EP4662240A2 - Fragment fab mutant pour l'obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques - Google Patents

Fragment fab mutant pour l'obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques

Info

Publication number
EP4662240A2
EP4662240A2 EP24714531.1A EP24714531A EP4662240A2 EP 4662240 A2 EP4662240 A2 EP 4662240A2 EP 24714531 A EP24714531 A EP 24714531A EP 4662240 A2 EP4662240 A2 EP 4662240A2
Authority
EP
European Patent Office
Prior art keywords
seq
antibody fragment
mutant antibody
molecule
conjugate
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP24714531.1A
Other languages
German (de)
English (en)
Inventor
Didier Boquet
Amaury HERBET
Narciso COSTA
Marie HAUTIERE
Franck Denat
Claire Bernhard
Victor GONCALVES
Delphine VIVIER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Centre National de la Recherche Scientifique CNRS
Commissariat a lEnergie Atomique et aux Energies Alternatives CEA
Universite de Bourgogne
Original Assignee
Centre National de la Recherche Scientifique CNRS
Commissariat a lEnergie Atomique CEA
Commissariat a lEnergie Atomique et aux Energies Alternatives CEA
Universite de Bourgogne
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National de la Recherche Scientifique CNRS, Commissariat a lEnergie Atomique CEA, Commissariat a lEnergie Atomique et aux Energies Alternatives CEA, Universite de Bourgogne filed Critical Centre National de la Recherche Scientifique CNRS
Publication of EP4662240A2 publication Critical patent/EP4662240A2/fr
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/0019Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
    • A61K49/0021Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
    • A61K49/0032Methine dyes, e.g. cyanine dyes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0058Antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/006Biological staining of tissues in vivo, e.g. methylene blue or toluidine blue O administered in the buccal area to detect epithelial cancer cells, dyes used for delineating tissues during surgery
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1027Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against receptors, cell-surface antigens or cell-surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1093Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2869Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3053Skin, nerves, brain
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation

Definitions

  • Mutant Fab fragment for obtaining site-specific mono- or bi-functionalized conjugates FIELD OF THE INVENTION
  • the present invention relates to a mutant Fab fragment, characterized in that the amino acid residue at position 128 of the heavy chain according to the IMGT nomenclature is substituted by a cysteine, provided that said fragment is not a Fab fragment whose mutated heavy chain fragment corresponds to the amino acid sequence SEQ ID NO: 1 and the light chain fragment corresponds to the amino acid sequence SEQ ID NO: 2, as well as its use for obtaining site-specific mono- or bi-functionalized conjugates thereof, an intermediate conjugate, methods for preparing the final or intermediate conjugate and mono- or bi-functionalized conjugates, as well as various uses of these conjugates.
  • fluorescent conjugates are of growing interest for surgical assistance (FGS for Fluorescence Guided Surgery).
  • FGS Fluorescence Guided Surgery
  • the presence of a fluorescent molecule helps the surgeon visualize tumor tissues invisible to the naked eye, thus allowing better delineation of tumor areas, and therefore better resection of tumors, thus reducing the risk of recurrence.
  • the development of these approaches requires modifying the biological vector in order to introduce the desired functionality (cytotoxic molecule, chelating agent for a radiometal, fluorophore, etc.).
  • Many bioconjugation methods have thus been developed, including some so-called "site-specific" approaches to control the attachment site on proteins.
  • strategies that are sufficiently modular to allow the customized introduction of several functionalities.
  • conjugates containing both a radiometal chelating agent and a fluorophore have been described, particularly in the case of vectors based on a whole antibody, but these are often constructed using sequential functionalization methods that do not allow precise control of the ratio of the two imaging probes and good reproducibility of the syntheses.
  • a trastuzumab conjugated to a bifunctionalized tetrazine platform by a chelating agent (DOTAGA) and a fluorophore (disulphonated Cy5) has been described, but the grafting of the bifunctionalized tetrazine platform was carried out randomly and non-site-specifically, by reaction of a bicyclo[6.1.0]nonyne (BCN) group on the amine functions of the antibody (WO2018172543A1 and Coline Canovas, et al.. Modular Assembly of Multimodal Imaging Agents through an Inverse Electron Demand Diels–Alder Reaction. Bioconjugate Chemistry, American Chemical Society, 2019, 30 (3), pp.888-897).
  • BCN bicyclo[6.1.0]nonyne
  • a diabody modified by the addition of a H6-GGC tag (6 histidines followed by two glycines and a cysteine) at the C-terminal and conjugated on these two cysteines by a fluorophore (IRDye800CW) and randomly by a radioisotope ( 124 Iodine) has been synthesized (Zettlitz, K.A., et al., 2018. Dual-modality immunoPET and near-infrared fluorescence (NIRF) imaging of pancreatic cancer using an anti-prostate cancer stem cell antigen (PSCA) cys-diabody. J Nucl Med jnumed.117.207332).
  • a site-specific bifunctionalized trastuzumab with a chelating agent (DFO) and a fluorophore (IRDye800CW) has been described, the conjugate based on a lysine platform trifunctionalized with DFO, IRDye800CW and a BCN group, and its grafting onto the antibody at the level of the two N-glycans, previously modified to include an azide group reacting with the BCN group of the lysine platform (Pierre Adumeau, et al.
  • a conjugate between an anti-EGFR VHH, a photosensitizing fluorophore (IRDye700DX) and a chelating agent (diethylenetriamine-pentaacetic acid or ADTP) via a tetrazine platform was synthesized.
  • the grafting of the VHH onto the tetrazine platform was done by grafting onto a cysteine added at the C-terminal of the VHH (Renard, E. et al. Site-Specific Dual-Labeling of a VHH with a Chelator and a Photosensitizer for Nuclear Imaging and Targeted Photodynamic Therapy of EGFR-Positive Tumors. Cancers 2021, 13, 428).
  • WDO2011/003622A1 describes a bivalent anti-HER2 nanobody comprising two VH domains fused via a linker (Nanobody 1-(VVTS)C of sequence SEQ ID NO:17).
  • a linker Nabody 1-(VVTS)C of sequence SEQ ID NO:17.
  • the amino acid at position 128 IMGT was replaced by a cysteine. If the nanobody was produced, its ability to bind its antigen with the same affinity as without the substitution at position 128 IMGT has not been verified.
  • no conjugate of this nanobody with another chemical group at the thiol group of the cysteine inserted at position 128 IMGT is described.
  • WO2011/006914A2 describes a variant called DSM0162 of a single domain anti-TNFR1 antibody (called DOM1h-574-16), whose amino acid at position 128 IMGT has been substituted by a cysteine, as well as a conjugate of this fragment to polyethylene glycol (PEG) via a maleimide linker, in order to increase its half-life in vivo.
  • a half-life was calculated based on an ELISA assay using TNFR1 capture. However, no coupling yield is reported and it is not demonstrated that the affinity for the antigen is not affected by the substitution.
  • US2006/062784A1 describes a variant (called DOM8-24cys of sequence SEQ ID NO:85) of a single domain anti-CD40 antibody (DOM-24, SEQ ID NO:26), in which the amino acid at position 128 IMGT has been substituted by a cysteine, as well as the possibility of conjugating it to polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • WO2018/106895A1 describes two fusion proteins of sequences SEQ ID NO: 816 and 817 (Table 4 of Example 2) comprising the Shiga toxin A subunit fused to a VHH of unknown antigenic specificity, in which the amino acid at position 128 IMGT has been substituted by a cysteine.
  • SEQ ID NO: 816 and 817 Table 4 of Example 2
  • the activity of these two fusion proteins has not been tested, and therefore it has not been demonstrated that they maintain their affinity for their antigen.
  • no conjugate of these specific fusions is described.
  • WO2022/133089A1 describes a single chain antibody (sdAb) directed against CEA6 named Cap03-04-CEA6-R3-39/19 of sequence SEQ ID NO: 154, in which the amino acid at position 128 IMGT has been substituted by a cysteine.
  • sdAb single chain antibody directed against CEA6
  • Cap03-04-CEA6-R3-39/19 of sequence SEQ ID NO: 154 in which the amino acid at position 128 IMGT has been substituted by a cysteine.
  • no functional data confirming that this sdAB maintains an equivalent affinity for its antigen is presented. No conjugate of this specific sdAb is described either.
  • VHHs are not necessarily available for all targets of interest, while many antibodies against targets of interest are available.
  • a small antibody fragment such as a Fab or scFv fragment (or any other antibody fragment format with a heavy chain and a light chain), could therefore make it possible to benefit from all existing antibodies targeting targets of interest while limiting the size sufficiently to allow crossing the BBB, and by limiting the in vivo lifespan, due to the absence of an Fc domain.
  • WO2010/115866A1 describes an anti-GPIIb/IIIa scFv (AP3 LC-HC scFV C39S S248C). In the part of the scFv corresponding to the VH domain, the amino acid at position 128 IMGT has been substituted by a cysteine.
  • a Fab fragment would be particularly suitable, due to its intermediate molecular weight (neither too high nor too low), allowing it to cross the BBB and to have an in vivo lifetime that is neither too long nor too short.
  • the presence of two partial heavy chains can allow double conjugation, which would be absent in VHH or ScFv type fragments, thus allowing better specific activity in both fluorescence and isotopic imaging.
  • the preparation of bioconjugates based on a Fab fragment poses difficulties.
  • a Fab fragment generally does not include an N-glycan that can be modified to have an azide group capable of reacting with the BCN group of a lysine further functionalized by a chelating agent and a fluorophore as described in Adumeau et al (Site-Specific Platform-Based Conjugation Strategy for the Synthesis of Dual-Labeled Immunoconjugates for Bi-modal PET/NIRF Imaging of HER2-Positive Tumors. Bioconjugate Chemistry, American Chemical Society, 2022, 33 (3), pp.530-540).
  • WO2018172543A1 describes a bifunctionalized Fab’ fragment via a tetrazine platform.
  • Conjugation is performed on the cysteines of the hinge region, which has the disadvantage of causing problems of homogeneity and reproducibility.
  • this method requires the presence of a hinge region, which is not present in many antibody fragments, such as a Fab fragment, scFv, an Fv fragment, a diabody, a tribody, or a tetrabody. This method is therefore limited to the conjugation of Fab’ fragments, with limited homogeneity and reproducibility.
  • Junutula JR et al tested the possibility of replacing some residues of the heavy or light chain fragment of the Hu4D antibody Fab fragment with a cysteine to allow site-specific conjugation (Junutula JR et al.
  • the selected position in the heavy chain corresponds to the first amino acid of the constant part, which is position 129 of the heavy chain according to the IMGT nomenclature.
  • Such a position, located in the constant region can again only be used for antibody fragments comprising part of the constant region, but not for antibody fragments comprising only the variable regions of the antibody, such as an scFv fragment, an Fv fragment, a diabody, a tribody, or a tetrabody.
  • the method chosen is therefore limited to fragments comprising at least part of the constant region.
  • Other positions in the VH domain allowing site-specific conjugation have been identified, but these are positions that are not very conserved within the murine and human VH genes and play a crucial role in the correct folding of the heavy chain of the antibody (see Example 1 below), which does not allow them to be used in a general method that can be applied to any type of initial antibody and to generate any type of antibody fragment comprising a VH domain.
  • this paper illustrates how difficult it is to predict the effect of mutation of a cysteine position on conjugation capacity, since the reactivity of thiol groups obtained by mutation of residues very close to each other to cysteine is widely variable (see Table 2 of Junutula JR et al).
  • Endothelin 1 acts as a true growth factor in tumor development, which results in changes in the expression of ETA, ETB and ET-1 in different tumors such as colon, breast, ovarian, prostate, kidney, bladder, lung, ENT cancer, gliomas or melanoma.
  • endothelin type A receptor stimulates the proliferation of epithelial tumors.
  • This is for example the case of tumor cells from ovarian, cervical, prostate or colon cancer.
  • ET B is expressed in other tumor types such as skin cancer and in particular in melanoma, Kaposi's sarcoma, breast cancer, vulvar cancer and certain gliomas.
  • ETB plays a role in tumor progression and proliferation.
  • an antagonist of this receptor is used, there is then an inhibition of cell proliferation. Therefore, these antagonists seem to be candidates of choice for the therapy of these tumors.
  • Antibodies that specifically bind to an endothelin receptor are therefore candidates of interest, particularly in the form of conjugates with either a therapeutic molecule (for therapy) or with a molecule useful in imaging (for diagnosis and assistance with surgical tumor resection).
