exemple d’un acide nucléique choisi dans le groupe comprenant un acide nucléique consistant en la séquence SEQ ID NO 8 ou SEQ ID NO 9.
Selon l’invention, les acides nucléiques, quel que soit leurs séquences, peuvent comprendre en outre, à leur extrémité 5’, une séquence codant pour une séquence signal ou séquence d’adressage. Il peut s’agir par exemple de toute séquence codant pour une séquence signal ou séquence d’adressage adaptée connue de l’homme du métier.
Selon l’invention, les acides nucléiques, quel que soit leurs séquences, peuvent comprendre en outre, à leur extrémité 5’, une séquence codant pour une étiquette de purification (« purification tag » en anglais). Il peut s’agir par exemple d’un acide nucléique de séquence ATGGGCAGCAGCCACCATCACCATCACCATGGATCCCTCGAC (SEQ ID NO 14).
La présente invention a également pour objet des sondes et/ou des amorces nucléotidiques comprenant ou consistant en un fragment de SEQ ID NO : 12 ou de SEQ ID NO : 13. De telles sondes et amorces peuvent par exemple comprendre ou consister en 15 à 50 nucléotides consécutifs, préférentiellement 18 à 35 nucléotides consécutifs, de SEQ ID NO : 12 ou de SEQ ID NO : 13. De telles sondes et amorces ne codent pas pour une enzyme glycoside hydrolase selon l’invention mais sont utiles pour le clonage, le séquençage et/ou la détection d’acides nucléiques selon l’invention. Les sondes peuvent éventuellement être marquées, par exemple grâce à un marqueur radioactif ou à un fluorophore. Par ailleurs, les sondes et amorces peuvent comprendre, outre un fragment de la séquence SEQ ID NO : 12 ou de la SEQ ID NO : 13, une séquence hétérologue telle que la séquence d’un site de restriction ou une séquence de liaison à un marqueur. Les acides nucléiques selon l’invention peuvent être préparés par synthèse chimique ou par génie génétique en utilisant les techniques bien connues de l’homme du métier et décrites, entre autres, dans Molecular Cloning - A Laboratory Manual [15], Des acides nucléiques selon l’invention peuvent par exemple être obtenus par amplification des gènes de Mariniflexile fucanivorans à l’aide de la méthode PCR (Polymerase Chain Reaction), par exemple comme décrit dans l’exemple 1. Le fragment d’acides nucléiques ainsi amplifié peut ensuite être cloné dans un vecteur d’expression selon les techniques décrites Molecular Cloning - A Laboratory Manual [15] et/ou dans l’exemple 1.
Dans la présente invention, la ou les séquences nucléotidiques codant l’enzyme glycoside hydrolase, par exemple la fucanase ou endo-a- 1 ,4-fucanase peu(ven)t être contenue(s) indépendamment dans un vecteur d’expression adapté pour leur expression.
La présente invention se rapporte également à un vecteur comprenant un acide nucléique selon l’invention. Il peut s’agir par exemple d’un vecteur comprenant un acide nucléique choisi dans le groupe comprenant un acide nucléique de séquence SEQ ID NO 8, un acide nucléique de séquence SEQ ID NO 9, un acide nucléique de séquence SEQ ID NO 10, un acide nucléique de séquence SEQ ID NO 11 , un acide nucléique de séquence SEQ ID NO 11 et un acide nucléique de séquence SEQ ID NO 12. Par exemple, il peut s’agir d’un vecteur comprenant un acide nucléique choisi dans le groupe comprenant un acide nucléique de séquence SEQ ID NO 8 et un acide nucléique de séquence SEQ ID NO 9.
Le vecteur peut être un des vecteurs connus de l’homme du métier pour produire des protéines recombinantes. Il est choisi en général notamment en fonction de l’hôte cellulaire utilisé. Le vecteur peut être par exemple choisi parmi les vecteurs listés dans le catalogue http://www.promega.com/vectors/mammalian_express_vectors.htm [21] ou http://www.qiagen.com/overview/qiagenes. aspx?gaw=PRQTQIAgenes080 7&gkw=mammalian+expression [22], ou encore http://www.scbt.com/chap_exp_vectors. php?type=pCruzTM%20Expressio n%20Vectors [23], Il peut s’agir par exemple du vecteur d’expression décrit dans le document WO 83/004261. Le vecteur peut être par exemple un vecteur plasmidique, par exemple le vecteur pF04 de séquence SEQ ID NO 17, par exemple tel que représenté sur la figure 2. Il peut s’agir également de tout vecteurs adaptés connus de l’homme du métier disponibles dans le commerce. Il peut s’agir par exemple des vecteurs de la série pET par exemple commercialisé par la société Novagen ou Merck, du vecteur pGEX par exemple commercialisé par la société VWR international, du vecteur pMAL par exemple commercialisé par la société New England Biolabs etc. Par exemple le vecteur d’expression peut être un vecteur plasmidique comprenant, outre la séquence d'acide nucléique selon l’invention, les moyens nécessaires à son expression. Ces moyens peuvent par exemple inclure un promoteur et un terminateur de transcription. Le vecteur d’expression peut également comporter d’autres éléments tels qu’une origine de réplication, un site de clonage multiple, un enhanceur, un peptide signal qui pourra être fusionné en phase avec le polypeptide de l’invention lors du clonage, et un ou plusieurs marqueurs de sélection.
Le vecteur peut comprendre une séquence polynucléotidique, par exemple une cassette d'expression, comprenant les éléments suivants dans l'ordre 5' à 3' : une séquence promotrice ; une séquence d'acide nucléique codant pour une enzyme de l'invention ; et une séquence de polyadénylation (polyA).
Le promoteur peut être tout promoteur connu de l'homme du métier. Il peut s'agir par exemple d'un promoteur constitutif, d'un promoteur de gène viral, d'un promoteur spécifique de tissu.
Il peut s'agir par exemple de promoteurs de gènes viraux choisis dans le groupe comprenant le promoteur du CMV. Il peut s’agir par exemple du promoteur T7 par exemple du promoteur contenu dans le vecteur commercial pET15B, par exemple commercialisé par la société Novagen [14] codant pour la T7 RNA polymérase.
Le vecteur peut être choisi en fonction de la cellule hôte sélectionnée. L'homme du métier compte tenu de ses connaissances techniques, adaptera le vecteur en fonction de la cellule hôte.
La cellule hôte peut être tout hôte approprié pour l'expression des acides nucléiques ou des vecteurs de l'invention. Il peut s'agir, par exemple, de cellules de mammifères, de E. coli, de Pischia pastoris, de Saccharomyces cerevisiae, ou de cellules d'insectes, par exemple un système cellule d'insecte-baculovirus, par exemple des cellules d'insectes SF9 utilisées dans un système d'expression baculovirus. Il peut s’agir par exemple Escherichia coli.
Les acides nucléiques de la présente invention ou les vecteurs de la présente invention sont utilisables notamment pour la production de l’enzyme glycoside hydrolase, par exemple la fucanase ou endo-a-1 ,4- fucanase selon l’invention. Aussi, la présente se rapporte également à une cellule hôte comprenant une séquence d’acide nucléique codant pour une enzyme glycoside hydrolase, par exemple une fucanase ou endo-a-1 ,4- fucanase ou un vecteur codant pour une enzyme glycoside hydrolase, par exemple une fucanase ou endo-a-1 ,4-fucanase.
La présente invention a également pour objet une cellule hôte comprenant un acide nucléique selon l’invention, ou un vecteur selon l’invention.
La cellule hôte ou hôte cellulaire peut être tout hôte approprié pour la production d’une enzyme glycoside hydrolase, par exemple la fucanase ou endo-a-1 ,4-fucanase de la présente à partir des vecteurs précités comprenant une séquence nucléotidique codant une enzyme glycoside hydrolase, par exemple une fucanase ou endo-a-1 ,4-fucanase selon l’invention.
On entend par « cellule hôte » au sens de la présente invention une cellule procaryote ou eucaryote. Des cellules hôtes couramment utilisées pour l’expression de protéines recombinantes incluent notamment des cellules de bactéries telles que Escherichia coli ou Bacillus sp., des cellules de levures telles que Saccharomyces cerevisiae, des cellules de champignons tels que Aspergillus niger, des cellules d’insectes, et des cellules de mammifères (notamment humaines) telles que les lignées cellulaires HEK 293, PER-C6, CHO, etc... Il peut s’agir par exemple d’ Escherichia coli. La transformation des cellules procaryotes et eucaryotes est une technique bien connue de l’homme du métier, par exemple la lipofection, l’électroporation, le choc thermique, ou des méthodes chimiques. En fonction de la cellule à transformer, l’homme du métier pourra aisément déterminer les moyens nécessaires à la transformation de la cellule hôte choisie. Ainsi le vecteur d’expression et la méthode d’introduction du vecteur d’expression au sein de la cellule hôte seront sélectionnés en fonction de la cellule hôte choisie. La cellule hôte transformée par un vecteur d’expression va produire une protéine correspondante par exemple sous forme recombinante. La cellule hôte transformée par un vecteur d’expression ou un acide nucléique selon l’invention exprime préférentiellement l’enzyme ou la protéine selon l’invention de manière stable. L’homme du métier peut aisément vérifier que la cellule hôte produit l’enzyme ou la protéine, par exemple recombinante, par exemple en utilisant la technique du Western blot.
Les cellules hôtes selon l’invention sont notamment utiles pour produire des enzymes glycosides hydrolases selon l’invention. L’invention concerne donc une méthode de production d’une enzyme glycoside hydrolase selon l’invention comprenant l’étape de cultiver une cellule hôte selon l’invention dans des conditions permettant l’expression dudit enzyme glycoside hydrolase selon l’invention. Cette méthode peut en outre comprendre une étape de purification de ladite enzyme glycoside hydrolase selon l’invention. Les étapes de culture et de purification peuvent par exemple être réalisées comme décrit dans l’exemple 2.
La présente invention se rapporte également à un procédé de fabrication d’une enzyme glycoside hydrolase selon l’invention par recombinaison génétique utilisant un acide nucléique selon l’invention, ou un vecteur selon l’invention.
Selon l’invention, le procédé de recombinaison génétique peut être tout procédé de recombinaison génétique adapté connu de l’homme du métier.
Il peut s’agir également d’un procédé de production d’enzymes glycoside hydrolase selon l’invention par transformation d’une cellule hôte par utilisation d’un vecteur tel que défini ci-dessus et incubation de ladite cellule transformée.
Dans ce procédé, la cellule hôte peut être toute cellule connue de l’homme du métier adaptée. Il peut s’agir par exemple des cellules hôtes telles que définies ci-dessus.
Selon l’invention, la transformation peut être réalisée par tout procédé connu de l’homme du métier. La transformation des cellules procaryotes et eucaryotes est une technique bien connue de l’homme du métier, par exemple la lipofection, l’électroporation, le choc thermique, ou des méthodes chimiques. En fonction de la cellule à transformer, l’homme du métier pourra aisément déterminer les moyens nécessaires à la transformation de la cellule hôte choisie.
Selon l’invention, l’incubation peut être réalisée par tout procédé connu de l’homme du métier. L’incubation/la culture des cellules procaryotes et eucaryotes est une technique bien connue de l’homme du métier. En fonction de la cellule, l’homme du métier pourra aisément déterminer les moyens nécessaires, milieu de culture, conditions de temps et de température requis pour l’incubation/la culture de la cellule hôte choisie.
Selon l’invention, le procédé de fabrication peut comprendre une étape, après transformation et culture/incubation de la cellule transformée, de purification de l’enzyme glycoside hydrolase.
La purification dudit enzyme glycoside hydrolase produite peut être réalisée par tout moyen connu de l’homme du métier. Il peut s’agir par exemple d’une technique choisie parmi une électrophorèse, un tamisage moléculaire, une ultracentrifugation, une précipitation différentielle, par exemple au sulfate d’ammonium, une ultrafiltration, une filtration sur membrane ou sur gel, un échange d’ions, une séparation par interactions hydrophobes, ou une chromatographie d’affinité, par exemple de type IMAC.
Selon l’invention, le procédé de fabrication peut également comprendre une étape, après transformation et culture/incubation de la cellule transformée, une étape de récupération des enzymes glycoside hydrolase. Cette étape de récupération ou d’isolement peut être réalisée par tout moyen connu de l’Homme du métier. Il peut s’agir par exemple d’une technique choisie parmi une électrophorèse, un tamisage moléculaire, une ultracentrifugation, une précipitation différentielle, par exemple au sulfate d’ammonium, par ultrafiltration, une filtration sur membrane ou sur gel, un échange d’ions, une élution sur hydroxyapatite, une séparation par interactions hydrophobes, ou tout autre moyen connu.
La présente invention se rapporte également à un procédé de dégradation de fucanes sulfatés comprenant une étape de mise en contact des fucanes sulfatés avec une enzyme glycoside hydrolase isolé selon l’invention, ou avec une cellule hôte selon l’invention, dans des conditions permettant la dégradation des fucanes sulfatés par digestion enzymatique par ladite enzyme glycoside hydrolase ou ladite cellule hôte.
La détermination de la dégradation de fucanes sulfatés ou l’activité fucanolytique des enzymes glycoside hydrolase isolées selon l’invention peut être déterminée ou mesurée par tout procédé adapté connu de l’homme du métier. Il peut s’agir par exemple du procédé décrit dans le document Zabkackis et Perez (Zablackis E, Perez J: A partially pyruvated Carrageenan from Hawaiian Grateloupia filicina (Cryptonemiales, Rhodophyta). Botanica Marina 1990, 33:273-276. [20] comprenant la détermination et/ou suivie du relargage d’oligosaccharides de fucanes sulfatés, également dénommé olio-fucanes, par C-PAGE ( électrophorèse sur gel de polyacrylamide-carbohydrate ou « Carbohydrate- PolyAcrylamide Gel Electrophoresis » en anglais) ou du procédé décrit dans Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021 - 1032 [9],
La détermination de la dégradation de fucanes sulfatés ou l’activité fucanolytique permet à l’homme du métier de trouver les conditions optimales de concentration d’enzyme glycoside hydrolase, par exemple de fucanase, par exemple d’endo-a-1 ,4-fucanase utilisé et de concentration des fucanes sulfatés pour la dégradation des fucanes sulfatés dans le milieu où ils se trouvent ou dans le milieu dans lequel ils ont été placés. Le pH peut être compris de préférence entre 6,5 et 8,5 de préférence à 7,5. Il s’agit en effet de la gamme de pH optimale. La température est de préférence comprise entre 15 et 30°C, par exemple à 20°C. L’étape de digestion enzymatique peut être réalisé pendant un temps compris de 12 à 36 heures, par exemple pendant 24 heures.
Dans la présente, les fucanes sulfatés peuvent être tout fucanes sulfatés connus de l’homme du métier quel que soit l’origine et/ou disponibles dans le commerce. Il peut s’agir par exemple de fucanes sulfatés comprenant une chaine principale comprenant des L-fucoses liés alternativement par des liaisons a-1 ,4 et a-1 ,3. Il peut s’agir par exemple de fucanes sulfatés provenant d’algues, par exemple d’algues brunes. Il peut s’agir par exemple de fucanes sulfatés provenant d’algues de l’ordre des Fucales, par exemple appartenant à la classe des Phaeophyceae. Il peut s’agir par exemple de fucanes sulfatés provenant d’algues choisies dans le groupe comprenant Pelvetia sp., par exemple Pelvetia canaliculata, Ascophylum sp., par exemple Ascophylum nodosum, Fucus sp., par exemple Fucus vesiculosus.
Dans la présente, lorsque les fucanes sulfatés proviennent d’algues, le procédé peut comprendre préalablement une étape d’extraction et de purification desdits fucanes sulfatés. Il peut s’agir par exemple de tout procédé de purification et d’extraction connu de l’homme du métier adapté à l’extraction et à la purification de fucanes sulfatés à partir d’algues. Il peut s’agir par exemple du procédé décrit dans le document Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata. International Journal of Biological Macromolecules 2021 , 201 :143-157. [18].
Dans la présente, le procédé peut comprendre en outre après l’étape de digestion enzymatique une étape de récupération et de purification des fragments de fucanes sulfatés et/ou des oligosaccharides obtenus à partir de la digestion enzymatique de fucanes sulfatés. Il peut s’agir de tout procédé de récupération et de purification adapté connu de l’homme du métier. Il peut s’agir par exemple d’un procédé choisi parmi une électrophorèse, un tamisage moléculaire, une ultracentrifugation, une précipitation différentielle, par exemple au sulfate d’ammonium, par ultrafiltration, une filtration sur membrane ou sur gel, un échange d’ions, une élution sur hydroxyapatite, une séparation par interactions hydrophobes, ou tout autre moyen connu.
La présente invention a également pour objet l’utilisation d’une enzyme glycoside hydrolase pour la production d’oligosaccharides de fucanes sulfatés.
L’enzyme glycoside hydrolase est telle que définie ci-dessus.
Dans la présente par oligosaccharide de fucanes sulfatés, également dénommé oligo-fucanes, on entend un oligosaccharide obtenu par clivage des liaisons a-1 ,4 au sein de fucanes sulfatés comprenant une chaine principale comprenant des L-fucoses liés alternativement par des liaisons a-1 ,4 et a-1 ,3. Il peut s’agir par exemple d’un oligosaccharide composé ou constitué de motifs de répétition disaccharidiques de type A, B et/ou C tel que décrits dans la Figure 1 .
La présente invention permet avantageusement de mobiliser la très grande ressource d’algues actuellement inexploitée, notamment d’algues brunes. L’invention permet en outre de favoriser la biodégradation des algues, notamment des algues brunes, de produire des molécules originales, qui sont des fragments de fucanes sulfaté, et d’offrir une source nouvelle de monosaccharides/oligosaccharides rares pour des applications cosmétiques, agroalimentaires et médicaments ou formulations pharmaceutiques et parapharmaceutiques.
L’invention permet également de produire des molécules originales, qui sont des fragments de fucanes sulfatés, par exemple des oligosaccharides.
La présente invention a donc également pour objet un oligosaccharide de fucane sulfaté obtenu selon le procédé de dégradation de fucanes selon l’invention ou l’utilisation d’une enzyme glycoside hydrolase selon l’invention pour la production d’oligosaccharides de fucanes sulfatés.
Selon l’invention les oligosaccharides de fucanes sulfatés obtenus selon le procédé de l’invention et/ou l’utilisation selon l’invention peut être au moins un oligosaccharide comprenant de 2 à 10 monomères de fucoses et/ou comprenant de 2 à 10 groupements sulfates. Il peut s’agir par exemple d’oligosaccharides de fucanes sulfatés choisis dans le groupe comprenant des oligosaccharides constitués de 4 monomères de fucoses comprenant 4 à 7 groupements sulfates, par exemple 4 monomères fucoses comprenant 4 groupements sulfates, 4 monomères fucose comprenant 5 groupements sulfates, 4 fucoses comprenant 6 groupements sulfates, 4 fucoses comprenant 7 groupements sulfates. Il peut s’agir par exemple d’oligosaccharides de fucanes sulfatés choisis dans le groupe comprenant des oligosaccharides constitués de 6 monomères de fucoses comprenant 6 à 10 groupements sulfates, par exemple 6 monomères fucoses comprenant 6 groupements sulfates, 6 monomères fucoses comprenant 7 groupements sulfates, 6 monomères fucoses comprenant 8 groupements sulfates, 6 monomères fucoses comprenant 9 groupements sulfates, 6 monomères fucoses comprenant 9 groupements sulfates et 6 monomères fucoses comprenant 10 groupements sulfates. Il peut s’agir par exemple d’oligosaccharides de fucanes sulfatés choisis dans le groupe comprenant des oligosaccharides constitués de 8 monomères de fucoses comprenant 6 à 10 groupements sulfates, par exemple 8 monomères fucoses comprenant 6 groupements sulfates, 8 monomères fucoses comprenant 7 groupements sulfates, 8 monomères fucoses comprenant 8 groupements sulfates, 8 monomères fucose comprenant 9 groupements sulfates, 8 monomères fucose comprenant 9 groupements sulfates et 8 monomères fucose comprenant 10 groupements sulfates.