  • endothelin receptors belong to class 1 or family A of G Protein Coupled Receptors (GPCRs). As a result, they include 7 transmembrane domains (TM). Coupled to heterotrimeric G proteins at the carboxyl end of the GPCR, they allow signal transduction inside the cell. TM domains consist of alpha helices connected by loops intracellular (i1, i2 and i3) and extracellular (e1, e2 and e3).
  • the mutation is in the VH domain of the heavy chain, it can be used broadly to obtain any other antibody fragment having a VH domain, without requiring further development, making the method much more versatile than those described in the prior art.
  • the last amino acid of the VH domain is widely conserved in both humans and mice (see Example 1), making the proposed mutation usable in a large number of antibodies.
  • the invention also relates to a method for preparing a conjugate according to the invention comprising the following steps: a) reduction of the disulfide bridge(s) of the mutant antibody fragment, in particular in the presence of tris(2-carboxyethyl)phosphine (TCEP), to give a reduced mutant antibody fragment, b) reoxidation of the disulfide bridge(s) of the mutant antibody fragment, in particular in the presence of dehydroascorbic acid, to give a partially reduced mutant antibody fragment, c) conjugation with at least one molecule of interest of the thiol function of the cysteine at position 128 of the heavy chain variable domain according to the IMGT nomenclature of the partially reduced mutant antibody fragment to give a conjugate according to the invention.
  • TCEP tris(2-carboxyethyl)phosphine
  • Figure 1 shows the antigen binding curves on CHO-ET cells HAS of the unmutated Fab fragment of the xiRA63 antibody and a conjugate obtained by random grafting of a tetrazine bifunctionalized by a Zirconium-89 chelating agent (DFO) and a fluorophore (IRDye800).
  • DFO Zirconium-89 chelating agent
  • IRSe800 a fluorophore
  • Figure 2 shows the antigen binding curves on CHO-ETA cells of the mutant Fab fragment with a cysteine at position 128 of the heavy chain according to the IMGT nomenclature of the xiRA63 antibody and a conjugate obtained by site-specific grafting of a tetrazine bifunctionalized by a Zirconium-89 chelating agent (DFO) and a fluorophore (IRDye800).
  • Figure 3 shows the validation by MALDI-TOF mass spectrometry of the conjugation of the DFO group to the ThioFab-xiRA63 fragment (light gray line: native ThioFab-xiRA63, dark gray line: ThioFab-xiRA63-DFO).
  • Figure 4 shows the validation of the affinity of the ThioFab-xiRA63-DFO fragment conjugate by flow cytometry. Comparison of the binding curve obtained by flow cytometry between ThioFab-xiRA63 (orange) and ThioFab-xiRA63-DFO (blue). To test their specificity, the antibodies were tested on CHO-ETA (solid line) and CHO-WT (dotted line) not visible in the figure. Data are presented as mean ⁇ SEM. Statistical comparisons were performed with the paired two-tailed Student's t-test (* p ⁇ 0.05, ** p ⁇ 0.01, **** p ⁇ 0.0001). MFI: Median Fluorescence Intensity.
  • Figure 5 represents the evaluation of radiolabeling of [ 89 Zr]Zr-ThioFAb-xiRA63- DFO:
  • A. HPLC-UV chromatograms of ThioFab-xiRA63-DFO detected at 280 nm before and after radiolabeling with 89 Zr with a retention time of 18 minutes for ThioFab-xiRA63-DFO. The second peak after radiolabeling at 25 minutes corresponds to gentisic acid.
  • B. HPLC-radiochromatogram of [ 89 Zr]-ThioFab-xiRA63.
  • AU arbitrary unit.
  • Figure 6 Figure 6 shows a summary of the in vivo experiment: (A.) Experiments and animal sacrifices.
  • B. Summary table of [89Zr]Zr-ThioFab-xiRA63 injection in mice bearing a human glioblastoma tumor.
  • Figure 8 represents a brain tumor imaged over time by PET with the radioligand [ 89 Zr]Zr-ThioFab-xiRA63:
  • A. Quantification of activity in the tumor obtained with the antibody [ 89 Zr]Zr-ThioFab-xiRA63 at 1h, 5h, 24h, 48h, 72h, D7 p.i.
  • B. Example of a PET scan of one of the brain tumors imaged with the [ 89 Zr]Zr- ThioFab-xiRA6348h p.i. with the 3 visions (transverse, axial and coronal sections).
  • DI.cm- 3 percentage of injected dose per tissue volume.
  • Figure 9 Classical structure of GPCRs (after Bockaert et al. Bull. Acad. Natle Méd., 2012, 196, no. 9, 1765-1775). Receptors with 7 TM domains linked by 3 extracellular loops (e1, e2 and e3) and 3 intracellular loops (i1, i2, i3). The N-terminal domain is located in the extracellular region while the C-terminal domain composed of an 8 th helix is located on the intracellular side and can interact with intracellular proteins (GIPs for "GPCR Interacting Proteins").
  • Figure 10 2-dimensional (2D) structure of human ETA and ETB obtained by GPCRdb.
  • Figure 11 Competition assay protocol.
  • Figure 12 Thermal denaturation curves and inflection temperatures Ta and T12 of the xiRB49-P125T, Fab-xiRB49-P125T, and ThioFab-xiRB49-P125T antibodies.
  • Figure 13 Binding curves obtained by flow cytometry of the Fab-xiRB49-P125T and ThioFab-xiRB49-P125T antibodies allowing the determination of their apparent Kd and their Bmax.
  • Figure 14 Binding curves obtained by flow cytometry of the competition test between xiRB49-P125T and Thio-Fab-xiRB49-P125T or Fab-xiRB49-P125T.
  • Figure 15 Binding curves obtained by flow cytometry with an anti-Fd secondary antibody.
  • an antibody fragment that comprises a mutated heavy chain variable domain may comprise a single mutated heavy chain variable domain (in the case of an Fv or scFv fragment in particular) or several mutated heavy chain variable domains (in the case of a Fab fragment, a diaboby, tribody or tetrabody in particular).
  • a polypeptide “comprises” an amino acid sequence when the amino acid sequence is part of the final amino acid sequence of the polypeptide. Such a polypeptide may have up to several hundred additional amino acid residues.
  • a polypeptide consists essentially of an amino acid sequence when such an amino acid sequence is present with possibly only a few additional amino acid residues (e.g., a peptide of 20 or fewer amino acids, such as a 6-histidine tag Hisx6, may additionally be here).
  • Consisting of” or “consisting of” means excluding more than trace amounts of other components or steps.
  • a polypeptide "consists of" a sequence of amino acids when the polypeptide does not contain any amino acids other than the stated amino acid sequence.
  • Antibody or “immunoglobulin” or “Ig” means a molecule comprising at least one antigen-binding domain and a constant domain comprising an Fc moiety capable of binding to FcR receptors.
  • an antibody is composed of 4 polypeptide chains: 2 heavy chains and 2 light chains linked together by a variable number of disulfide bridges providing flexibility to the molecule.
  • Each light chain consists of a constant domain (CL) and a variable domain (VL); the heavy chains being composed of a variable domain (VH) and 3 or 4 constant domains (CH1 to CH3 or CH1 to CH4) depending on the antibody isotype.
  • antibodies consist of only two heavy chains, each heavy chain comprising a variable domain (VH) and a constant region.
  • the variable domains are involved in antigen recognition, while the constant domains are involved in the biological, pharmacokinetic and effector properties of the antibody.
  • the variable region differs from one antibody to another.
  • the genes coding for the heavy and light chains of antibodies are generated by recombination of respectively three and two distinct gene segments called VH, DH and JH-CH for the heavy chain and VL and JL-CL for the light chain.
  • the CH and CL segments do not participate in recombination and form the constant regions of the heavy and light chains respectively.
  • VH-DH-JH and VL-JL segments form the variable regions of the heavy and light chains respectively.
  • the VH and VL regions each have 3 hypervariable zones or complementarity determining regions (CDRs), called CDR1, CDR2 and CDR3, with CDR3 being the most variable, since it is located at the recombination zone.
  • CDRs complementarity determining regions
  • These three CDR regions, and particularly CDR3, are found in the part of the antibody that will be in contact with the antigen and are therefore very important for antigen recognition.
  • antibodies retaining all three CDR regions and each of the heavy and light chains of an antibody retain the antigenic specificity of the original antibody for the most part.
  • an antibody retaining only one of the CDRs, and in particular CDR3, also retains the specificity of the original antibody.
  • the CDR1, CDR2 and CDR3 regions are each preceded by the FR1, FR2 and FR3 regions respectively, corresponding to the framework regions (framework region FR) that vary the least from one VH or VL segment to another.
  • the CDR3 region is also followed by a framework region FR4.
  • the CDRs of an antibody are defined from the amino acid sequence of its heavy and light chains in relation to criteria known to those skilled in the art. Different methods for determining CDRs have been proposed, and the portion of the amino acid sequence of a variable region of the heavy or light chain of an antibody defined as a CDR varies depending on the method chosen.
  • a first method of determination is that proposed by Kabat et al (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
  • the CDRs are defined by searching for the amino acids responsible for binding to the antibody antigen.
  • a 2 th method was proposed by the INTERNATIONAL IMMUNOGENETICS INFORMATION SYSTEM® (IMGT), this time based on the determination of hypervariable regions.
  • IMGT INTERNATIONAL IMMUNOGENETICS INFORMATION SYSTEM®
  • This numbering provides a standardized delimitation of the framework regions (FR1-IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 118 to 128) and the complementarity determining regions (CDR1-IMGT: positions 27 to 38, CDR2-IMGT: positions 56 to 65 and CDR3-IMGT: positions 105 to 117).
  • FR1-IMGT positions 1 to 26
  • FR3-IMGT 66 to 104
  • FR4-IMGT 118 to 128
  • CDR1-IMGT positions 27 to 38
  • CDR2-IMGT positions 56 to 65
  • CDR3-IMGT positions 105 to 117
  • a program for determining the CDRs from the amino acid sequence of an antibody heavy or light chain according to different nomenclatures is the abYsis “Annotate” tool available at http://www.abysis.org/abysis/sequence_input/key_annotation/key_annotation.cgi.
  • the IMGT “DomainGapAlign” tool available at https://www.imgt.org/3Dstructure-DB/cgi/DomainGapAlign.cgi described in two articles by Ehrenmann F. et al (Ehrenmann F., Kaas Q. and Lefranc M.-P.
  • variable regions whose sequence varies greatly from one antibody to another
  • constant regions are characterized by an amino acid sequence very close from one antibody to another, characteristic of the species and the isotype, with possibly some somatic mutations.
  • the heavy chain constant region is composed of N at the C-terminus of a CH1 domain, a hinge region then CH2 and CH3 or CH2 to CH4 domains (depending on the isotype).
  • the "Fc fragment" is naturally composed of the constant region of the heavy chain excluding the CH1 domain, i.e.
  • the positions of the CH1 to CH3 or CH1 to CH4 domains and the hinge region of the different antibody isotypes of many species are known to those skilled in the art, and can in particular be found on the IMGT website.
  • the Fc fragment is glycosylated at the CH2 domain with the presence, on each of the 2 heavy chains, of an N-glycan linked to the asparagine residue at position 297 (Asn 297).
  • binding domains located in the Fc, are important for the biological properties of the antibody: - FcRn receptor binding domain, involved in the pharmacokinetic properties (in vivo half-life) of the antibody: Various data suggest that certain residues located at the interface of the CH2 and CH3 domains are involved in binding to the FcRn receptor.
  • - C1q complement protein binding domain involved in the CDC response (for “complement-dependent cytotoxicity”): located in the CH2 domain;
  • - FcR receptor binding domain involved in phagocytosis or ADCC (for “antibody-dependent cellular cytotoxicity”) responses: located in the CH2 domain.
  • the light chain constant region for antibodies with two heavy chains and two light chains is composed of a single domain called CL.
  • “monoclonal antibody” or “monoclonal antibody composition” is meant a composition comprising antibody molecules with identical and unique antigenic specificity.
  • the antibody molecules present in the composition are likely to vary in their post-translational modifications, and in particular in their glycosylation structures or their isoelectric point, but have all been encoded by the same heavy and light chain sequences and therefore have, before any post-translational modification, the same protein sequence.
  • Certain differences in protein sequences, linked to post-translational modifications (such as for example the cleavage of the C-terminal lysine of the heavy chain, the deamidation of asparagine residues and/or the isomerization of aspartate residues), may nevertheless exist between the different antibody molecules present in the composition.
  • Antibodies can be of several "isotypes", depending on the nature of their constant region: the constant regions ⁇ , ⁇ , ⁇ , ⁇ and ⁇ correspond respectively to the immunoglobulins IgG, IgA, IgM, IgE and IgD.