Les produits de dégradation des fucanes sulfatés donnent accès à de nouveaux produits qui peuvent être des actifs alimentaires, cosmétiques, pharmaceutiques et parapharmaceutiques utilisables dans les domaines agroalimentaires, cosmétiques, pharmaceutiques et parapharmaceutiques. Ces nouveaux produits peuvent également être des produits non actifs mais présentant une neutralité et/ou stabilité qui est très intéressante pour une utilisation dans chacun de ces domaines.
La présente invention ouvre également de nouvelles perspectives d’utilisation des algues brunes pour des applications en bioénergie et en chimie. La production d’oligosaccharides peut donner des molécules de base pour la fabrication d’autres molécules. La dépolymérisation des fucanes sulfatés devrait faciliter la fermentation par des microorganismes conduisant à la production de bioéthanol par exemple.
D’autres caractéristiques et avantages apparaitront encore à l’Homme du métier à la lecture des exemples ci-dessous, donnés à titre illustratif et non limitatif, en référence aux figures annexées.
Brève description des figures
La figure 1 représente des schémas de motifs de disaccharides comprenant un à trois sulfates constituant la chaîne principale des fucanes sulfatés des algues brunes de l’ordre des Fucales comprenant l’espèce Pelvetia canaliculata. La figure 1 A représente un schéma d’un motif disaccharides comprenant un groupement sulfate : Motif de type A : [^4)- a-L-fucopyranose-2-sulfate-(1^3)-a-L-fucopyranose-(1^]. La figure 1 B représente un schéma d’un autre motif disaccharides comprenant deux groupements sulfates : motif de type B : [^4)-a-L-fucopyranose-2-sulfate- (1^3)-a-L-fucopyranose-2-sulfate-(1^]. La figure 1 C représente un schéma d’un autre motif disaccharides comprenant trois groupements sulfates : motif de type C : [4^)a-L-fucopyranose-2,3-disulfate-(1^3)-a-L- fucopyranose-2-sulfate-(1^] (Ropartz et collaborateurs (Ropartz D, Marion L., Fanuel M, Nikolic J, Jam M, Larocque R, Ficko-Blean E, Michel G, Rogniaux H, (2022) In-depth structural characterization of oligosaccharides released by GH107 endofucanase MfFcnA reveals enzyme subsite specificity and sulfated fucan substructural features. Glycobiology, 32, 276-288) [28]).
La figure 2 représente un schéma du plasmide pFO4.
La figure 3 représente une photographie d’un gel C-PAGE obtenu à partir d’échantillons obtenus après incubation de fucanes sulfatés désignés FCSPs (FCSP : fucose containing sulfated polysaccharides en anglais) des algues brunes Pelvetia canaliculata (P. canaliculata), Ascophyllum nodosum (A. nodosum) et Fucus vesiculosus (F. vesiculosus) incubés avec protéines recombinantes pMF8 et pMF9 actives (pistes paires) ou inactivés par chaleur (« control ») (pistes impaires).
La figure 4 représente des spectres de masse des oligosaccharides obtenus (figure 4 A - L), en particulier des oligosaccharides de fucanes sulfatés également dénommés oligo-fucanes, après digestion enzymatique par une enzyme glycoside hydrolase, en particulier une endo-a-1 ,4- fucanases, en particulier la protéine recombinante pMF8, obtenus par chromatographie liquide ultra-haute performance couplée à la spectrométrie de masse haute résolution (UPLC-MS). Sur cette figure RT signifie temps de rétention, l’axe des ordonnées correspond à une intensité arbitraire (sans unité), l’axe des abscisses le rapport masse/charge (m/z), Fuc : sous unité fucane (masse monoisotopique = 164.0685 Daltons), S : sulfatation ou sulfate (incrément de masse monoisotopique de la modification = 79.9568 Daltons), H : hydrogène (masse monoisotopique = 1.0078 Daltons, HxA : HexylAmine (masse monoisotopique = 101.1204 Daltons. La valeur RT indique l’ordre d’élution des différents oligosaccharides sur la chromatographie liquide.
La figure 5 représente des spectres de masse des oligosaccharides obtenus (figures 5 A - P), en particulier des oligosaccharides de fucanes sulfatés également dénommés oligo-fucanes, après digestion enzymatique par une enzyme glycoside hydrolase, en particulier une endo-a-1 ,4- fucanases, en particulier la protéine recombinante pMF9, obtenus par chromatographie liquide ultra-haute performance couplée à la spectrométrie de masse haute résolution (UPLC-MS). Sur cette figure RT signifie temps de rétention, l’axe des ordonnées correspond à une intensité arbitraire (sans unité), l’axe des abscisses le rapport masse/charge (m/z), Fuc : sous unité fucane (masse monoisotopique = 164.0685 Daltons), S : sulfatation ou sulfate (incrément de masse monoisotopique de la modification = 79.9568 Daltons), H : hydrogène (masse monoisotopique = 1.0078 Daltons, HxA : HexylAmine (masse monoisotopique = 101.1204 Daltons. La valeur RT indique l’ordre d’élution des différents oligosaccharides sur la chromatographie.
Figure 6 : la figure 6A représente un spectre de masse MS/MS obtenus sur les ions produits sous forme [M+4.HxA]+ au rapport masse sur charge m/z 955.6 des oligo-fucanes de degré de polymérisation 2 obtenus par hydrolyse de fucane par une enzyme glycoside hydrolase, en particulier une endo-a-1 ,4-fucanases, en particulier la protéine recombinante pMF8. La figure 6B représente un schéma des structures des produits obtenus. La nomenclature des annotations, sur le spectre et les structures correspond au standard introduit dans Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397- 409 [30].
Figure 7 : la figure 7A représente un spectre de masse MS/MS obtenus sur les ions produits sous forme [M+4.HxA]+ au rapport masse sur charge m/z 955.6 des oligo-fucanes de degré de polymérisation 2 obtenus par hydrolyse de fucane par une enzyme glycoside hydrolase, en particulier une endo-a-1 ,4-fucanases, en particulier la protéine recombinante pMF9. La figure 7B représente un schéma des structures des produits obtenus. La nomenclature des annotations, sur le spectre et les structures correspond au standard introduit dans Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397- 409 [30],
La figure 8 représente un diagramme en bâton correspondant aux intensités moyennes mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits.
La figure 9 représente un diagramme en bâton correspondant aux intensités moyennes) mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits.
La figure 10 représente un diagramme en bâton correspondant au pourcentage relatif des intensités mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans distinction des différents isomères produits.
La figure 11 représente un diagramme en bâton correspondant au pourcentage relatif des intensités mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans distinction des différents isomères produits.
La figure 12 représente un diagramme en bâton correspondant aux intensités moyennes mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans distinction des différents isomères produits.
La figure 13 représente un diagramme en bâton correspondant aux intensités moyennes mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec la distinction des différents isomères produits.
La figure 14 représente un diagramme en bâton correspondant au pourcentage relatif des intensités mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec la distinction des différents isomères produits.
La figure 15 représente un diagramme en bâton correspondant au pourcentage relatif des intensités mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec la distinction des différents isomères produits. EXEMPLES
Exemple 1 : identification et clonage des gènes codant pour des enzymes glycoside hydrolases, en particulier des endo-a-1, 4- fucanases.
Les cadres de lecture ouverts codant les enzymes glycoside hydrolases, en particulier d’endo-a-1 ,4-fucanases, désignés FcnB et FcnC ont été identifiés sur la base de la séquence complète du génome de Mariniflexile fucanivorans (NCBI Accession No. NZ_SLUP00000000.1 ). Ces gènes ont été identifiés et sélectionnés parmi un groupe de gènes candidats localisés dans le génome de M. fucanivorans. L’activité enzymatique des protéines-candidates recombinantes a été ensuite criblée par C-PAGE en utilisant le fucane sulfaté de P. canaliculata [18], Il a été démontré de manière surprenante et inattendue que deux gènes avaient une activité endo-a-1 ,4-fucanase, qui ont été nommé fcnB et fcnC.
Les gènes entiers des endo-a-1 ,4-fucanases FcnB et FcnC, comprenant notamment une séquence codant pour un signal peptide et un module catalytique, ont été tronqués par génie génétique, à savoir par PCR selon le protocole décrit ci-dessous, afin d’isoler et de produire une protéine recombinante contenant uniquement le module catalytique de ladite enzyme, à savoir les acides aminés 25-725 de la séquence SEQ ID NO 3 pour l’endo-a-1 ,4-fucanase FcnB et les acides aminés 16-717 de la séquence SEQ ID NO 4 pour l’endo-a-1 , 4-fucanase FcnC. Les protéines recombinantes obtenues ont été respectivement désignées pMF8 et pMF9.
Plus précisément, les séquences nucléotidiques cibles ont été amplifiés en parallèle par amplification en chaîne par polymérase (PCR), partant du matériel ADN génomique de M. fucanivorans, avec des amorces en 5’ et 3’.
Les amorces utilisées étaient respectivement :
- pour l’endo-a-1 ,4-fucanase désignée FcnB :
FcnB w : TTTTTTGTCGACGTTTCAAACGCTGATTTTTATGTGTC (SEQ ID NO 15) FcnB_rev :
AAAAAACTGCAGTTATTTTGTACGTAATCCTATCATGGA (SEQ ID NO 16)
- pour l’endo-a-1 ,4-fucanase désignée FcnC :
FcnC w: TTTTTTGTCGACAAAAGTAGTACAACTCAAACTGCTTC (SEQ ID NO 17)
FcnC_rev: AAAAAACTGCAGTTACTTAGACCTACGTAAACCAATCT (SEQ ID NO 18)
Le cycle PCR était le suivant : 98°C pendant 2 minutes, puis 98°C pendant 10 secondes puis 60°C pendant 15 secondes puis 72°C pendant 3 minutes, le cycle étant répété 30 fois, enfin 72°C pendant minutes.
L’enzyme utilisée est la Q5 High Fidelity DNA Polymerase commercialisé par la société New England Biolabs (référence catalogue M0491 L)
Pour chaque réaction de PCR totalisant 50 pl ont été ajouté :
1 unité Q5 High Fidelity DNA Polymerase (New England Biolabs),
10 pl X Q5 buffer (New England Biolabs),
0,4 pl 25 mM dNTPs (New England Biolabs),
0,2 pl d’ADN génomique de Marineflexile fucanivorans SW5,
0,5 pl 100 pM amorce FcnB ou FcnC fw,
0,5 pl 100 pM amorce FcnB ou FcnC rev, et complété à 50 pl avec de l’eau distillée sans ADN (DNA-free dH2Û en anglais).
Les produits d’amplification PCR, à savoir les séquences d’acides nucléiques codant pour les modules catalytiques de FcnB et FcnC, respectivement, ont ensuite été purifiés avec le kit Qiaquick PCR Purification Kit commercialisé par la société QIAGEN tel que décrit dans la notice du produit cat# 28104 et élués avec 50 pL d’eau. Les produits PCR purifiés ont à leur tour été digérés pendant quatre heures à 37°C avec le mélange des enzymes de restriction Sall/Pstl pour chaque réaction :0,5 pl Sall-HF 20 unités/pl (commercialisé par New England Biolabs référence catalogue R3138L), 0,5 pl Pstl-HF 20 unités/pl (commercialisé par New England Biolabs référence catalogue R3140L), 6,0 pl tampon 10X Cutsmart (commercialisé par New England Biolabs référence catalogue B6004S), 3,0 pl d’eau distillée (dH2O), 50 pl produit PCR ont été ensuite purifié sur colonne QIAGEN (QIAquick Spin Columns).
Après digestion, les produits ont été à nouveau purifiés avec le kit Qiaquick PCR Purification Kit tel que décrit précédemment puis élués avec 25 pL de H2O.
Les produits de PCR ont été ligaturés selon le procédé décrit par Groisillier et collaborateurs [14] dans le vecteur pFO4 (dérivé du vecteur pET15b de Novagen, [14]) représenté sur la figure 2. Le vecteur, à savoir le plasmide pFO4 a été préalablement digéré et déphosphorylé par les enzymes de restrictions Xhol/Nsil et recombinant shrimp alkaline phosphatase (rSAP) respectivement comme suit: 1 pl d’ADN plasmidique pFO4 (1 pg/pl), 0,5 pl Xhol 20 unités/pl (commercialisé par New England Biolabs référence catalogue R0146L) 0,5 pl Nsil-HF 20 unités/pl (commercialisé par New England Biolabs référence catalogue R3127L) 3,0 pl 10X tampon Cutsmart (Cutsmart buffer en anglais commercialisé par New England Biolabs référence catalogue B6004S) 1 ,0 pl rSAP (commercialisé par New England Biolabs référence catalogue M0371 L) et 24 pl dH2O.
Cette procédure de ligature a été effectuée avec la T4 ADN Ligase à 20°C pendant 4 heures suivi d'une incubation durant une nuit, à savoir pendant 12 heures à 10 °C. La ligation a été effectuée avec 1 ,0 pl pFO4/Sall/Nsil (10 ng/pl), 0,5 pl tampon 10 T4 DNA ligase (en anglais « 10 T4 DNA ligase buffer » commercialisé par New England Biolabs référence catalogue B0202S) 1 ,0 pl T4 DNA ligase (commercialisé par New England Biolabs référence catalogue M0202L) 1 ,0 pl produit de PCR digéré et purifié précédemment et 1 ,5 pl dH2O.
Après incubation, un plasmide circularisé comprenant soit la séquence SEQ ID NO 12 ou SEQ ID NO 13 codant respectivement pour l’enzyme pMF8 ou pMF9 a été obtenu pouvant être transformé et propagé dans la bactérie de laboratoire Escherichia edi. Des cellules d’Escherichia coli (souche NEB5a) compétentes disponibles commercialement (New England Biolabs, France, référence catalogue C2987H), ont été transformées avec le vecteur comprenant les séquences codantes pour les protéines recombinantes pMF8 et pMF9 Pour cela, les cellules ont été mises sur glace pour être décongelées, puis ont été incubées pendant 30 minutes sur glace avec le mélange résultant de la ligature. La transformation a été effectuée en appliquant un choc thermique pendant 45 secondes à 42°C, puis les cellules ont été remises dans la glace 5 minutes. Les cellules ont été étalées sur des boites de Pétri LB-agar contenant de l’ampicilline (100 pg/mL) et incubées à 37°C pendant la nuit. Après incubation, environ 200 colonies d’ Escherichia coli transformées avec le vecteur ont été obtenues. Chacune des colonies comprenait de 1 à 3 copies des vecteurs comprenant les séquences codantes pour les protéines recombinantes pMF8 et pMF9. L’ADN plasm idique présent dans les colonies d’E. coli obtenues a été récupéré en utilisant les kits Qiagen Plasmid mini (100) référence catalogue 12125. La région codante des plasmides obtenus a été séquencée confirmant que les séquences recombinantes correspondaient bien respectivement à la séquence SEQ ID NO : 12 ou SEQ ID NO : 13, et correspondant donc aux séquences pMF8 et pMF9.
Exemple 2 : Production et purification de protéines recombinantes avant une activité enzymatique fucanase.
Dans cet exemple, des protéines recombinantes ayant pour activité enzymatique une activité fucanase pour lesquels les séquences codantes ont été identifiées et isolé dans l’exemple 1 ci-dessus ont été exprimées dans des cellules hôtes. En particulier les protéines recombinantes pMF8 et pMF9 ont été surexprimées dans des cellules d’E. coli (souche BL21 (DE3), NEB cat# C2527I). Préalablement à l’expression les cellules d’E. coli (souche BL21 (DE3)) ont été transformées tel que décrit dans l’exemple 1 ci-dessus pour la souche NEB5a. La surexpression a été effectuée à 20°C sous agitation (160 tours par minutes) dans 1 L d’un milieu ZYP-5052 avec 100 pg.mL’1 d’ampicilline tel que décrit dans Studier FW: Protein production by auto-induction in high density shaking cultures. Protein Expression and Purification 2005, 41 :207- 234. [16], Les cellules ont été récoltées par centrifugation (8000 g, 20 min, 4°C) après 72 h de culture. Pour chaque protéine d’intérêt, le culot bactérien a ensuite été suspendu dans un milieu tampon (50 mM Tris pH 7,5, 25 % sucrose, Lysozyme). Les cellules ainsi suspendues ont été lysées par du lysozyme pendant 30 minutes sur glace, puis mélangées avec un tampon avec 1 % deoxycholate, 1 % triton, 20 mM Tris pH 7,5, et 100 mM NaCI. Du MgCk a été ajouté à 5 mM et 200 pg de DNasel (Roche Diagnostics référence catalogue 10104159001 ) ont été ajoutés en mélangeant doucement à température ambiante pendant une demi-heure [17], Le lysat a été clarifié par centrifugation (23700 g, 45 min, 4°C), puis par une filtration en utilisant des filtres (Millipore) de 0,2 pm. La solution ainsi filtrée a été chargée sur une colonne de 10 mL de résine IMAC HyperCell (Pali Corporation), laquelle a été chargée avec une solution de NiSÛ4. La colonne avait préalablement été équilibrée avec du tampon A (20 mM Tris pH 7,5, 500 mM NaCI, 20 mM imidazole). Après une étape de lavage avec le tampon A (dix volumes de colonne), la protéine a été éluée à 1 mL.min’1 dans 60 mL en effectuant un gradient linéaire entre le tampon A et 100 % de tampon B (20 mM Tris pH 7,5, 500 mM NaCI et 500 mM Imidazole). Le gradient a été collecté par des fractions de 1 mL et un aliquote de 5 pL de chaque fraction a été analysé par électrophorèse en gel de polyacrylamide à 12% contenant du dodécysulfate de sodium (SDS- PAGE) selon le protocole décrit dans Sambrook and Russel (J. F. Sambrook and D.W. Russel, 2001 , Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory Press, 2001 , 2100 pp [25]). Toutes les fractions contenant la protéine d’intérêt ont été additionnées et concentrées par ultrafiltration en utilisant des unités de filtration Am icon® Ultra-0.5 (Ultracel® 10K) selon les indications du fournisseur (Millipore). Une étape de purification supplémentaire a été effectuée sur une colonne d’exclusion de taille (Superdex 200, V = 125 mL) permettant également de changer le tampon des enzymes. Ainsi les protéines recombinantes ont été éluées par un gradient isocratique (tampon C : 20 mM Tris pH 7,5, 500 mM NaCI). Au final, les protéines recombinantes pMF8 et pMF9 ont été obtenues pures à l’homogénéité électrophorétique avec un rendement de production de 80 mg et 21 mg, respectivement, par litre de milieu de culture. Toutes les procédures de chromatographie ont été effectuées avec un système ÀKTA Purifier (GE-Healthcare) à température ambiante.
Cet exemple démontre donc clairement la production et l’isolement de protéines recombinantes.
Exemple 3 : Hydrolyse/Déqradation enzymatique de fucanes sulfatés d’alques brunes par des enzymes qlycoside hydrolases : des endo-a- 1 ,4-fucanases
Dans cet exemple, les protéines recombinantes obtenues dans l’exemple 2 ci-dessus (pMF8 et pMF9) ont été utilisées dans un procédé afin de déterminer si elles avaient une activité enzymatique, en particulier si elles permettaient effectivement de depolymériser des fucanes sulfatés.
Plusieurs sources de fucanes sulfatés d’algues brunes (ordre des Fucales) ont été testées. Le fucane sulfaté de Pelvetia canaliculata, nommé FCSPs P. canaliculata dans la Figure 3, FCSP signifiant « fucose containing sulfated polysaccharides » en anglais a été extrait et purifié selon un protocole décrit dans la référence bibliographique Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata. International Journal of Biological Macromolecules 2021 , 201 :143-157. [18] et basé sur les travaux initiaux décrit dans la référence bibliographique Kloareg B, Demarty M, Quillet M: Extraction et purification du fucoidane de Pelvetia canaliculata (Dene et Thur.). Physiologie Végétale 1979, 17:731-747[19], Les fucanes sulfatés d’Ascophylum nodosum commercialisés sous la référence commerciale FUC400®, indiqués FCSPs Æ nodosum dans la Figure 3, et de Fucus vesiculosus commercialisé sous la référence commerciale FUC100®, indiqué FCSPs F. vesiculosus dans la Figure 3 ont été achetés à la société commerciale Elicityl (France) .