  • the constant regions ⁇ include several subtypes: ⁇ 1, ⁇ 2, ⁇ 3, these three types of constant regions having the particularity of fixing human complement, and ⁇ 4, thus creating the subisotypes IgG1, IgG2, IgG3, and IgG4.
  • chimeric antibody we mean an antibody that contains a natural variable region (light chain and heavy chain) derived from an antibody of a given species in association with the constant regions of light chain and heavy chain of an antibody of a species heterologous to said given species.
  • the monoclonal antibody composition for use as a medicament according to the invention comprises a chimeric monoclonal antibody, the latter comprises human constant regions.
  • a chimeric antibody can be prepared using genetic recombination techniques well known to those skilled in the art.
  • the chimeric antibody can be produced by cloning for the heavy chain and the light chain a recombinant DNA comprising a promoter and a sequence coding for the variable region of the non-human antibody, and a sequence coding for the constant region of a human antibody.
  • a recombinant DNA comprising a promoter and a sequence coding for the variable region of the non-human antibody, and a sequence coding for the constant region of a human antibody.
  • Verhoeyen et al Verhoeyen et al. BioEssays, 8: 74, 1988.
  • a "humanized" antibody is defined as an antibody that contains CDR regions derived from an antibody of non-human origin, with the other parts of the antibody molecule being derived from one (or more) human antibodies.
  • FRs residues of the backbone segments
  • FRs residues of the backbone segments
  • humanized antibodies according to the invention can be prepared by techniques known to those skilled in the art such as the technologies of “CDR grafting”, “resurfacing”, SuperHumanization, “Human string content”, “FR libraries”, “Guided selection”, “FR shuffling” and “Humaneering”, as summarized in the review by Almagro et al (Almagro et al. Frontiers in Bioscience 13, 1619-1633, January 1, 2008).
  • human antibody is meant an antibody that contains only amino acid sequences of human origin.
  • a human antibody recognizing a given antigen can be obtained either by immunizing a healthy human volunteer, or by other methods, such as phage display (see for example Hammers CM, Stanley JR. Antibody phage display: technique and applications.
  • antigen-binding antibody fragment is meant a fragment of an antibody retaining the antigen-binding domain and thus having the same antigenic specificity as the original antibody.
  • antigen-binding antibody fragments include: - for double-chain antibodies (derived from most mammals, including mouse and human): Fv, scFv, Fab, F(ab') fragments 2 , Fab’, diabodies (generally called “diabodies”), triantibodies (generally called “tribodies”), tetraantibodies (generally called “tetrabodies”); and - for single-chain antibody fragments (from camelids or cartilaginous fish), VHH fragments (VH domain of a camelid antibody) or VNAR fragments (VH domain of a cartilaginous fish antibody).
  • Fv fragment or “variable fragment” is meant an antibody fragment formed from the VH and VL domains associated non-covalently.
  • the amino acids of the linker are most often chosen from glycine, serine, threonine, asparagine, alanine and proline, with glycine and serine being most often used in the majority.
  • a common scFv format is of the formula VH-linker-VL where the linker is of the sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 23).
  • a scFv generally has a molar mass of approximately 25 kDa.
  • Fab fragment we mean a fragment formed by the assembly of the part of the heavy chain located upstream of the papain cleavage site (the CH1 domain is included, but the hinge region and the other CH domains) and the entire light chain of the antibody of interest.
  • Fab fragments are monomers of approximately 50 kDa.
  • Fab fragment
  • F(ab’) fragment 2 we mean a fragment formed by the pairing of 2 Fab' fragments by disulfide bridges at the cysteines of the hinge region.
  • diabody or “diaantibody”, we mean a dimer composed of two scFv fragments.
  • the two scFv fragments can be identical (the diabody then has a single antigenic specificity) or different (the diabody can then be bispecific if the two scFvs recognize different antigens).
  • a diabody generally has a molar mass of approximately 50 kDa (2 times that of a scFv).
  • trimer or “tribody” or “triabody”, we mean a trimer composed of three scFv fragments.
  • the three scFv fragments can be identical (the tribody then has a single antigenic specificity) or different (the tribody can then be bi- or tri-specific depending on the antigenic specificity of the three scFvs).
  • a tribody generally has a molar mass of approximately 75 kDa (3 times that of a scFv).
  • tetraantibody or “tetrabody” is meant a quadrimer composed of four scFv fragments. The four scFv fragments can be identical (the tetrabody then has a single antigenic specificity) or different (the tetrabody can then be bi-, tri- or quadri-specific depending on the antigenic specificity of the four scFvs).
  • a tetrabody generally has a molar mass of approximately 100 kDa (4 times that of a scFv).
  • minibody or “minibody” is meant a fragment formed by the fusion of a scFv to a domain that tends to dimerize, and in particular to a CH3 domain.
  • a minibody generally has a molar mass of approximately 75 kDa.
  • nanobody or “single domain antibody” is meant the variable domain of the heavy chain of a single chain antibody.
  • a nanobody can in particular be a VHH or a VNAR.
  • VHH means the variable domain of the heavy chain of a single-chain antibody from a camelid (including llama and alpaca).
  • VNAR means the variable domain of the heavy chain of a single-chain antibody from a cartilaginous fish (including shark).
  • a VHH or VNAR typically has a molecular weight of about 12 to 15 kDa.
  • An antibody or antibody fragment “specifically binds” to an antigen when it binds to that antigen with a significantly higher binding affinity (e.g., than at least 10 times greater) than that with which it binds to other antigens.
  • a significantly higher binding affinity e.g., than at least 10 times greater
  • antigen is meant a substance which, when administered to a subject, can stimulate the immune system and cause the production of antibodies recognizing this substance.
  • an antigen can be a peptide or a protein, but can also be a nucleic acid, a lipid, a sugar, etc.
  • an antigen can in particular be a cancer antigen, an antigen of a pathogenic microorganism (for example of a virus, a bacterium, a parasite), or a self-antigen.
  • cancer antigen is meant an antigen expressed on the surface of a cancer cell. This cancer antigen is preferably expressed specifically on the surface of cancer cells (for example due to a tumor-specific mutation), to the exclusion of healthy cells of the subject, expressed predominantly on the surface of cancer cells (i.e. the majority of healthy cells of the subject do not express the cancer antigen), or overexpressed on the surface of cancer cells (i.e.
  • endothelin a neuropeptide secreted by the vascular endothelium, having a powerful vasoconstrictor effect on smooth muscle cells.
  • ET-1, ET-2 and ET-3 composed of 21 amino acids and including two disulfide bridges between cysteines 1 and 15 and 3 and 11.
  • ET-1, ENT-2 and ET-3 are derived from three much larger precursors: preproendothelin 1,2 and 3 (polypeptides of about 200 amino acids).
  • ETDs endothelins
  • EDNRA Endothelin subtype A receptor
  • ETB Endothelin subtype B receptor
  • GPCRs G protein-coupled receptors
  • ET-1 endothelins and their receptors
  • ET-1 plays a crucial role in the regulation of physiological smooth muscle motility, but ET-1 is also involved in a wide variety of pathologies including hypertension, heart failure, renal disorders and infectious diseases.
  • the ET axis is overexpressed in cancer of different organs contributing to tumor growth by acting on cell proliferation, survival, migration, differentiation, angiogenesis and recruitment of inflammatory cells.
  • ETAs are upregulated in prostate, ovarian and breast cancers while ETBs are overexpressed deregulated in melanoma, lung, renal and vulvar cancers ref (Rosan ⁇ , L., Spinella, F., Bagnato, A., 2013.
  • Pathogenic microorganism antigen means an antigen expressed on the surface of a pathogenic microorganism or cells infected by a pathogenic microorganism.
  • Self antigen means an antigen naturally expressed by certain healthy cells of a subject. There are self-tolerance mechanisms and the immune system does not normally generate antibodies that bind specifically to a self antigen, but sometimes the control mechanisms are insufficient and a subject produces antibodies against one or more self antigens. This is called an autoimmune disease.
  • identity percentages are determined on the basis of a global alignment of the sequences (nucleic or protein) to be compared, that is to say on an alignment of the sequences taken in their entirety over their entire length using any algorithm well known to those skilled in the art such as the Needleman and Wunsch algorithm (Needleman and Wunsch. J.Mol. Biol. 48,443-453, 1970).
  • This sequence comparison can be carried out using any software well known to those skilled in the art, for example the needle software using the "Gap open” parameter equal to 10.0, the “Gap extend” parameter equal to 0.5 and a "Blosum 62" matrix.
  • the needle software is for example available on the website ebi.ac.uk worldwide under the name "Align”.
  • An “amino acid equivalent” to another amino acid means any amino acid whose structure is close to that of the original amino acid and is therefore unlikely to alter the biological activities of the antibody.
  • molecule of interest is meant a molecule useful for an application of the conjugate according to the invention, in particular in the field of diagnosis or in vitro research tools.
  • molecules of interest include in particular molecules that are detectable or likely to become detectable, affinity molecules (and pharmacomodulatory molecules.
  • molecule that is detectable or likely to become detectable is meant a molecule that can be detected, directly (detectable molecule) or indirectly after modification (molecule likely to become detectable), using medical imaging techniques known to those skilled in the art, in particular isotopic imaging (such as positron emission tomography (PET), single-photon emission tomography (SPECT) and Cerenkov Luminescence imaging (CLI)); optical imaging; imaging by fluorescence.
  • PET positron emission tomography
  • SPECT single-photon emission tomography
  • CLI Cerenkov Luminescence imaging
  • Isotopic imaging or “nuclear imaging” detects "radionuclides” or “radioisotopes”, i.e. radioactive isotopes of a given atom.
  • PET positron emission tomography
  • SPECT single-photon emission tomography
  • the gamma rays of a radionuclide with direct or indirect emission of gamma photons are detected by gamma cameras.
  • the radionuclides used In SPECT, the radionuclides used directly emit a gamma ray when they disintegrate, while in PET, the radionuclides used emit a positron during their disintegration, which after annihilation with a surrounding electron, leads to the emission of 2 gamma rays, thus obtained indirectly.
  • Cerenkov Luminescence Imaging CLI
  • Cerenkov radiation CLI
  • Radioisotopes can be present directly in the probe (detectable molecule), or a probe with a chelating agent (molecule likely to become detectable) can also be used, which is coupled just before administration with a radiometal.
  • a “chelating agent” means a substance that has the ability to bind metal cations by forming a stable complex.
  • a “radiometal” means a radioactive isotope of a metal atom.
  • Optical imaging can detect absorbance, in particular that of a chromophore.
  • a "chromophore” means a group of atoms containing one or more double bonds, and forming with the rest of the molecule a sequence of conjugated double bonds, thus giving its color to the molecule containing it.
  • Optical imaging can also detect Cerenkov radiation (CR). Fluorescence imaging detects the fluorescence emission of a probe comprising a fluorescent molecule or fluorophore.
  • a “fluorescent molecule” or “fluorophore” means a molecule that emits light when exposed to light or other radiation, the emitted light having a longer wavelength than the light to which the molecule was exposed. Many fluorophores are molecules comprising multiple conjugated aromatic rings or planar, cyclic molecules having one or more ⁇ bonds.
  • An “affinity molecule” means a molecule that can be selectively and non-covalently bound to another chemical partner group, thereby forming a complex.
  • pharmacomodulatory molecule is meant a chemical molecule, synthetic or natural, that can modify the pharmacokinetic properties of another molecule to which it is linked.
  • halogeno is meant bromo, chloro, iodo, or fluoro.
  • (C 1 -C x )alkyl means a saturated, linear or branched hydrocarbon chain comprising 1 to x carbon atoms.
  • a (C1-C6)alkyl group is therefore a saturated, linear or branched hydrocarbon chain comprising 1 to 6, preferably 1 to 4, carbon atoms. Examples include methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, pentyl or hexyl groups.
  • “Cycloalkane” means a saturated hydrocarbon monocycle or polycycle comprising one or more, in particular 1 or 2 cycles, the cycles being able to be joined (i.e.
  • the cycloalkane will comprise 3 to 9 carbon atoms. It will preferably be cyclopropane, cyclohexane, cyclooctane, bicyclononane, norbonane.
  • heterocycloalkane we mean a cycloalkane in which one or more, in particular 1, 2, 3 or 4, carbon atoms have been replaced respectively by a heteroatom chosen from O, S and N, in particular O or N. It may in particular be piperidine, 1,2-piperazine, 1,4-piperazine, pyrrolidine, morpholine.
  • cycloalkene we mean a hydrocarbon monocycle or polycycle comprising at least one double bond and comprising one or more, in particular 1 or 2 cycles, the cycles being able to be joined (i.e. they share a bond between two carbon atoms) or bridged (i.e. they share a sequence of at least three carbon atoms).
  • the cycloalkene will comprise 3 to 10 carbon atoms. It will preferably be cyclopropene, cyclohexene, cyclooctene, bicyclononene, norbornene.
  • heterocycloalkene is meant a cycloalkene in which one or more, in particular 1, 2, 3 or 4, carbon atoms have been replaced respectively by a heteroatom chosen from O, S and N, in particular O or N. It may in particular be 3-pyrroline, 1,2,3,6-tetrahydropyridazine.
  • cycloalkyne is meant a hydrocarbon monocycle or polycycle comprising at least one triple bond and comprising one or more, in particular 1 or 2 cycles, the cycles being able to be joined (i.e. they share a bond between two carbon atoms) or bridged (i.e. they share a sequence of at least three carbon atoms). carbon).
  • the cycloalkyne will comprise 3 to 9 carbon atoms. It will preferably be cyclooctyne, bicyclononyne.
  • heterocycloalkyne is meant a cycloalkyne in which one or more, in particular 1, 2, 3 or 4, carbon atoms have been replaced respectively by a heteroatom chosen from O, S and N, in particular O or N. It may in particular be azacyclooctyne.
  • aromatic cycle is meant an aromatic hydrocarbon monocycle or polycycle comprising one or more, in particular 1 or 2 joined cycles. It will advantageously comprise 6 to 14, in particular 6 to 10 carbon atoms.
  • heteromatic cycle an aromatic monocycle or polycycle comprising one or more, in particular 1, 2 or 3, attached cycles, the atoms constituting the cycle or cycles comprising one or more, in particular 1, 2, 3 or 4 heteroatoms chosen from O, S and N, in particular O and N, the other atoms constituting the cycle or cycles being carbon atoms.
  • the cycle or cycles will advantageously be formed from 5 to 15, in particular 5 to 10 atoms.
  • each cycle will be a 5- or 6-membered cycle.
  • the invention relates to an antigen-binding mutant antibody fragment comprising a mutated heavy chain variable domain, the amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain being substituted by a cysteine, provided that said fragment is not a Fab fragment whose mutated heavy chain fragment corresponds to the amino acid sequence SEQ ID NO: 1 and the light chain fragment corresponds to the amino acid sequence SEQ ID NO: 2.
  • the invention covers any type of antigen-binding mutant antibody fragment comprising a mutated heavy chain variable domain as defined herein.
  • the invention covers both a fragment: a) which further comprises a light chain variable domain (from antibodies having two heavy chains and two light chains) and b) which does not comprise a light chain variable domain (from single chain antibodies comprising only one heavy chain).
  • Fragments which further comprise a light chain variable domain are however preferred, since the amino acid sequences of the heavy and light chains of many antibodies having two heavy chains and two light chains against many antigens are available in the prior art and therefore accessible to those skilled in the art.
  • the mutant antibody fragment according to the invention may be any type of fragment having a mutated heavy chain variable domain (VH) and a light chain variable domain (VH), but may advantageously be chosen from a Fab fragment, an scFv fragment, an Fv fragment, a diabody, a tribody, a tetrabody, and a minibody.
  • VH mutated heavy chain variable domain
  • VH light chain variable domain
  • the Fab, scFv and diabody fragments are preferred (in particular the Fab fragment), because they are those with the lowest molecular weight, and therefore the most capable of crossing the blood-brain barrier and with a short in vivo lifespan suitable for diagnosis.
  • the mutant antibody fragment according to the invention may in particular be a nanobody, advantageously chosen from the VHH and VNAR fragments.
  • the substitution of the amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain by a cysteine aims to allow selective conjugation on this cysteine.
  • the inventors have shown that, subject to using a particular method, it is possible to carry out specific conjugation on this cysteine in a Fab fragment, without affecting the other cysteines present in this fragment.
  • mutant antibody fragments according to the invention are intended to be conjugated to groups useful for in vivo use (diagnosis in particular), in particular in humans. Consequently, the mutant antibody fragment according to the invention is advantageously chimeric (if it contains part of the constant region, such as a Fab, then this part is human), humanized or human.
  • a mutant antibody fragment according to the invention if it contains a part of the constant region, such as a Fab, then this part is from the species of the animal in which the fragment is used), modified to replace the framework regions of the variable domains with regions from the species of the animal in which the fragment is used, or entirely from the species in which the fragment is used.
  • Antigen recognized by the mutant antibody fragment The antigen recognized by the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention is of little importance, the invention being applicable regardless of the antigen to which the original antibody binds specifically.
  • the mutant antibody fragments according to the invention are intended to be conjugated to groups useful for in vivo use (diagnosis in particular), and the antigen will therefore advantageously be chosen from antigens of diagnostic interest.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to a cancer antigen, an antigen of a pathogenic microorganism (in particular a viral, bacterial or parasitic antigen), or a self-antigen.
  • a mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binding specifically to a cancer antigen will be useful for in vivo uses in the context of the diagnosis, and possibly the treatment, of cancers, and is particularly preferred.
  • a mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention can bind specifically to any cancer antigen of interest.
  • Cancer antigens of interest include in particular CD19, CD20, CD22, CD38, HER2, CEA, PD1, PD-L1, CTLA-4, B7-H3 (also known as CD276), EpCAM, Folate receptor alpha, BCMA, LAG-3, gp100, GD2, TROP-2, Nectin-4, CD79b, CCR4, PDGRF ⁇ , SLAMF7, EGFR, and endothelin receptor A or receptor B.
  • the mutant antibody fragment in particular Fab, scFv or diabody, in particular Fab
  • Fab fragment according to the invention can in particular bind specifically to endothelin receptor A or receptor B.
  • a mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention specifically binding to an antigen of a pathogenic microorganism will be useful for in vivo uses in the context of the diagnosis, and possibly the treatment, of an infection by the pathogenic microorganism from which the antigen originates.
  • a mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention specifically binding to a self-antigen will be useful for in vivo uses in the context of the diagnosis, and possibly the treatment, of an autoimmune disease involving the production of antibodies against a self-antigen.
  • mutant antibody fragment Preferred antibodies from which the mutant antibody fragment is derived
  • the inventors have demonstrated that it is possible to specifically conjugate a mutant Fab fragment derived from an anti-endothelin receptor A RA63 antibody whose alanine residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain has been substituted by a cysteine.
  • the residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain of antibodies having a murine or human FR4 region is, unless there is a somatic mutation at this position, a serine (majority of cases) or an alanine.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention is therefore advantageously derived (by substitution of the residue at position 128 according to the IMGT nomenclature of the antibody heavy chain variable domain by a cysteine) from an antibody fragment whose amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain is a serine or an alanine.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention can therefore be derived (by substitution of the residue at position 128 according to the IMGT nomenclature of the antibody heavy chain variable domain by a cysteine) from an antibody fragment whose amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain is a serine.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention can therefore be derived (by substitution of the residue at position 128 according to the IMGT nomenclature of the variable domain of the heavy chain of the antibody by a cysteine) from an antibody fragment whose amino acid residue at position 128 according to the IMGT nomenclature of the variable domain of the heavy chain is an alanine.
  • the mutant antibody fragment according to the invention can be derived (by substitution of the residue at position 128 according to the IMGT nomenclature of the variable domain of antibody heavy chain by a cysteine) of a fragment of the antibody RB49 or RA63 or a variant thereof, which specifically bind to the endothelin receptor B.
  • the antibody RB49 specifically binds to the endothelin receptor B and has 6 CDRs defined according to the IMGT nomenclature as: - heavy chain: GYTFISYW (SEQ ID NO: 3, CDR1-H), IDPDSGGT (SEQ ID NO: 4, CDR2-H) and AREGDYAWFAY (SEQ ID NO: 5, CDR3-H), and - light chain: QSIVHSNGNTY (SEQ ID NO: 6, CDR1-L), KVS (SEQ ID NO: 7, CDR2-L) and FQGSHVPWT (SEQ ID NO: 8, CDR3-L).
  • IMGT IMGT nomenclature as: - heavy chain: GYTFISYW (SEQ ID NO: 3, CDR1-H), IDPDSGGT (SEQ ID NO: 4, CDR2-H) and AREGDYAWFAY (SEQ ID NO: 5, CDR3-H), and - light chain: QSIVHSNGNTY (SEQ ID NO: 6,
  • the RA63 antibody specifically binds to endothelin receptor A and has 6 CDRs defined according to the IMGT nomenclature as: - heavy chain: GFTFNIYA (SEQ ID NO: 9), IRSKSNNYAT (SEQ ID NO: 10) and VSSYYSGSFFAY (SEQ ID NO: 11), and - light chain: SQSIVYSNGKIYL (SEQ ID NO: 12), KVS (SEQ ID NO: 13) and FQGSHLPLT (SEQ ID NO: 14).
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) binds specifically to the endothelin B receptor, and comprises (in addition to the substitution of the amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain by a cysteine): - a heavy chain variable domain (VH) comprising three heavy chain CDRs CDR1-H, CDR2-H and CDR3-H having according to the IMGT nomenclature for respective sequences GYTFISYW (SEQ ID NO: 3), IDPDSGGT (SEQ ID NO: 4) and AREGDYAWFAY (SEQ ID NO: 5) or a sequence with at least 80% identity with GYTFISYW (SEQ ID NO: 3), IDPDSGGT (SEQ ID NO: 4) or AREGDYAWFAY (SEQ ID NO: 5), and - a light chain variable domain (VL) comprising three light
  • the amino acid(s) which differ from the native sequence are preferably substituted by an equivalent amino acid, so as to maintain the affinity for the ETB antigen.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin B receptor, and further comprises (in addition to the CDRs indicated above which correspond to that of the RB49 antibody or to variants thereof): - a VH domain having the sequence SEQ ID NO: 15 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVPVSA) or a sequence having at least 80% identity with SEQ ID NO: 15 such as the sequence SEQ ID NO: 27 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSED
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin B receptor, and comprises: - a VH domain having a sequence having at least 80% identity with SEQ ID NO: 15 and comprising three heavy chain CDRs CDR1-H, CDR2-H and CDR3-H having according to the IMGT nomenclature for respective sequences GYTFISYW (SEQ ID NO: 3), IDPDSGGT (SEQ ID NO: 4) and AREGDYAWFAY (SEQ ID NO: 5); and - a VL domain having a sequence having at least 80% identity with SEQ ID NO: 16 comprising three light chain CDRs CDR1-L, CDR2-L and CDR3-L having according to the IMGT nomenclature for respective sequences QSIVHS
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin B receptor, and comprises: - a VH domain having the sequence SEQ ID NO: 15 or SEQ ID NO: 27, and- a VL domain having the sequence SEQ ID NO: 16.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin receptor A, and comprises (in addition to the substitution of the amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain by a cysteine): - a VH domain comprising three heavy chain CDRs CDR1-H, CDR2-H and CDR3-H having according to the IMGT nomenclature for respective sequences GFTFNIYA (SEQ ID NO: 9), IRSKSNNYAT (SEQ ID NO: 10) and VSSYYSGSFFAY (SEQ ID NO: 11) or a sequence with at least 80% identity with GFTFNIYA (SEQ ID NO: 9), IRSKSNNYAT (SEQ ID NO: 10) or VSSYYSGSFFAY (SEQ ID NO: 11), and - a VL domain comprising three heavy chain CDRs CDR1-H, C
  • amino acid(s) which differ from the native sequence are preferably substituted by an equivalent amino acid, so as to maintain the affinity for the ETA antigen.
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin receptor A, and further comprises (in addition to the CDRs indicated above which correspond to that of the RA63 antibody or to variants thereof): - a VH domain having the sequence SEQ ID NO: 17 (EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTI SRDDSQNMVYLQMNNLKTEDTAMYYCVSSYYSGSFFAYWGQGTLVTVSA) or a sequence having at least 80% identity with SEQ ID NO: 17 such as the sequence SEQ ID NO: 28 (EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTI SRDDSQNMVYLQMNNLKTEDTAMYYCVSSYYSGSFF
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin receptor A, and comprises: - a VH domain having a sequence having at least 80% identity with SEQ ID NO: 17 and comprising three heavy chain CDRs CDR1-H, CDR2-H and CDR3-H having according to the IMGT nomenclature for respective sequences GFTFNIYA (SEQ ID NO: 9), IRSKSNNYAT (SEQ ID NO: 10) and VSSYYSGSFFAY (SEQ ID NO: 11); and - a VL domain having a sequence having at least 80% identity with SEQ ID NO: 18 comprising three light chain CDRs CDR1-L, CDR2-L and CDR3-L having according to the IMGT nomenclature for respective sequences
  • the mutant antibody fragment (in particular Fab, scFv or diabody, in particular Fab) according to the invention binds specifically to the endothelin B receptor, and comprises: - a VH domain having the sequence SEQ ID NO: 17 or SEQ ID NO: 28, and - a VL domain having the sequence SEQ ID NO: 18.