Douze mélanges réactionnels ont été indépendamment produits : les trois types de fucanes sulfatés à savoir les FCSPs de P. canaliculate, d’Æ nodosum et de F. vesiculosus ont été mis en présence de chaque enzyme (pMF8 ou pMF9), sous forme active ou sous forme inactivée par la chaleur (10 min à 95°C ; contrôle négatif). Chaque mélange réactionnel contenait 2% poids/volume (w/v) de fucanes sulfatés dissous dans 50 mM ammonium bicarbonate et 0,2 mg/mL de protéine recombinantes (pMF8 ou pMF9, formes active ou inactivée, dans le tampon C : 20 mM Tris pH 7,5, 500 mM NaCI). Chaque digestion enzymatique a eu lieu à 20°C pendant 24 h. Les réactions ont été arrêtées en inactivant les enzymes par chauffage à 95°C pendant 10 min. Un aliquote de chaque réaction, à savoir 1 ,25 pL, a ensuite été mélangé à 3,75 pL d’une solution de 10% de sucrose (contenant 0.08% de phénol rouge pour la visualisation). Ces échantillons ont été analysé par C-PAGE (Carbohydrate- PolyAcrylamide Gel Electrophoresis) selon le protocole décrit dans Zabkackis et Perez (Zablackis E, Perez J: A partially pyruvated Carrageenan from Hawaiian Grateloupia filicina (Cryptonemiales, Rhodophyta). Botanica Marina 1990, 33:273-276. [20]). Les fucanes sulfatés et les oligo-fucanes libérés ont été ainsi séparés sur un gel de polyacrylamide comprenant une zone supérieure de concentration à 6% (w/v) (dite « stacking gel » en anglais) et une zone inférieure de séparation à 27% (w/v) (dite « running gel » en anglais). L’électrophorèse a eu lieu à 200 V, à température ambiante, à savoir 20°C pendant 2h. Les polysaccharides et les oligosaccharides ont été visualisés par une coloration au bleu Alcian suivie d’une coloration au nitrate d’argent tel que décrit dans Min H. and Cowan, M.K., Combined alcian blue and silver staining of glycosaminoglycans in polyacrylamide gels: Application to electrophoretic analysis of molecular weight distribution. 1986. Anal. Biochem. 155, 275-285 [26], La figure 3 est une photographie du gel C-PAGE ainsi obtenu. Les pistes 1 , 3, 5, 7, 9 et 11 sont les contrôles négatifs correspondant respectivement à la mise en présence des fucanes sulfatés de P. canaliculata, d’A. nodosum et de F. vesiculosus avec les protéines recombinantes inactivées par chauffage (pMF8 inactivée: pistes 1 , 3 et 5 ; pMF9 inactivées : pistes 7, 9 et 11 ). Tel que démontré, la coloration dans les pistes contrôles, à savoir les pistes 1 , 3, 5, 7, 9 et 11 , était limitée à une forte tache dans le haut du gel (« stacking gel » en anglais) correspondant aux polysaccharides intacts de hautes masses moléculaires. Des trainées faiblement colorées, sans bandes distinctes, ont été observées dans la zone de séparation (running gel) indiquant la présence en faible quantité de composés indéterminés de basses masses moléculaires dans les substrats de départ.
Les pistes 2, 4, 6, 8, 10 et 12 correspondent respectivement au résultat des digestions enzymatiques des fucanes sulfatés de P. canaliculata, d’A. nodosum et de F. vesiculosus par les protéines recombinantes actives pMF8 (pistes 2, 4 et 6) et pMF9 (pistes 8, 10 et 12). En comparaison des pistes des contrôles négatifs, les pistes 2, 4, 8, 10 et 12 présentent clairement des bandes distinctes dans la zone de séparation du gel (« running gel » en anglais) correspondant donc à des oligosaccharides de fucanes sulfatés de tailles moléculaires différentes qui migrent dans le gel sous l’action du champ électrique. Ces résultats démontrent clairement que pMF8 et pMF9 sont des fucanases permettant la libération d’oligosaccharides à partir de fucanes sulfatés. Ces résultats démontrent également clairement que les fucanes sulfatés sont des substrats des fucanases pMF8 et pMF9. Ces résultats démontrent en outre que pMF9 est active sur les fucanes sulfatés quel que soit l’espèce de Fucales, en particulier les fucanes sulfatés de P. canaliculata, d’A. nodosum et de F. vesiculosus. En d’autres termes, les fucanes sulfatés de P. canaliculata, d’A. nodosum et de F. vesiculosus sont des substrats de pMF9. Les résultats démontrent également clairement que les fucanes sulfatés de P. canaliculata et A. nodosum sont des substrats pMF8. En d’autres termes, pMF9 est active sur les fucanes sulfatés, en particulier les fucanes sulfatés de P. canaliculata, et d’A. nodosum. Ce dernier résultat suggère que pMF8 et pMF9 ont des subtiles différences de spécificité au sein des fucanes sulfatés de Fucales, en dépit de leur forte identité de séquence en acides aminés (65%). En outre, les profils d’oligosaccharides obtenus aux différentes pistes démontrent que pMF8 et pMF9 libèrent des populations d’oligo-fucanes variant en taille, par exemple des oligosaccharides de haute taille, c’est-à-dire de degré de polymérisation de 20 ou plus en haut du gel de séparation et en bas du gel des oligosaccharides de petite taille c’est-à-dire inférieur à 10 degrés de polymérisation et non un petit oligosaccharide de taille unique comme le ferait une enzyme exolytique. Par conséquent, il apparait clairement que les protéines pMF8 et pMF9 sont des enzymes hydrolytiques agissant selon un mode d’action endo-lytique. En d’autres termes, les résultats démontrent clairement que les protéines pMF8 et pMF9 sont des endo- fucanases.
Une analyse structurale des oligo-fucanes obtenus par l’hydrolyse du fucane sulfaté de P. canaliculata par pMF8 et pMF9 a été réalisée. Il s’agit d’une analyse d’échantillons correspondant respectivement aux produits des pistes 2 et 8 de la figure 3. L’analyse structurale a été réalisée par chromatographie liquide ultra-haute performance couplée à la spectrométrie de masse (UHPLC-MS en anglais). La séparation a été réalisée lieu par chromatographie d’appariement d’ions en phase inverse (IP-RP) en utilisant un système UHPLC Acquity H-class plus (Waters, Wilmslow, UK) équipé d’une colonne Hypersil GOLD (100 mm x 1 mm, taille de particules 1 ,9 p ; Thermo scientific, Waltham, Massachusetts, États-Unis) avec un débit de 0,175 mL/min à 45°C. Un gradient ternaire a été utilisé avec de l’eau pure (solvant A), de l’acétonitrile pure (solvant B) et de l’hexylammonium acetate (HxA dans de l’eau ((solvant C ; le pH étant ajusté à 6 par addition d’acide acétique). Le gradient utilisé allait de 16,6% jusqu’à 35,0% de solvant B pendant les 10 premières minutes, puis jusqu’à 63,4% à 20 min et était maintenu à 73,4% pendant 4,5 min. Le solvant C a été gardé constant à 25% tel que décrit dans D. Ropartz, A. Giuliani, M. Fanuel, C. Herve, M. Czjzek, H. Rogniaux, (2016) Online coupling of high- resolution chromatography with extreme UV photon activation tandem mass spectrometry: Application to the structural investigation of complex glycans by dissociative photoionization, Anal. Chim. Acta 933, 1-9 [27],
Les acquisitions ont été réalisées par couplage direct du système UHPLC (Acquity H-Class) avec un spectromètre de masse Select Series Cyclic IMS (Waters, Wilmslow, UK). Les spectres ont été acquis par ionisation électrospray en mode négatif (ESI) dans le domaine m/z 300 - 2000, avec un analyseur de temps de vol (TOF) opéré en V-mode. Les paramètres de la source étaient les suivant : voltage capillaire 2,5 kV ; voltage de cône : 40 V ; température de source : 100°C ; température de désolvatation : 280°C ; gaz de désolvatation : 500 L/h ; gaz de nébulisation : 5,5 bars. Les données ont été enregistrées avec le logiciel Quartz (Waters, release 5) et traitées avec Mass Lynx 4.2 (Waters, Wilmslow, UK).
Les spectres de masse obtenus sont représentés sur les figures 4 et 5. Sur ces figures, la valeur RT indique l’ordre d’élution des différents oligosaccharides sur la chromatographie liquide permettant de les analyser séparément et, notamment, de séparer les espèces isomères, par exemple de même masses exactes mais temps de rétention différents. La mesure de masse exacte et le profil isotopique ont été utilisés à des fins d’identification.
Tel que représenté sur les figures 4 et 5, les masses exactes mesurées ainsi que les profils isotopiques observés démontrent clairement que les principaux oligosaccharides libérés par l’action de pMF8 (Figure 4) ou de pMF9 (Figure 5) comprennent des motifs de répétition disaccharidiques de type A, B et/ou C (Figure 1 ) (Ropartz D, Marion L., Fanuel M, Nikolic J, Jam M, Larocque R, Ficko-Blean E, Michel G, Rogniaux H, (2022) In-depth structural characterization of oligosaccharides released by GH107 endofucanase MfFcnA reveals enzyme subsite specificity and sulfated fucan substructural features. Glycobiology, 32, 276-288 [28]). En particulier, les spectres de masse obtenus démontrent clairement l’obtention d’oligosaccharides par digestion enzymatique avec pmF8 de fucanes à savoir des disaccharides constitués de 2 fucoses di ou tri sulfatés (2.Fuc+2.S, 2.Fuc+3.S, pics 570.16 et 650.12 (figures 4 A, B, C)) ; des oligosaccharides constitués de 4 fucoses comprenant 4 à 6 sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, pics 460.03, 550.57, 641.11 (figures 4 D, E, F, G, H, I, J)) et des oligosaccharides constitués de 8 fucoses comprenant 8 à 9 sulfates (8.Fuc+8.S, 8.Fuc+9.S, pics 1215.94, 1306.98 (figures 4 K, L)) . En particulier, les spectres de masse obtenus démontrent clairement l’obtention d’oligosaccharides par digestion enzymatique avec pmF9 de fucanes à savoir des disaccharides constitués de 2 fucoses di ou tri sulfatés (2.Fuc+2.S, 2.Fuc+3.S, pics 570.16 et 650.12 (figures 5 A, B, C)). Des oligosaccharides constitués de 4 fucoses comprenant 4 à 7 sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+7.S pics 460.04, 550.58, 641.12, 731.66 (figures 5 D, E, F, G, J, K, O)) ; de 6 fucoses comprenant 7 à 9 sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S, pics 888.30, 928.28, 1069.38, 1160.42 (figures 5 H, I, L, M, P)) ; de 8 fucoses comprenant 9 sulfates (8.Fuc+9.S, pics 1306.48 (figure 5 N). Les résultats démontrent clairement l’obtention d’oligosaccharides degrés de polymérisation pairs sur un polysaccharide présentant une alternance stricte et démontrent ainsi clairement que les enzymes pMF8 et pMF9 hydrolysent spécifiquement une des deux liaisons.
En outre, une analyse structurale fine des formes limites des oligo- fucanes obtenus par pMF8 et pMF9 de degré de polymérisation 2 a été réalisée. L’analyse structurale fine a été réalisée par spectrométrie de masse en tandem (MS/MS) par fragmentation haute énergie par dissociation par transfert de charge (CTD). L’appareil utilisé était un spectromètre de masse trappe ionique modifié au laboratoire tel que décrit dans Ropartz, D.; Fanuel, M.; Ollivier, S.; Lissarrague, A.; Benkoulouche, M.; Mulard, L. A.; André, I.; Guieysse, D.; Rogniaux, H. Combination of High-Resolution Multistage Ion Mobility and Tandem MS with High Energy of Activation to Resolve the Structure of Complex Chemoenzymatically Synthesized Glycans. Anal. Chem. 2022, 94 (4), 2279-2287 [29],
Les paramètres de la source électrospray étaient les suivants : tension capillaire : 4,5 kV ; gaz nébuliseur : 6 psi ; et gaz de séchage : 4 L/min (80 °C). Les spectres de masse ont été enregistrés en mode d'ionisation positive dans la gamme m/z 250-1000. Les ions précurseurs ont été isolés avec une largeur de fenêtre de 10 Daltons (Da). Le temps d'activation était de 200 ms. Les données ont été traitées à l'aide de Data Analysis 4.4 (Bruker Daltonics, Brême, Allemagne), MSConvert 3.0.18261 , et mMass 5.5.0.
Les spectres de masse MS/MS obtenus sur les ions produits sous forme [M+4.HxA]+ au rapport masse sur charge m/z 955.6 sont présentés sur les Figures 6 et 7 pour respectivement pMF8 et pMF9 avec les structures associées. La nomenclature des annotations, sur les spectres et les structures correspond au standard introduit dans Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397- 409 [30],
Les spectres de fragmentation des deux produits limites des enzymes pMF 8 et pMF9 sont identiques à l’erreur de mesure prêt admise sur une trappe d’ion en MS/MS par l’homme du métier (inférieure à 100 ppm), démontrant clairement que leur activité catalytique est identique. Les fragments 1 % (m/z 535.4), 1 4Ai (m/z 556.3), Bi (m/z 610.4) et Ci (m/z 628.3) démontrent que la sous unité Fucose en extrémité non réductrice des DP2 porte 2 fonctions sulfates en position 2 et 3. Les fragments 1 5Xi (m/z 475.2), Yi (m/z 447.3) et Zi (m/z 429.2) montrent que la sous unité fucose en extrémité réductrice des DP2 porte une fonction sulfate. Les fragments 35 A2 (m/z 898.5), et 04 A2 (m/z 912.5) démontrent le branchement entre les sous unités en 1-3 et la localisation de la fonction sulfate en position 2. La structure complète de ce DP2-3S correspond donc parfaitement à la structure du composé de la Figure 1 C. Ces analyses démontrent clairement que pMF8 et pMF9 hydrolysent spécifiquement les liaisons a-1 ,4 au sein des fucanes sulfatés comprenant une chaine principale majoritairement constituée de L-fucoses liés alternativement par des liaisons a-1 ,4 et a-1 ,3.
Cet exemple démontre donc clairement que les protéines recombinantes pMF8 et pMF9 sont des endo-a-1 ,4-fucanases, en particulier des endo-a-1 ,4-fucanases capables d’hydrolyser différent type de fucanes sulfatés, en particulier quel que soit leurs origines, et par exemple des fucanes sulfatés d’algues brunes, par exemple de la famille des Fucales.
Cet exemple démontre également clairement que les protéines recombinantes pMF8 et pMF9 permettent avantageusement l’obtention d’oligosaccharides tout en préservant leur structure et activité biologique.
Cet exemple démontre également clairement que les protéines recombinantes pMF8 et pMF9 permettent avantageusement l’obtention d’oligo-fucanes tout en préservant leur structure et activité biologique.
Cet exemple démontre également clairement que les protéines recombinantes pMF8 et pMF9 permettent avantageusement de dépolymériser et/ou hydrolyser les fucanes sulfatés afin de valoriser cette bio-ressource, issue notamment des algues brunes, et ainsi libérer de façon contrôlée et reproductible de nouveaux oligo-fucanes de structures définies.
Exemple 4 : Hydrolyse/Déqradation enzymatique de fucanes sulfatés d’algues brunes par des enzymes glycoside hydrolases : des endo-a- 1 ,4-fucanases
Dans cet exemple, les protéines recombinantes obtenues dans l’exemple 2 ci-dessus (pMF8 et pMF9) et FcnA (pMF4), qui a été précédemment produite et caractérisée, connue pour cliver spécifiquement la liaison a-1 ,4 dans les fucanes sulfatés des algues brunes de l’ordre des Fucales (EC 3.2.1.212) (Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021-1032 [9] ; Yvin JC, Colin S, Cloarec B, Barbeyron T: Recombinant endofucanase., WO 2006/008379 [10]), ont été utilisées dans un procédé afin de déterminer le type d’oligosaccharide et la quantité produite obtenus à partir de la dépolymérisation de fucanes sulfatés.
La source de fucanes sulfatés d’algues brunes (ordre des Fucales) utilisée était le fucane sulfaté de Pelvetia canaliculata, extrait et purifié selon un protocole décrit dans la référence bibliographique Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculata. International Journal of Biological Macromolecules 2021 , 201 :143-157. [18] et basé sur les travaux initiaux décrit dans la référence bibliographique Kloareg B, Demarty M, Quillet M: Extraction et purification du fucoïdane de Pelvetia canaliculata (Dene et Thur.). Physiologie Végétale 1979, 17:731 -747[19].
Des mélanges réactionnels ont été indépendamment produits : les fucanes sulfatés ont été mis en présence de chaque enzyme (pMF4, pMF8 ou pMF9), sous forme active ou sous forme inactivée par la chaleur (10 min à 95°C ; contrôle négatif). Chaque mélange réactionnel contenait 2% poids/volume (w/v) de fucanes sulfatés dissous dans 50 mM ammonium bicarbonate et 0,2 mg/mL de protéine recombinantes (pMF4, pMF8 ou pMF9, formes active ou inactivée, dans le tampon C : 20 mM Tris pH 7,5, 500 mM NaCI). Chaque digestion enzymatique a eu lieu à 20°C pendant 5 jours. Les réactions ont été arrêtées en inactivant les enzymes par chauffage à 95°C pendant 10 min. Un aliquote de chaque réaction, à savoir 1 ,25 pL, a ensuite été mélangé à 3,75 pL d’une solution de 10% de sucrose (contenant 0.08% de phénol rouge pour la visualisation). Ces échantillons ont été analysés par chromatographie liquide à ultra haute performance en phase inverse par appariement d’ion couplé à un spectre de masse.
Chaque réaction enzymatique a été réalisée en au moins trois exemplaires (triplicat), chacun des mélanges réactionnels ayant été analysé par chromatographie liquide à ultra haute performance en phase inverse par appariement d’ion (IIHPLC) couplé avec un spectromètre de masse.
En particulier, la séparation des produits/éléments/oligosaccharides présents dans les échantillons obtenus a été réalisée par chromatographie liquide à ultra haute performance en phase inverse par appariement d’ion (IIHPLC, Acquity H-Class plus® Waters, Wilmslow, UK). Le système était équipé d'une colonne BEH C18 (100 mm x 1 mm , rempli de particules de porosité de 1 ,7 pm ; Waters, Wilmslow, UK) chauffée à 45°C. Le débit était de 0,15 mL.min’1. Un gradient ternaire a été utilisé avec A, eau pure (Eau ultra pure produite par un appareil Milli-Q (Millipore) ; B, ACN pur (acétonitrile (ACN) qualité HPLC ( Carlo-Erba Reagents, Val de Reuil, France), et C, 20 mM Hexylamine 99% (HxA) (Sigma-Aldrich Co., Saint Quentin Fallavier, France) dissous dans l'eau (valeur du pH ajustée à 6 par ajout d'acide acétique (Acide acétique 98% (Fluka, distribué par Sigma- Aldrich Co., Saint Quentin Fallavier, France). Le gradient est passé de 16,6% à 35% de solvant B en 10 min, puis jusqu'à 63,4% en 20 min et maintenu à 73,4% pendant 4,5 min. Le solvant C est resté constant à 25 % tel que décrit dans Ropartz D, Giuliani A, Fanuel M, Herve C, Czjzek M, Rogniaux H. 2016. Online coupling of high-resolution chromatography with extreme UV photon activation tandem mass spectrometry: Application to the structural investigation of complex glycans by dissociative photoionization. Anal Chim Acta. 933:1-9 [31], Les acquisitions ont été réalisées par couplage direct du système UHPLC avec un spectromètre de masse Select Series Cyclic IMS (Waters, Wilmslow, Royaume-Uni) (Giles K, Ujma J, Wildgoose J, Pringle S, Richardson K, Langridge D, Green M. 2019. A cyclic ion mobility-mass spectrometry system. Anal Chem. 91 :8564-8573). Les spectres ont été acquis en mode d'ionisation par électrospray négatif sur la plage de m/z 300 à 2 000, l'analyseur TOF (temps de vol) a été utilisé en mode V. Les paramètres de la source étaient les suivants : Tension capillaire 2,5 kV ; Tension du cône : 40 V ; Température de la source : 100°C ; Température de désolvatation : 280°C ; Gaz de désolvatation : 500 L/h ; Gaz de nébulisation : 5,5 bars. Les données ont été enregistrées avec le logiciel Quartz (logiciel intégré Waters, version 5) et traitées à l'aide de Mass Lynx 4.2 (de Waters, Wilmslow, Royaume-Uni) et du logiciel MzMine (Pluskal T, Castillo S, Villar-Briones A, Oresic M. 2010. MZmine 2: Modular framework for processing, visualizing, and analyzing mass spectrometry-based molecular profile data. BMC Bioinformatics. 11 :395 [32]). Les paramètres utilisés dans MzMine sont indiqués dans le tableau 1 suivant.
Tableau 1 : paramètres du logiciel MzMine Gamme d'ondelettes RT | 0 - 0,1
Résultats :
L’analyse des hydrolysats obtenus sont représentés sur les figures 8 à 15 représentants respectivement
- intensités moyennes de pics de spectre de masse mesurées à partir de triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits (figure 8),
- intensités moyennes de pics de spectre de masse mesurées à partir de triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits (figure 9),
- le pourcentage relatif des intensités de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits (figure 10),
- pourcentage relatif des intensités de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans la distinction des différents isomères produits (figure 11 ),