  • the RB49 and RA63 antibodies from which the mutant antibody fragment according to the invention is advantageously derived are chimeric antibodies, and when the mutant antibody fragment according to the invention contains a part of the constant regions (for example for a Fab fragment), this is preferably human.
  • mutant antibody fragment according to the invention may in particular be chosen from: a) a mutant Fab fragment specifically binding to the endothelin B receptor and comprising a heavy chain fragment of sequence SEQ ID NO: 19 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVTVSCASTKGPSVFPLAPSSKSTSGGTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTH) and a light chain of sequence SEQ ID NO: 20 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDL
  • an scFv fragment specifically binding to the endothelin receptor B comprising or consisting of the amino acid sequence SEQ ID NO: 25 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKGGGGSGGGGSGGGGSGGGGGSQVQLQPG AALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATLTVDKSSSTA YMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVTVSC); and b) a scFv fragment specifically binding to the endothelin receptor A comprising or consisting of the amino acid sequence SEQ ID NO: 26 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVYSNGKIYLE
  • the mutant antibody fragment according to the invention is not a Fab fragment whose mutated heavy chain fragment corresponds to the amino acid sequence SEQ ID NO: 1 and the light chain fragment corresponds to the amino acid sequence 'amino acids SEQ ID NO:2.
  • Such a Fab fragment would correspond to the Fab fragment of the antibody Hu4D5 (humanized antibody binding specifically to HER2), in which the serine residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain is substituted by a cysteine.
  • a mutant antibody fragment according to the invention may more broadly not be an antibody fragment whose heavy chain variable domain (VH) corresponds to the amino acid sequence SEQ ID NO: 1.
  • mutant antibody fragments whose VH domain corresponds to the VH domain of the Hu4D5 antibody (humanized antibody binding specifically to HER2), in which the serine residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain is substituted by a cysteine (regardless of the type of fragment or the sequence of the possible light chain). Even more broadly, a mutant antibody fragment according to the invention may not be a fragment of an antibody binding to the human HER2 antigen.
  • the mutant antibody fragment according to the invention is not derived (by substitution of the residue at position 128 according to the IMGT nomenclature of the antibody heavy chain variable domain by a cysteine) from an antibody fragment whose amino acid residue at position 128 according to the IMGT nomenclature of the heavy chain variable domain is a serine.
  • Nucleic acid molecule or pair of nucleic acid molecules encoding the mutant antibody fragment according to the invention The present invention also relates to a nucleic acid molecule or pair of nucleic acid molecules encoding the mutant antibody fragment according to the invention. Such a molecule or pair of molecules is useful in particular for producing the mutant antibody fragment according to the invention.
  • mutant antibody fragment may comprise a single chain (for example, fragments of the scFv, diabody, tribody, tetrabody, minibody, VHH, VNAR type) or two chains (for example, fragments of the Fv, Fab, Fab’, F(ab’)2 type).
  • a single nucleic acid molecule is preferably used to encode this chain.
  • the mutant antibody fragment according to the invention comprises two chains, the two chains may be encoded either by a single nucleic acid molecule or by two nucleic acid molecules.
  • nucleic acid sequences coding for a particular amino acid sequence of a mutant antibody fragment according to the invention are within the scope of the invention.
  • sequence of a nucleic acid according to the invention may have been optimized to promote its expression in a host cell, a transgenic non-human animal or a transgenic plant of interest.
  • some of these combinations are generally used preferentially by a given cell or organism (this is then referred to as a bias in the use of the genetic code). This preference depends in particular on the producing organism or from which the cell originates.
  • nucleic acid molecule(s) coding for the mutant antibody fragment according to the invention may further comprise a nucleic sequence coding for a signal peptide at the N-terminus of the chain(s) of the mutant antibody fragment according to the invention.
  • the present invention also relates to a vector comprising the nucleic acid molecule or the pair of nucleic acid molecules according to the invention, as described above.
  • a vector is also useful for producing the mutant antibody fragment according to the invention, the latter being able to be used to transform (in a stable or transient manner) a host cell which will then produce the mutant antibody fragment according to the invention.
  • Such a vector comprises the elements necessary for the expression of said nucleic sequence, and in particular a promoter, a transcription initiation codon, termination sequences, and appropriate transcription regulation sequences. These elements vary depending on the host used for the expression and are easily chosen by a person skilled in the art in the light of his general knowledge.
  • the vector may in particular be plasmidic or viral. Examples of plasmid and viral vectors suitable for expressing an antibody fragment are known to those skilled in the art (see in particular Sandomenico, A., Sivaccumar, J.P., Ruvo, M., 2020. Evolution of Escherichia coli Expression System in Producing Antibody Recombinant Fragments.
  • Host cell, transgenic non-human animal or transgenic plant The present invention also relates to a host cell, a transgenic non-human animal or a transgenic plant comprising the nucleic acid molecule or the pair of nucleic acid molecules according to the invention or the vector according to the invention as described above.
  • Such a host cell such a transgenic non-human animal and such a transgenic plant are also useful for producing the mutant antibody fragment according to the invention, these expressing the mutant antibody fragment according to the invention.
  • the host cell may be of prokaryotic or eukaryotic origin, and may in particular be chosen from bacterial cells, insect cells, plant cells, yeast cells or mammalian cells.
  • the mutant antibody fragment according to the invention may then be produced by culturing the host cell under appropriate conditions.
  • a host cell according to the invention may in particular be obtained by transforming a cell line with a vector according to the invention and separating the different cell clones obtained.
  • the transformed cell line is preferably of eukaryotic origin, and may in particular be chosen from insect cells, plant cells, yeast cells or mammalian cells.
  • Suitable cell lines for the production of the mutant antibody fragment according to the invention include in particular Escherichia coli among bacteria, Saccharomyces cerevisiae and Pichia pastoris among yeasts, and the cell lines CHO, NS0, Sp2/0, HEK293, and PER.C6 among mammalian cells.
  • a transgenic non-human animal according to the invention may be obtained by direct injection of the gene(s) of interest (here the nucleic acid molecule or the pair of nucleic acid molecules according to the invention) into a fertilized egg (Gordon et al., 1980 Proc Natl Acad Sci U S A.;77:7380-4).
  • a transgenic non-human animal may also be obtained by introduction of the gene(s) of interest (here the nucleic acid molecule or the pair of nucleic acid molecules according to the invention) into an embryonic stem cell and preparation of the animal by a chimera aggregation method or a chimera injection method (see Manipulating the Mouse Embryo, A Laboratory Manual, Second edition, Cold Spring Harbor Laboratory Press (1994); Gene Targeting, A Practical Approach, IRL Press at Oxford University Press (1993)).
  • the gene(s) of interest here the nucleic acid molecule or the pair of nucleic acid molecules according to the invention
  • a transgenic non-human animal may also be obtained by a cloning technique in which a nucleus, into which the gene(s) of interest (here the nucleic acid molecule or the pair of nucleic acid molecules according to the invention) has been introduced, is transplanted into an enucleated egg (Ryan et al, 1997 Science; 278: 873 – 876; Cibelli et al., 1998 Science, 280: 1256-1258; WO00/26357).
  • the mutant antibody fragment according to the invention may then be accumulated in the transgenic animal and harvested, in particular from the animal's milk or eggs.
  • transgenic non-human animals For the production of antibodies in the milk of transgenic non-human animals, preparation methods are described in particular in WO90/04036, WO95/17085, WO01/26455, WO2004/050847, WO2005/033281, WO2007/048077. Methods for purifying proteins of interest from milk are also known (see WO01/26455, WO2007/106078).
  • Transgenic non-human animals of interest include in particular mice, rabbits, rats, goats, cattle (in particular cows), and poultry (in particular chickens).
  • a transgenic plant according to the invention may be chosen from any plant allowing the production of antibody fragments.
  • the invention also relates to a conjugate comprising the mutant antibody fragment according to the invention, linked to at least one, in particular one or two, molecules of interest, advantageously via cysteine, and more particularly the thiol function of cysteine, in position 128 of the heavy chain variable domain according to the IMGT nomenclature of the mutant antibody fragment.
  • Molecule(s) of interest conjugated to the mutant antibody fragment according to the invention Different types of molecules of interest are likely to be conjugated to the mutant antibody fragment according to the invention, depending on the use envisaged for the conjugate.
  • the mutant antibody fragment according to the invention may in particular be conjugated to one or more molecules chosen from a molecule that is detectable or likely to become detectable, an affinity molecule, and a pharmacomodulatory molecule.
  • the mutant antibody fragment according to the invention may in particular be conjugated to one or more molecule(s) that are detectable or likely to become detectable, in particular in the context of diagnostic uses of the conjugate.
  • the mutant antibody fragment according to the invention may in particular be conjugated to one (conjugate intended to be used in a single type of imaging) or two (conjugate intended to be used in several types of imaging detecting different physical phenomena carrying two molecules detectable or likely to become detectable of different type, or conjugate intended to be used in a single type of imaging carrying two copies of the same molecule detectable or likely to become detectable in order to increase the signal) molecule(s) detectable or likely to become detectable.
  • Each molecule detectable or likely to become detectable is chosen according to the type of imaging for which the conjugate is intended.
  • Examples of molecules that are detectable or capable of becoming detectable that can be conjugated to the mutant antibody fragment according to the invention are: a) a radioisotope (detectable molecule), a chelating agent (molecule capable of becoming detectable, which becomes detectable after contacting with a radiometal), or an affinity molecule (molecule capable of becoming detectable, which becomes detectable after contacting the mutant antibody fragment conjugated to the affinity molecule with a radioisotope conjugated to a binding partner of the affinity molecule, or with a chelating agent conjugated to a binding partner of the affinity molecule and then a radiometal).
  • the radioisotope can be covalently conjugated to the mutant antibody fragment according to the invention, or non-covalently by complexation with a chelating agent covalently conjugated to the mutant antibody fragment according to the invention.
  • Radioisotopes or radiometals emitting gamma rays directly (direct emission of a gamma photon during decomposition) or indirectly (emission of a positron during its disintegration, which after annihilation with a surrounding electron, leads to the emission of 2 gamma rays) are preferred because they are detectable by positron emission tomography (PET) or by single-photon emission tomography (SPECT).
  • radiometals generally indirectly conjugated to the probe used (here the mutant antibody fragment according to the invention), the probe comprising a chelating agent which fixes the radiometal.
  • chelating agents include linear or cyclic chelating agents, such as DOTA, NOTA, deferoxamine B, and their derivatives.
  • DOTA and NOTA are for example respectively DOTAGA and (R)-NODAGA.
  • Examples of radiometals emitting directly or indirectly (via the emission of a positron, which after annihilation with a surrounding electron, leads to the emission of 2 gamma rays) gamma rays include 99m Tc, 111 In, 64 Cu, 68 Yes, 89 Zr, and 44 Sc.
  • 99m Tc, 111 In are direct emitters of gamma rays detectable by single-photon emission computed tomography (SPECT), while 64 Cu, 68 Yes, 89 Zr, and 44 Sc are indirect emitters of gamma rays detectable by positron emission tomography (PET).
  • a chelating agent can be advantageous because it allows in particular to be able to store the conjugate ready to chelate and to add the radioisotope, which can have a very short half-life, only at the last moment before use.
  • the complexation can be carried out just before use of the conjugate of the invention for an isotopic imaging application.
  • the conjugation to the chelating agent can be indirect via an affinity molecule and its binding partner, the mutant antibody fragment according to the invention is advantageously conjugated directly to a chelating agent.
  • Another radioisotope that can be used in PET imaging is 18 F, which is a positron emitter (and therefore an indirect emitter of gamma photons) and which can notably be introduced on so-called prosthetic groups, known to those skilled in the art, which can be conjugated to the mutant antibody fragment according to the invention.
  • a fluorophore detecttable molecule
  • an affinity molecule molecule capable of becoming detectable
  • the fluorophore is then detected after bringing the mutant antibody fragment conjugated to the affinity molecule into contact with a fluorophore conjugated to a binding partner of the affinity molecule.
  • the fluorophores are useful when the conjugate is intended to be used in fluorescence imaging.
  • the fluorophore can be covalently conjugated to the mutant antibody fragment according to the invention, or non-covalently when it is previously conjugated to a binding partner of the affinity molecule which complexes with the affinity molecule covalently conjugated to the mutant antibody fragment according to the invention.
  • fluorophores capable of being detected by fluorescence imaging and therefore of being conjugated to the mutant antibody fragment according to the invention include compounds of the cyanine family (in particular Cyanine3, Cyanine5, Cyanine5.5, Cyanine7, Cyanine7.5, carrying or not water-solubilizing groups, such as sulfones); compounds of the xanthene family (in particular compounds of the rhodamine family such as X-rhodamine, rhodamine B and compounds of the fluorescein family, carrying or not water-solubilizing groups, such as sulfones); compounds of the coumarin family (in particular, hydroxycoumarin, aminocoumarin, methoxycoumarin, carrying or not water-solubilizing groups, such as sulfones); and compounds of the boron-dipyrromethene family (BODIPY, including azaBODIPY derivatives).
  • BODIPY boron-dipyrromethene family
  • the fluorophore is selected from Cyanine5, Cyanine7, a rhodamine or an azaBODIPY.
  • Examples of (affinity molecule/binding partner) pairs include (biotin/avidin), (biotin/streptavidin), (avidin/biotin), and (streptavidin/biotin).
  • a chromophore detecttable molecule
  • an affinity molecule molecule capable of becoming detectable, the chromophore is then detected after contacting the mutant antibody fragment conjugated to biotin with a chromophore conjugated to a streptavidin molecule. Chromophores are useful when the conjugate is intended to be used in optical imaging by absorbance measurement.
  • the chromophore can be covalently conjugated to the mutant antibody fragment according to the invention, or non-covalently when it is previously conjugated to a binding partner of the affinity molecule which complexes with the affinity molecule covalently conjugated to the mutant antibody fragment according to the invention.
  • chromophores capable of being conjugated to the mutant antibody fragment according to the invention for use in optical imaging include phenolphthalein, gentian violet or Congo Red.
  • (affinity molecule/binding partner) pairs include (biotin/avidin), (biotin/streptavidin), (avidin/biotin), and (streptavidin/biotin).
  • the molecules detectable or capable of becoming detectable can be chosen from a fluorophore, a chromophore, an affinity molecule, a radioisotope and a chelating agent.
  • the mutant antibody fragment according to the invention may in particular be conjugated to: 1) a radioisotope or a chelating agent for use in isotopic imaging and a fluorophore or an affinity molecule for use in fluorescence imaging; 2) two detectable or detectable molecules of the same type and preferably identical, to increase the detected signal.
  • the detectable or detectable molecule may in particular be chosen from: a) radioisotopes or chelating agents for use in isotopic imaging, or b) fluorophores or affinity molecules for use in fluorescence imaging.
  • the mutant antibody fragment according to the invention may further or alternatively be conjugated to an affinity molecule. Such a conjugate can then be complexed to a detectable molecule or to a molecule capable of being detectable (for example, a chelating agent) capable of forming a complex with the affinity molecule which is conjugated to the mutant antibody fragment according to the invention.
  • affinity molecules include a biotin (capable in particular of forming a complex with a streptavidin previously conjugated to a fluorophore, a chromophore, a radioisotope or a chelating agent), an avidin (capable in particular of forming a complex with a biotin previously conjugated to a fluorophore, a chromophore, a radioisotope or a chelating agent), and a streptavidin (capable in particular of forming a complex with a biotin previously conjugated to a fluorophore, a chromophore, a radioisotope or a chelating agent).
  • a biotin capable in particular of forming a complex with a streptavidin previously conjugated to a fluorophore, a chromophore, a radioisotope or a chelating agent
  • an avidin capable in particular of forming a complex with
  • the affinity molecule can alternatively be used to easily purify the mutant antibody fragment according to the invention.
  • it is also possible to use a hexahistidine peptide making it possible to easily purify the fragment on a column comprising nickel (binding partner to which the hexahistidine peptide complexes).
  • the affinity molecule can therefore be chosen from biotin, avidin, streptavidin and a hexahistidine peptide.
  • the mutant antibody fragment according to the invention may additionally or alternatively be conjugated to a pharmacomodulatory molecule. Such conjugation may make it possible to improve the pharmacokinetics of the mutant antibody fragment according to the invention.
  • Examples of pharmacomodulatory molecules include linear or branched chains of poly(ethylene glycol), linear or branched chains of poly(glutamic acid), cholesterol, and molecules capable of binding to albumin (for example fatty acids, metal ions, bilirubin, a toxin, the p-iodophenyl butyryl group, the biphenyl group).
  • albumin for example fatty acids, metal ions, bilirubin, a toxin, the p-iodophenyl butyryl group, the biphenyl group.
  • the conjugate is linked to two molecules of interest, advantageously via cysteine, and more particularly the thiol function of cysteine, in position 128 of the heavy chain variable domain according to the IMGT nomenclature of the mutant antibody fragment.
  • at least one of these molecules is a molecule that is detectable or capable of becoming detectable, and preferably the two molecules each independently represent a molecule that is detectable or capable of becoming detectable, such as a fluorophore, a chromophore, an affinity molecule, a radioisotope, or a chelating agent.
  • one of these detectable molecules may be a fluorophore and the other may be a radioisotope or a chelating agent.
  • one of the molecules may be the chelating agent DOTA (allowing the chelation of a metal radioisotope such as 68Ga) and the other a tetrasulfonated cyanine 7 (fluorophore emitting in the near infrared).
  • DOTA chelating agent
  • 68Ga metal radioisotope
  • cyanine 7 fluorophore emitting in the near infrared
  • Such a conjugate may correspond to the following formula (I): in which: R 1 represents a mutant antibody fragment according to the invention linked to X 1 via cysteine, and more particularly the thiol function of cysteine, in position 128 of the heavy chain variable domain according to the IMGT nomenclature; with X 4 representing a single bond, O, S, or NR 4 , and R 4 representing H or (C1-C6)alkyl, the wavy bond indicating the point of attachment to R 1 and the dotted line indicating the point of attachment to L 1 ; L 1 , L 2 and L 3 each independently represent a single bond or a spacer, the spacer being a (C1-C30)-alkyl chain, for example (C1-C20)-alkyl, optionally preceded and/or interrupted and/or followed by one or more units chosen from the group consisting of aromatic, heteroaromatic, cycloalkane, cycloalkene, heterocycloalkane, heterocycloalkene
  • X 1 represents .
  • L 1 , L 2 and L 3 each independently represent a spacer.
  • the spacer is a (C1-C30)-alkyl chain, in particular (C1-C20)-alkyl, such as (C1-C10)-alkyl or (C1-C6)-alkyl, and in particular an ethyl or hexyl group (e.g. n-hexyl).
  • X 2 and X 3 are chosen independently from S and NR 8 .
  • one of X 2 and X 3 is S and the other is S or NR 8 .
  • R 8 is H. , , , dotted line indicating the point of attachment to L 1 and the wavy bonds indicating the points of attachment to the carbon atoms bearing X 2 or X 3 .
  • R 2 and R 3 is a residue of a molecule detectable or likely to become detectable, and in particular R 2 and R 3 each independently represent a residue of a molecule detectable or likely to become detectable, advantageously R 2 and R 3 represent respectively a residue of a fluorophore and a residue of a radioisotope or a chelating agent.
  • R 2 and R 3 may represent respectively a residue of a sulfonated Cyanine 7 and a residue of R-NODAGA (chelating agent).
  • X 1 represents .
  • L 1 and L 4 each independently represent a spacer.
  • the spacer is a chain (C 1 -C 30 )-alkyl, especially (C 1 -C 20 )-alkyl, such as (C1-C10)-alkyl or (C1-C6)-alkyl, and in particular an ethyl or hexyl group (e.g. n-hexyl).
  • the spacer is a PEG chain of formula –(CH2CH2O)x- or –(CH2CH2O)x-CH2CH2- with x an integer from 1 to 12, in particular from 2 to 8 and in particular 2, 4 or 8.
  • R 1 is a residue of a molecule which is detectable or capable of becoming detectable, advantageously chosen from a fluorophore, a chromophore, an affinity molecule, a radioisotope, and a chelating agent, and in particular from a fluorophore, a radioisotope and a chelating agent.
  • the conjugates according to the invention can advantageously be prepared by a preparation method comprising the following steps in the order indicated: a) reduction of the disulfide bridge(s) of the mutant antibody fragment, in particular in the presence of tris(2-carboxyethyl)phosphine (TCEP), to give a reduced mutant antibody fragment, b) reoxidation of the disulfide bridge(s) of the mutant antibody fragment, in particular in the presence of dehydroascorbic acid, to give a partially reduced mutant antibody fragment, c) conjugation with at least one molecule of interest of the thiol function of the cysteine at position 128 of the heavy chain variable domain according to the IMGT nomenclature of the partially reduced mutant antibody fragment to give a conjugate according to the invention.
  • TCEP tris(2-carboxyethyl)phosphine
  • Step a) aims to reduce all the disulfide bridges of the mutant antibody fragment, whether the disulfide bridges connecting the heavy chains of the mutant antibody fragment (also called inter-chain disulfide bridges), or the disulfide bridge formed with the thiol function of the cysteine at position 128.
  • Step b) aims to reoxidize only the inter-chain disulfide bridges, so as to obtain a partially reduced mutant antibody fragment, that is to say in which only the thiol of the cysteine at position 128 is in reduced form.
  • This thiol is then in the form of an SH group which can serve as a reactive chemical group to covalently conjugate at least one molecule of interest.
  • Step c) aims to conjugate the at least one molecule of interest to the SH function of the cysteine in position 128.
  • the partially reduced mutant antibody fragment obtained in step b) will be coupled with a molecule carrying, on the one hand, at least one molecule of interest and, on the other hand, a chemical group capable of reacting with an SH thiol function.
  • Such a chemical group capable of reacting with an SH function can be in particular , with Hal representing Br or I and X 4 representing a single bond, O, S, or NR 4 , R 4 representing H or (C1-C6)alkyl.
  • the process described above comprising steps a) and b) as described here prior to step c) of conjugation is also preferred for antibody fragments, in particular the Fv, VHH, VNAR fragments, because these fragments are often isolated in the form of dimers or adducts to glutathione, cysteines, etc. Steps a) of reduction and b) of reoxidation before conjugation are therefore also advantageously used.
  • the conjugate according to the invention is a conjugate of formula (I) as defined above and step c) can be carried out by coupling between the partially reduced mutant antibody fragment (corresponding to the R1H molecule) and a compound of the following formula (III): for which: L 1 is as defined above, cycle A 3 represents a cycloalkyne, cycloalkene, heterocycloalkyne or heterocycloalkene ring, optionally joined with one or more, in particular one or two, aromatic rings and optionally substituted by one or more groups chosen from (C1-C6)alkyl, halogeno, and hydroxy, and X 1a represents a chemical group reactive with an SH function, to give a compound of the following formula (IV): X1 R1 (IV) for which R 1 , X 1 , L 1 and cycle A 3 are as defined above, followed by the coupling between the compound of formula (IV) and a compound of the following formula (V): for which R 2
  • X 1a which represents a chemical group reactive with an SH function, representing a single bond, O, S, or NR 4 , and R 4 representing H or (C1-C6)alkyl.
  • the reaction of X 1a with the SH function of the cysteine at position 128 will form the group X 1 and covalently link the compound of formula (III) to the antibody fragment partially reduced mutant.
  • such a reaction between the SH function of a cysteine and a chemical group reactive with respect to an SH function is well known in the art.
  • step c) can be carried out by coupling the partially reduced mutant antibody fragment (R 1 H) with a compound of formula X 1a -L 1 -R 2 in which L 1 , X 1a and R 2 are as defined above.
  • a different reactive chemical group (G 2 ) can be grafted to the molecule of interest via a spacer L 4 or not (when L 4 represents a single bond).
  • the compound of formula X 1a -L 1 -X 1 '-R 2 can then be prepared by coupling between a compound of formula X 1a -L 1 -G 1 and a compound of formula G 2 -L 4 -R 2 in which X 1a , L 1 , L 4 and R 2 are as defined above and G 1 and G 2 are different and each represent a reactive chemical group capable of reacting together to form a group X 1 '.
  • the present invention therefore also relates to intermediate conjugates useful as a synthesis intermediate during the preparation of the conjugates according to the invention.
  • the present invention thus also relates to an intermediate conjugate comprising the mutant antibody fragment according to the invention, linked, via the cysteine, and more particularly the thiol function of the cysteine, in position 128 of the heavy chain variable domain according to the IMGT nomenclature of the mutant antibody fragment, to a reactive chemical group.