- intensités moyennes de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) sans distinction des différents isomères produits (figure 12),
- intensités moyennes de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec distinction des différents isomères produits (figure 13),
- pourcentage relatif de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 4 avec 4, 5, 6 et 7 fonctions sulfates (4.Fuc+4.S, 4.Fuc+5.S, 4.Fuc+6.S, 4.Fuc+ 7. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec la distinction des différents isomères produits (figure 14), et
- pourcentage relatif des intensités de pics de spectre de masse mesurées sur des triplicats analytiques pour les oligosaccharides de degré de polymérisation 6 avec 6, 7, 8, 9 et 10 fonctions sulfates (6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+ 9. S, 6.Fuc+ 10. S) produits par la digestion des 3 enzymes pMF 4 (Fnc4) (diagonales noires et blanches) par pMF8 (remplissage gris) ou pMF9 (remplissage noir) avec la distinction des différents isomères produits (figure 15)
Les résultats obtenus, tel que représentés sur les figures 8 et 10 démontrent clairement la production d’oligosaccharide de degré de polymérisation 4 par PMF8, en particulier comprenant peu de groupements sulfates (4 ou 5) (formes peu sulfatées 4.Fuc+4.S, 4.Fuc+5.S) sont très majoritairement différents des oligosaccharides de degré de polymérisation 4 produits par PMF4 et PMF9 comprenant 6 groupements sulfates, majoritairement des 4.Fuc+6.S, que ce soit en proportion réelles et en proportions relatives.
Les résultats obtenus tels que représentés sur les figures 9 et 11 démontrent clairement une hétérogénéité importante pour les produits, oligosaccharides obtenus par digestion enzymatique, pour les trois enzymes testées concernant le degré de sulfatation. Tel que représenté, PMF4 produit exclusivement les oligosaccharides 6.Fuc+7.S, 6.Fuc+8.S et 6.Fuc+ 9. S. PMF8 permet d’obtenir l’ensemble des oligosaccharides identifiés à savoir 6.Fuc+6.S, 6.Fuc+7.S, 6.Fuc+8.S, 6.Fuc+9.S et 6.Fuc+10.S. PMF9 permet d’obtenir des oligosaccharides comprenant peu de sulfates (formes peu sulfatés) à savoir 6.Fuc+6.S et 6.Fuc+7.S en proportion plus importantes que PMF8
Les résultats obtenus, représentés sur les figures 12 et 14 démontrent clairement que l’enzymes pMF8 permet d’obtenir les 2 isomères structuraux de 4.Fuc+5.S et les 2 isomères structuraux de 4.Fuc+4.S.
Les résultats obtenus, représentés sur les figures 13 et 15 démontrent clairement des spécificités pour chaque enzyme. PMF8 et PMF9 permettent de produire des isomères spécifiques, le 6.Fuc+7.S isomère 2 par rapport à PMF 4 qui produit exclusivement l’isomère 1 et le 6.Fuc+8.S isomère 3. PMF8 et PMF 9 produisent des oligosaccharides 6.Fuc+7.S qui ne sont pas produits par PMF4. En outre de manière surprenante PMF8 produit différents isomères de 6.Fuc+7.S, à savoir l’isomère 1 et l’isomère 2 tandis que PMF9 produit l’isomère 1 et l’isomère 3.
Les résultats démontrent donc clairement que les enzymes obtenues dans l’exemple 2 ci-dessus (pMF8 et pMF9) ont une activité enzymatique différente de celle d’enzymes connues dans l’état de la technique, par exemple par rapport à Fcna (PMF4) et permettent avantageusement une production de différents oligosaccharides (OS) variant par : 1 /leur degré de sulfatation (DS) ou 2/ leur isoméries mise en évidence par la séparation chromatographique.
Références
1. Deniaud-Bouet E, Hardouin K, Potin P, Kloareg B, Herve C: A review about brown algal cell walls and fucose-containing sulfated polysaccharides: Cell wall context, biomedical properties and key research challenges. Carbohydrate Polymers 2017, 175:395-408.
2. Kloareg B, Badis Y, Cock JM, Michel G: Role and Evolution of the Extracellular Matrix in the Acquisition of Complex Multicellularity in Eukaryotes: A Macroalgal Perspective. Genes 2021 , 12.
3. Pomin VH: Sulfated glycans in inflammation. European Journal of Medicinal Chemistry 2015, 92:353-369.
4. Ferreira SS, Passos CP, Madureira P, Vilanova M, Coimbra MA: Structure-function relationships of immunostimulatory polysaccharides: A review. Carbohydrate Polymers 2015, 132:378-396.
5. Mourao PA: Perspective on the use of sulfated polysaccharides from marine organisms as a source of new antithrombotic drugs. Marine Drugs 2015, 13:2770-2784.
6. Rabanal M, Ponce NM, Navarro DA, Gomez RM, Stortz CA: The system of fucoidans from the brown seaweed Dictyota dichotoma: chemical analysis and antiviral activity. Carbohydrate Polymers 2014, 101 :804-811.
7. Wu L, Sun J, Su X, Yu Q, Yu Q, Zhang P: A review about the development of fucoidan in antitumor activity: Progress and challenges. Carbohydrate Polymers 2016, 154:96-111 .
8. Barbeyron T, L'Haridon S, Michel G, Czjzek M: Mariniflexile fucanivorans sp. nov., a marine member of the Flavobacteriaceae that degrades sulphated fucans from brown algae. International Journal of Systematic and Evolutionary Microbiology 2008, 58:2107-2113.
9. Colin S, Deniaud E, Jam M, Descamps V, Chevolot Y, Kervarec N, Yvin JC, Barbeyron T, Michel G, Kloareg B: Cloning and biochemical characterization of the fucanase FcnA: definition of a novel glycoside hydrolase family specific for sulfated fucans. Glycobiology 2006, 16:1021 - 1032. 10. Yvin JC, Colin S, Cloarec B, Barbeyron T: Recombinant endofucanase. Patent 2006, WO 2006/008379 A1 .
11 . Boraston AB, Vickers C, Salama-Alber O, Abe K: Enzymatic hydrolysis of fucans. Patent 2020, WO 2020024403.
12. Vickers C, Liu F, Abe K, Salama-Alber O, Jenkins M, Springate CMK, Burke JE, Withers SG, Boraston AB: Endo-fucoidan hydrolases from glycoside hydrolase family 107 (GH107) display structural and mechanistic similarities to alpha-l-fucosidases from GH29. Journal of Biological Chemistry 2018, 293:18296-18308.
13. Shen J, Chang Y, Zhang Y, Mei X, Xue C: Discovery and Characterization of an Endo-1 , 3-Fucanase From Marine Bacterium Wenyingzhuangia fucanilytica: A Novel Glycoside Hydrolase Family. Frontiers in Microbiology 2020, 11 :1674.
14. Groisillier A, Herve C, Jeudy A, Rebuffet E, Pluchon PF, Chevolot Y, Flament D, Geslin C, Morgado IM, Power D, et al.: MARINE-EXPRESS: taking advantage of high throughput cloning and expression strategies for the post-genomic analysis of marine organisms. Microbial Cell Factories 2010, 9:45.
15. Sambrook J, Russel D: Molecular cloning: a laboratory manual. Cold Spring Habor, NY, USA: Cold Spring Harbor Press; 2001.
16. Studier FW: Protein production by auto-induction in high density shaking cultures. Protein Expression and Purification 2005, 41 :207-234.
17. Ficko-Blean E, Duffieux D, Rebuffet E, Larocque R, Groisillier A, Michel G, Czjzek M: Biochemical and structural investigation of two paralogous glycoside hydrolases from Zobellia galactanivorans: novel insights into the evolution, dimerization plasticity and catalytic mechanism of the GH117 family. Acta Crystallographica. Section D, Biological Crystallography 2015, 71 :209-223.
18. Nikolic Chenais J, Marion L, Larocque R, Jam M, Jouanneau D, Cladiere L, Le Gall S, Fanuel M, Desban N, Rogniaux H, et al.: Systematic comparison of eight methods for preparation of high purity sulfated fucans extracted from the brown alga Pelvetia canaliculate. International Journal of Biological Macromolecules 2021 , 201 : 143-157.
19. Kloareg B, Demarty M, Quillet M: Extraction et purification du fucoidane de Pelvetia canaliculate (Dene et Thur.). Physiologie Végétale 1979, 17:731-747.
20. Zablackis E, Perez J: A partially pyruvated Carrageenan from Hawaiian Grateloupia filicina (Cryptonemiales, Rhodophyta). Botanica Marina 1990, 33:273-276.
21 . http://www.promega.com/vectors/mammalian_express_vectors.htrn
22. http://www.qiagen.com/overview/qiagenes. aspx?gaw=PRQTQIAgenes080 7&gkw=mammalian+expression
23. http://www.scbt.com/chap_exp_vectors. php?type=pCruzTM%20Expressio n%20Vectors
24. WO 83/004261
25. J.F. Sambrook and D.W. Russel, 2001 , Molecular cloning: a laboratory manual, Cold Spring Harbor Laboratory Press, 2001 , 2100 pp
26. Min H. and Cowan, M.K., Combined alcian blue and silver staining of glycosaminoglycans in polyacrylamide gels: Application to electrophoretic analysis of molecular weight distribution. 1986. Anal. Biochem. 155, 275- 285.
27. D. Ropartz, A. Giuliani, M. Fanuel, C. Herve, M. Czjzek, H. Rogniaux, (2016) Online coupling of high-resolution chromatography with extreme UV photon activation tandem mass spectrometry: Application to the structural investigation of complex glycans by dissociative photoionization, Anal. Chim. Acta 933, 1-9.
28. Ropartz D, Marion L., Fanuel M, Nikolic J, Jam M, Larocque R, Ficko- Blean E, Michel G, Rogniaux H, (2022) In-depth structural characterization of oligosaccharides released by GH107 endofucanase MfFcnA reveals enzyme subsite specificity and sulfated fucan substructural features. Glycobiology, 32, 276-288. 29. Ropartz, D.; Fanuel, M.; Ollivier, S.; Lissarrague, A.; Benkoulouche, M.; Mulard, L. A.; André, I.; Guieysse, D.; Rogniaux, H. Combination of High- Resolution Multistage Ion Mobility and Tandem MS with High Energy of Activation to Resolve the Structure of Complex Chemoenzymatically Synthesized Glycans. Anal. Chem. 2022, 94 (4), 2279-2287
30. Domon, B.; Costello, C. A systematic nomenclature for carbohydrate fragmentations in fab-ms ms spectra of glycoconjugates. Glycoconjugate Journal 1988, 5 (4), 397-409
31. Ropartz D, Giuliani A, Fanuel M, Herve C, Czjzek M, Rogniaux H. 2016. Online coupling of high-resolution chromatography with extreme UV photon activation tandem mass spectrometry: Application to the structural investigation of complex glycans by dissociative photoionization. Anal Chim Acta. 933:1-9).
32. Pluskal T, Castillo S, Villar-Briones A, Oresic M. 2010. MZmine 2: Modular framework for processing, visualizing, and analyzing mass spectrometry-based molecular profile data. BMC Bioinformatics. 11 :395