  • the reactive chemical group is chosen from N, N+ - Preferably 3 O, , , , cycles A 3 and A 4 being as defined above.
  • cycle A 3 will be chosen from , , advantageously chosen from 5
  • the intermediate conjugate according to the invention corresponds to the formula R 1 -X 1 -L 1 -Z in which R 1 , X 1 and L 1 are as defined above, and Z represents a reactive chemical group as defined above.
  • the conjugate according to the invention may be used in different in vivo applications.
  • the present invention also relates to a method for determining the tumor burden in a patient suffering from a tumor by imaging, comprising: a) administering to the patient suffering from a tumor a conjugate according to the invention whose antibody fragment binds specifically to an antigen of the patient's tumor, b) obtaining by imaging one or more images of one or more organs of the patient, and c) determining the tumor burden of the patient from the image(s) obtained in step b).
  • the molecule(s) conjugated to the mutant antibody fragment according to the invention at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature is advantageously chosen from molecules that are detectable or likely to become detectable.
  • the molecule(s) detectable or likely to become detectable will be chosen according to the type(s) of imaging envisaged.
  • the mutant antibody fragment according to the invention is advantageously conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to a radioisotope or a chelating agent (a complex with a radiometal is then formed just before administration to the patient).
  • the mutant antibody fragment according to the invention can also be conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to two different detectable molecules or molecules likely to become detectable, allowing its use in two different types of imaging.
  • the mutant antibody fragment according to the invention can be conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to two molecules detectable or capable of being detectable by different imaging techniques, and in particular to: a1) a radioisotope emitting direct or indirect gamma rays or a chelating agent for its use in a method of diagnosing a tumor by isotopic imaging (in particular by positron emission tomography (PET) or by single-photon emission tomography (SPECT)) and a fluorophore for its use in a method of diagnosing a tumor by fluorescence imaging; a2) a direct or indirect gamma-ray emitting radioisotope or a chelating agent for use in
  • the conjugates a1 and b1) are preferred.
  • the mutant antibody fragment according to the invention may be conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to two molecules detectable or capable of being detectable by the same imaging technique (this making it possible to increase the signal and therefore the detection sensitivity), and in particular to: a) two radioisotopes emitting direct or indirect gamma rays (different or preferably identical) or two chelating agents (different or preferably identical) for its use in a method of diagnosing a tumor by isotopic imaging (in particular by positron emission tomography (PET) or by single-photon emission tomography (SPECT)), b) two fluorophores (different or preferably identical) for its use in a method of diagnosing a tumor by fluorescence imaging, c) two chromophores (different or preferably identical) for use in
  • the mutant antibody fragment according to the invention may also be conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to: a) a pharmacomodulatory molecule and a radioisotope emitting direct or indirect gamma rays or a chelating agent for its use in a method for diagnosing a tumor by isotopic imaging (in particular by positron emission tomography (PET) or by single-photon emission tomography (SPECT)); b) a pharmacomodulatory molecule and a fluorophore for use in a method of diagnosing a tumor by fluorescence imaging; c) a pharmacomodulatory molecule and a chromophore for use in a method of diagnosing a tumor by optical imaging; d) a pharmacomodulatory molecule and an affinity molecule (a complex with a fluorophore conjugated to a binding partner of the affinity molecule is then formed before administration to the patient, the pair
  • the conjugates with a detectable or detectable molecule and a pharmacomodulatory molecule described above, the conjugates a) (a pharmacomodulatory molecule and a direct or indirect gamma-ray emitting radioisotope or a chelating agent) and b) (a pharmacomodulatory molecule and a fluorophore) are preferred.
  • Method of surgical treatment by tumor resection guided by fluorescence or nuclear imaging probe The invention also relates to the conjugate according to the invention, for use in a method of surgical treatment by tumor resection guided by fluorescence or isotopic imaging probe.
  • the present invention also relates to a method of surgical treatment by fluorescence-guided tumor resection or isotopic imaging probe, comprising: a) administering to a patient a conjugate according to the invention whose antibody fragment binds specifically to an antigen of the patient's tumor, b) obtaining by real-time imaging images of the tumor labeled by the conjugate, and surgically resecting the entire tumor using the real-time images obtained.
  • the mutant antibody fragment according to the invention is conjugated at the cysteine at position 128 of the heavy chain according to the IMGT nomenclature to: a1) a fluorophore for use in a method of surgical treatment by fluorescence-guided tumor resection; a2) an affinity molecule (a complex with a fluorophore conjugated to a binding partner of the affinity molecule is then formed before administration to the patient, the pair (affinity molecule/binding partner) being advantageously chosen from (biotin/avidin), (biotin/streptavidin), (avidin/biotin), and (streptavidin/biotin)) for its use in a method of surgical treatment by tumor resection guided by fluorescence imaging; b1) a chelating agent (in this case, a complex with a radiometal, direct or indirect emitter of gamma rays, is formed just before administration to the patient) for its use in a method of surgical treatment by tumor resection guided by fluorescence
  • the conjugates a1), b1) and c1) are preferred.
  • Method for monitoring by imaging the effectiveness of an antitumor treatment The invention also relates to the conjugate according to the invention, for its use in a method for monitoring by imaging the effectiveness of an antitumor treatment.
  • the present invention also relates to a method of treating a cancer patient, comprising: a) determining the tumor burden of the patient by the tumor burden determination method according to the invention before or concomitantly with the start of the administration of the antitumor treatment, b) administering the antitumor treatment to the patient, c) determining the patient's tumor burden by the tumor burden determination method according to the invention after the start of the administration of the antitumor treatment, d) comparing the tumor burdens determined in steps a) and c), and e) administering to the patient an antitumor treatment, wherein: - if the tumor burden determined in step c) is lower than or equal to that determined in step a), then the antitumor treatment administered in step e) is the same as in step b); - if the tumor burden determined in step c) is higher than that determined in step a), then the antitumor treatment administered in step e) is different from that administered in step b).
  • the molecule(s) conjugated to the mutant antibody fragment according to the invention at the cysteine in position 128 of the heavy chain according to the IMGT nomenclature is advantageously chosen from molecules that are detectable or likely to become detectable.
  • the molecule that is detectable or likely to become detectable will be chosen according to the type(s) of imaging envisaged, as described above in the section relating to the use of the conjugate according to the invention in a method for diagnosing a tumor by imaging.
  • the conjugate according to the invention is advantageously used: a) before or concomitantly with the start of the administration of the antitumor treatment, and b) at least once after the start of the administration of the antitumor treatment, and the tumor burden detected after the start of the administration of the antitumor treatment is compared to that detected before or concomitantly with the start of the administration of the antitumor treatment. If the tumor burden has decreased or remains stable after the start of the administration of the antitumor treatment, then the antitumor treatment is considered effective. If the tumor burden has increased after the start of the administration of the antitumor treatment, then the antitumor treatment is considered ineffective.
  • the present invention is now illustrated by examples below.
  • Position 5 of the heavy chain according to the IMGT nomenclature is therefore not suitable for a general method of substituting this position with a cysteine to allow site-specific conjugation.
  • the results for position 24 of the heavy chain according to the IMGT nomenclature are presented in Table 4 below, and also show that this position is poorly conserved and varies significantly depending on the V segment that is used in the VH domain.
  • lysine K has a significantly longer side chain than alanine. While replacing an alanine (A) with a cysteine allows for good reactivity of the cysteine thiol, it is not clear whether replacing a lysine K or a threonine T with a cysteine would lead to the same result. Furthermore, position 24 of the heavy chain according to the IMGT nomenclature is not indicated for introducing a substitution because it plays a crucial role in the proper folding of the antibody chain, being located right next to the cysteine at position 23 IMGT performing the SS bridge between the C23 and C104 position (IMGT). Introducing a C at position 24 could therefore disrupt the proper folding and stabilization of the heavy chain.
  • Murine V segments Human V segments Amino acids at position S (75%), A (25%), S (100%) 128 of the heavy chain (IMGT) Thus, only one amino acid (S) is present at position 128 IMGT of the heavy chain in human J segments, and the majority of amino acids present at position 128 IMG of the heavy chain in murine J segments are also serine, the only other amino acid used at this position is alanine.
  • position 128 IMGT of the heavy chain corresponds to the last amino acid of the VH domain and is therefore not involved in antigen recognition or heavy chain folding. For all these reasons, position 128 IMGT of the heavy chain is therefore much more suitable than positions 5 and 24 IMGT of the heavy chain for a general method of substitution of this position with a cysteine to allow site-specific conjugation.
  • heavy chain IMGT positions 5 and 24 are poorly conserved and involved in proper heavy chain folding (in addition, IMGT position 24 is located near CDR1-H and also near the cysteine at position 23 and their replacement by a cysteine could therefore interfere with the canonical disulfide bridge between cysteines at positions 23 and 104. These positions are therefore not suitable for a general method of substituting this position by a cysteine to allow site-specific conjugation.
  • heavy chain IMGT position 128, the last amino acid before the constant region is highly conserved and is not involved in either antigen recognition or heavy chain folding. It is therefore particularly well suited for a general method of substituting this position by a cysteine to allow site-specific conjugation.
  • VH domain allows it to be used regardless of the type of antibody fragment of interest, provided that it includes a VH domain. This is not the case for position 129 IMGT identified in Junutula JR et al. as the best position of the Hu4D5 Fab heavy chain for site-specific conjugation (Junutula JR et al. Rapid identification of reactive cysteine residues for site-specific labeling of antibody-Fabs, Journal of Immunological Methods, Volume 332, Issues 1–2, 2008, Pages 41–52, https://doi.org/10.1016/j.jim.2007.12.011). This position is indeed the first amino acid of the constant region.
  • Example 2 Preparation of a mutant Fab of the chimeric antibody xiRA63 with a cysteine at position 128 (IMGT nomenclature) of the heavy chain and random or site-specific grafting onto a tetrazine already bifunctionalized by a Zirconium-89 chelating agent (DFO) and a fluorophore (IRDye800)
  • IMGT nomenclature a cysteine at position 128
  • DFO Zirconium-89 chelating agent
  • IRDye800 fluorophore
  • Plasmids were co-transfected into ExpiCHO-S cells (ThermoFisher) according to the manufacturer's instructions "ExpiCHOTM Expression System User Guide” (MAN0014337 ThermoFisher Scientific). Day 12 post-transfection, the supernatant was clarified by centrifugation at 4000-5000xg for 30 min at 4°C and filtered through a 0.22 ⁇ m filter. Thiofab xiRA63 was then affinity purified on a HiTrap KappaSelect column (GE Healthcare). After elution, antibody solutions were dialyzed with the Slide-A-LyzerTM G2 dialysis cassette (Thermoscientific) with a cut-off threshold of 10kDa in 1 liter of PBS.
  • Figure 2 presents antigen binding curves comparing the mutant Fab fragment with a cysteine at position 128 (IMGT) of the heavy chain according to the IMGT nomenclature of the xiRA63 antibody and a conjugate obtained by site-specific grafting of a tetrazine bifunctionalized by a Zirconium-89 chelating agent (DFO) and a fluorophore (IRDye800).
  • Tables 6 and 7 below further present the Bmax and Kd values obtained from the curves.
  • the site-specific conjugate obtained from the mutant Fab with a cysteine at position 128 of the heavy chain according to the IMGT nomenclature exhibits better conjugation characteristics than the random conjugate obtained from the classical Fab which is extremely perturbed. Due to its much better properties, the clinical use of the site-specific conjugate obtained from the mutant Fab with a cysteine at position 128 of the heavy chain according to the IMGT nomenclature can then be envisaged.
  • Example 3 Preparation of a mutant Fab of the chimeric antibody xiRA63 with a cysteine at position 128 (IMGT nomenclature) of the heavy chain, grafting, in vitro characterization and in vivo use for imaging in a glioblastoma model
  • IMGT nomenclature a cysteine at position 128
  • the plasmids were co-transfected into ExpiCHO-S cells (ThermoFisher) according to the manufacturer's instructions "ExpiCHOTM Expression System User Guide” (MAN0014337 ThermoFisher Scientific). Day 12 post-transfection, the supernatant was clarified by centrifugation at 4000-5000xg for 30 min at 4°C and filtered through a 0.22 ⁇ m filter. ThioFab xiRA63 was then affinity purified on a HiTrap KappaSelect column (GE Healthcare). After elution, the antibody solutions were dialyzed with the Slide-A-LyzerTM G2 Dialysis Cassette (Thermoscientific) with a 10kDa cutoff in 1 L of PBS.