Claims

Revendications
1. Enzyme glycoside hydrolase de séquence d'acides aminés comprenant ou consistant en la séquence SEQ ID NO : 1 ou 2, ou une séquence ayant au moins 65% d’identité de séquence avec la séquence SEQ ID NO : 1 ou 2.
2. Enzyme isolé selon la revendication 1 , dans lequel la séquence d'acides aminés comprend ou consiste en la séquence SEQ ID NO : 3 ou 4.
3. Enzyme isolé selon la revendication 1 ou 2, ledit enzyme est une endo-fucanase.
4. Acide nucléique codant pour enzyme glycoside hydrolase isolée selon l’une quelconque des revendications 1 à 3.
5. Acide nucléique selon la revendication 4 comprenant la séquence choisie parmi la séquence SEQ ID NO 8, SEQ ID NO 9, SEQ ID NO 10, SEQ ID NO 11 , SEQ ID NO 12 ou SEQ ID NO 13.
6. Vecteur comprenant un acide nucléique codant une enzyme glycoside hydrolase isolée selon la revendication 4 ou 5.
7. Vecteur selon la revendication 6 comprenant les éléments pour l’expression dudit acide nucléique dans une cellule.
8. Cellule hôte comprenant une séquence d’acide nucléique selon l’une quelconque des revendications 4 ou 5, ou un vecteur selon la revendication 6 ou 7.
9. Cellule hôte selon la revendication 8, ladite cellule hôte est E. Coli.
10. Procédé de fabrication d’une enzyme glycoside hydrolase telle que défini dans l’une quelconque des revendications 1 à 3 par recombinaison génétique utilisant un acide nucléique selon l’une quelconque des revendications 4 ou 5, ou un vecteur selon la revendication 6 ou 7.
11. Procédé de dégradation de fucanes sulfatés comprenant une étape de mise en contact des fucanes sulfatés avec une enzyme glycoside hydrolase isolé selon l’une quelconque des revendications 1 à 3, ou avec une cellule hôte selon la revendication 8 ou 9, dans des conditions permettant la dégradation des fucanes sulfatés par digestion enzymatique par ledit enzyme glycoside hydrolase ou ladite cellule hôte.
12. Utilisation d’une enzyme glycoside hydrolase tel que défini dans l’une quelconque des revendications 1 à 3 pour la production d’oligosaccharides de fucanes sulfatés.
13. Oligosaccharides de fucanes sulfatés obtenus selon le procédé défini dans la revendication 11 ou selon l’utilisation définie dans la revendication 12.
EP24703559.5A 2023-02-08 2024-02-06 Fucanases et leur utilisation pour hydrolyser des polysaccharides Pending EP4662308A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP23305169 2023-02-08
PCT/EP2024/052908 WO2024165557A1 (fr) 2023-02-08 2024-02-06 Fucanases et leur utilisation pour hydrolyser des polysaccharides

Publications (1)

Publication Number Publication Date
EP4662308A1 true EP4662308A1 (fr) 2025-12-17

Family

ID=85328517

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24703559.5A Pending EP4662308A1 (fr) 2023-02-08 2024-02-06 Fucanases et leur utilisation pour hydrolyser des polysaccharides

Country Status (2)

Country Link
EP (1) EP4662308A1 (fr)
WO (1) WO2024165557A1 (fr)

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR2532656B2 (fr) 1982-06-02 1985-10-18 Elf Bio Rech Nouveau vecteur de clonage et d'expression, levure et bacterie transformees par ce vecteur
FR2871811B1 (fr) 2004-06-18 2006-09-29 Goemar Lab Sa Endofucanase recombinante
CN109190062B (zh) 2018-08-03 2023-04-07 平安科技(深圳)有限公司 目标语料数据的爬取方法、装置及存储介质

Also Published As

Publication number Publication date
WO2024165557A1 (fr) 2024-08-15

Similar Documents

Publication Publication Date Title
CN109844117A (zh) 产生单磷酰脂质a的细菌和利用细菌产生单磷酰脂质a的方法
EP2582810B1 (fr) Ulvane lyase, procede de fabrication et utilisations
EP4149957B1 (fr) Souches bactériennes et procédé de production d'oligosaccharides
WO2024165557A1 (fr) Fucanases et leur utilisation pour hydrolyser des polysaccharides
EP3512942B1 (fr) Nouvelle ulvane lyase et son utilisation pour cliver des polysaccharides
CA2768857C (fr) Porphyranases et leur utilisation pour hydrolyser des polysaccharides
CA2979123A1 (fr) Production de synthons glycosyles par voie enzymatique
CN111849949A (zh) 一种甘露糖醛酸c-5差向异构酶/海藻酸裂解酶编码基因及酶和制备与应用
CA2759701A1 (fr) 4s-iota-carraghenane sulfatase et son utilisation pour l'obtention de l'alpha-carraghenane
EP2627778B1 (fr) Procede de transformation du iota-carraghenane en alpha-carraghenane a l'aide d'une nouvelle classe de 4s-iota-carraghenane sulfatase
WO2014072636A1 (fr) Kappa carraghénane sulfatase, procédé de fabrication et utilisation
EP2376621B1 (fr) Souche bacterienne et melange bacterien a activite fucanolytique
CN108251403B (zh) 一种新型鞘糖脂内切糖苷酶及其基因工程制备方法和应用
EP4031668A1 (fr) Production et fonctionnalisation de nanoparticules dérivées du phage t5 et utilisations thérapeutiques
EP2758528A1 (fr) 3s-rhamnose-glucuronyl hydrolase, procédé de fabrication et utilisations
CN112779239B (zh) 一种宏基因组来源的果胶酶、其编码基因及其表达
FR3058732A1 (fr) Alpha-1,3-(3,6-anhydro)-d-galactosidases et leur utilisation pour hydrolyser des polysaccharides
Sichert Fucoidan degradation by marine bacteria: Fucoidan Abbau durch marine Bakterien
FR2871811A1 (fr) Endofucanase recombinante
KR101796059B1 (ko) 한천을 가수분해하여 사탄당을 생성하는 능력이 우수한 아가라아제 및 이를 코드하는 유전자
CN108251394B (zh) 一种新型的鞘糖脂内切糖苷酶
KR20160117791A (ko) 진세노사이드 글리코시다제를 이용한 지페노사이드 lxxv 생산 방법
CN119331852A (zh) 一种α-L-鼠李糖苷酶及其编码基因和它们的应用
KR20170040541A (ko) 수용성 유기용매에서 지속적 활성유지가 가능한 신규 β-글루코스 분해 효소 유전자 Bgls6과 이로부터 생산한 재조합 효소의 이용

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20250805

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR

DAV Request for validation of the european patent (deleted)
DAX Request for extension of the european patent (deleted)