  • ThioFab-xiRA63-DFO conjugation ThioFab-xiRA63 (500 ⁇ g, 459 ⁇ L at 1.1 g/L) was reduced with 30.8 ⁇ L of TCEP (20mM) at 37°C for 1 hour. After purification using centrifugal filter units with a molecular weight cutoff of 10,000 Da, reoxidation of the native interchain disulfide bond was performed with 6.75 ⁇ L of dehydroascorbic acid (dhAA, 20 equiv., 50 mmol/L in carbonate/bicarbonate buffer pH 9) for 1 hour at 37°C.
  • dehydroascorbic acid dhAA, 20 equiv., 50 mmol/L in carbonate/bicarbonate buffer pH 9
  • Radiolabeling of ThioFab-xiRA63-DFO with Zirconium 89 [ 89 Zr] To radiolabel this antibody fragment with zirconium-89 (PerkinElmer), a protocol previously described by Vosjan et al., 2010 (Vosjan, M., Perk, L., Visser, G. et al. Conjugation and radiolabeling of monoclonal antibodies with zirconium-89 for PET imaging using the bifunctional chelate p-isothiocyanatobenzyl-desferrioxamine. Nat Protoc 5, 739–743 (2010). https://doi.org/10.1038/nprot.2010.13) was used.
  • the [ 89 Zr]Zr-ThioFab-xiRA63-DFO was then purified on a PD-10 column with a solution of gentisic acid (5 mg/mL in 0.25 M sodium acetate, pH 5.5) as mobile phase and concentrated with Vivaspin® ultrafiltration tubes (Satorius) with a cutoff of 10 kDa.
  • mice Six four-week-old female NMRI nude mice (Janvier Labs) were orthotopically implanted with 5.10 5 glioblastoma cells (Gli7; ETA + ), in the striatum (2 mm to the right of bregma and 2.5 mm deep from the dura mater) under isoflurane anesthesia associated with local xylocaine.
  • a 10 ⁇ L Hamilton syringe was used with a flow rate of 0.25 ⁇ L/min.
  • 0.05 mg.kg -1 of buprenorphine was administered subcutaneously to each mouse. Mice were housed in fours in ventilated cages with 40% humidity and a temperature-controlled room at 22°C.
  • Antibody injection 78 days after glioblastoma cell implantation (Herbet A. et al. Antibodies Targeting Human Endothelin-1 Receptors Reveal Different Conformational States in Cancer Cells. Physiol. Res. 67 (Suppl. 1): S257-S264, 2018. https://doi.org/10.33549/physiolres.933848), a total of 5 mice received an intravenous bolus of [ 89 Zr]Zr-ThioFab-xiRA63 (100 ⁇ C ⁇ 5 ⁇ C).
  • PET-CT image acquisitions We performed a first 60-minute dynamic acquisition immediately after antibody injection using an Inveon microPET scanner or an Inveon microPET/CT scanner (Siemens). Then, a 20-minute PET acquisition was performed at the following times: 5h, 24h, 48h, 72h and 7 days after injection. The imaging sessions of the mice were performed under anesthesia. PET-CT analysis: We used PMOD software (Version 3.9) to analyze the different acquisitions. Spherical volumes of interest (VI) with a fixed size of 8mm3 were created in several organs: heart, liver, kidneys, spleen and muscle. For bone and brain tumor, VIs were drawn using the "iso-contour" tool.
  • mice were imaged whole-body by microPET/CT at different times (for 1h after injection, then at 5h, 24h, 48h, 72h, and 168h or 7 days pi) allowing us to study the tissue distribution (biodistribution) of our PET immunotracer over time.
  • [ 89Zr ]Zr-ThioFab-xiRA63 ( ⁇ 60kDa) appears to follow a renal elimination pathway (70% ID.cm -3 accumulation in the kidney in the first hour pi). Indeed, small molecules are rapidly eliminated from the bloodstream due to glomerular filtration and renal excretion.
  • Example 4 Preparation of a thioFab (thioFab-xiRB49) of the chimeric RB49 antibody (xiRB49)
  • simple chimerization substitution of mouse constant regions by human constant regions
  • RB49 led to a non-functional chimeric antibody, unable to bind specifically to the ETB receptor.
  • the presence of an unusual proline at position 125 of the variable region of the heavy chain of RB49 could induce a different folding of the variable region during its chimerization.
  • the CDR3 of the heavy and light chains then come into prolonged contact, making them unavailable for interaction with the ETB antigen.
  • the heavy and light chains encoding IgG-xiRB49, Fab-xiRB49-P125T and ThioFab-xiRB49-P125T were subcloned into the expression plasmid pTT5.
  • Vectors were co-transfected into ExpiCHO-S cells (ThermoFisher Scientific) with the ExpiCHO Expression System kit (ThermoFisher Scientific) according to the manufacturer's instructions (MAN0014337 ThermoFisher Scientific).
  • the supernatant was clarified by centrifugation at 4000-5000 ⁇ g for 30 min at 4 °C and filtered through a 0.22 ⁇ m filter.
  • xiRA63 was purified on a HiTrap Protein A HP column (GE HealthCare) and Fab and ThioFab on the HiTrap KappaSelect (GE HealthCare). After elution, the antibody solutions were dialyzed with the Slide-A-LyzerTMG2 dialysis cassette (ThermoFisher Scientific) into 1 L of phosphate-buffered saline (PBS). Thermal stability study Samples at 1 mg ⁇ mL-1 were deposited in the capillaries to determine the antibody denaturation temperature curves (Tycho NT6 instrument, NanoTemper).
  • Figure 12 shows the first derivative of the A350 nm/A330 nm ratio of the xiRB49-P125T, Fab-xiRB49-P125T and ThioFab-xiRB49-P125T antibodies, allowing the inflection temperatures (T i ) to be obtained.
  • the three antibodies show the same T i 2 , reflecting the Fab domain of the order of 90°C. After confirming the physicochemical properties of the different fragments, their functionality was evaluated.
  • the ThioFab-xiRB49-P125T induces an equivalent shift of the signal emitted by the xiRB49-P125T with an apparent Kd then increasing to 11.69 nM. No significant difference is observed between the two competition conditions involving Fab-xiRB49-P125T and ThioFab-xiRB49-P125T. This result proves that the ThioFAb-xiRB49-P125T antibody is indeed functional as suggested by its thermal denaturation curve and its Ti2 inflection temperature.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Optics & Photonics (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Endocrinology (AREA)
  • Oncology (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

La présente invention concerne un fragment d'anticorps mutant se liant à l'antigène comprenant un domaine variable de chaine lourde muté, le résidu d'acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaîne lourde étant substitué par une cystéine, sous réserve que ledit fragment n'est pas un fragment Fab dont le fragment de chaîne lourde muté correspond à la séquence d'acides aminés SEQ ID NO : 1 et le fragment de chaîne légère correspond à la séquence d'acides aminés SEQ ID NO :2. La présente invention concerne également des molécules d'acides nucléiques, vecteurs et cellules hôtes utiles pour la production du fragment d'anticorps mutant, des conjugués finaux et intermédiaires le comprenant et leurs procédés de production, ainsi que différentes utilisations de ceux-ci.

Description

Fragment Fab mutant pour l’obtention de conjugués mono- ou bi-fonctionnalisés site- spécifiques DOMAINE DE L'INVENTION La présente invention concerne un fragment Fab mutant, caractérisé en ce que le résidu d’acide aminé en position 128 de la chaine lourde selon la nomenclature IMGT est substitué par une cystéine, sous réserve que ledit fragment n’est pas un fragment Fab dont le fragment de chaine lourde muté correspond à la séquence d’acides aminés SEQ ID NO : 1 et le fragment de chaine légère correspond à la séquence d’acides aminés SEQ ID NO :2, ainsi que son utilisation pour obtenir des conjugués mono- ou bi-fonctionnalisés site-spécifiques de celui- ci, un conjugué intermédiaire, des procédés de préparation du conjugué final ou intermédiaire et des conjugués mono- ou bi-fonctionnalisés, ainsi que différentes utilisations de ces conjugués. ETAT DE LA TECHNIQUE L’utilisation d’agents d’imagerie isotopique dans lesquels un radioisotope d’imagerie (émetteur de positons ou émetteur gamma) est accroché à un vecteur spécifique de récepteurs surexprimés par des cellules tumorales est aujourd’hui une approche très efficace pour le diagnostic de nombreux cancers. Par ailleurs, les succès cliniques récents du Lutathera et du PSMA-617, ou encore l’exemple plus ancien du zevalin, confirment l’efficacité de tels radiopharmaceutiques pour la thérapie (respectivement de tumeurs neuroendocrines, du cancer de la prostate et du lymphome non Hodgkinien) lorsque le radioisotope est un émetteur beta- (e.g. Lu-177 ou Y-90) ou alpha (e.g. Ac-225 ou Pb-212). De plus, l’utilisation de conjugués fluorescents trouve un intérêt grandissant pour l’assistance à la chirurgie (FGS pour Fluorescence Guided Surgery). En effet, la présence d’une molécule fluorescente permet d’aider le chirurgien à visualiser des tissus tumoraux invisibles à l’œil nu, permettant ainsi une meilleure délinéation des zones tumorales, et donc une meilleure résection des tumeurs, réduisant ainsi les risques de récidive. Le développement de ces approches nécessite de modifier le vecteur biologique afin d’introduire la fonctionnalité désirée (molécule cytotoxique, agent chélatant pour un radiométal, fluorophore, etc.). De nombreuses méthodes de bioconjugaison ont ainsi été développées, incluant certaines approches dites « site-spécifiques » pour contrôler le site d’accroche sur des protéines. Cependant, il existe peu d’exemples de stratégies suffisamment modulaires pour permettre d’introduire à façon plusieurs fonctionnalités. Ainsi, quelques exemples de conjugués contenant à la fois un agent chélatant de radiométaux et un fluorophore ont été décrits, notamment dans le cas des vecteurs reposant sur un anticorps entier, mais ceux-ci sont souvent construits selon des méthodes de fonctionnalisation séquentielle ne permettant pas de contrôler précisément le ratio des deux sondes imageantes et une bonne reproductibilité des synthèses. Ainsi, un trastuzumab conjugué à une plateforme tétrazine bifonctionnalisée par un agent chélatant (DOTAGA) et un fluorophore (Cy5 disulphonatée) a été décrit, mais le greffage de la plateforme tétrazine bifonctionnalisée a été réalisé de manière aléatoire et non site-spécifique, par réaction d’un groupement bicyclo[6.1.0]nonyne (BCN) sur les fonctions amines de l’anticorps (WO2018172543A1 et Coline Canovas, et al.. Modular Assembly of Multimodal Imaging Agents through an Inverse Electron Demand Diels–Alder Reaction. Bioconjugate Chemistry, American Chemical Society, 2019, 30 (3), pp.888-897). De même, un diabody modifié par l’ajout d’un tag H6-GGC (6 histidines suivies de deux glycines et une cystéine) en C-terminal et conjugué sur ces deux cystéines par un fluorophore (IRDye800CW) et de manière aléatoire par un radioisotope (124Iode) a été synthétisé (Zettlitz, K.A., et al., 2018. Dual-modality immunoPET and near-infrared fluorescence (NIRF) imaging of pancreatic cancer using an anti-prostate cancer stem cell antigen (PSCA) cys-diabody. J Nucl Med jnumed.117.207332). Un greffage aléatoire ne permet cependant pas de garantir le maintien de l’affinité pour l’antigène, et ne permet pas non plus une bonne reproductibilité du conjugué obtenu à chaque lot produit, ce qui n’est bien entendu pas acceptable pour des conjugués destinés à être administrés à des patients. Un trastuzumab bifonctionnalisé de manière site-spécifique par un agent chélatant (DFO) et un fluorophore (IRDye800CW) a été décrit, le conjugué reposant sur une plateforme de type lysine trifonctionnalisée par DFO, IRDye800CW et un groupement BCN, et son greffage sur l’anticorps au niveau des deux N-glycannes, modifiés préalablement pour comprendre un groupement azoture réagissant avec le groupement BCN de la plateforme lysine (Pierre Adumeau, et al. Site-Specific Platform-Based Conjugation Strategy for the Synthesis of Dual- Labeled Immunoconjugates for Bi-modal PET/NIRF Imaging of HER2-Positive Tumors. Bioconjugate Chemistry, American Chemical Society, 2022, 33 (3), pp.530-540). Cependant, dans le cadre des tumeurs cérébrales, les conjugués doivent en outre être capables de franchir la barrière hématoencéphalique (BHE). Or, les conjugués reposant sur un anticorps entier peinent à franchir la BHE et ne sont donc pas bien adaptés aux tumeurs cérébrales. De plus, les anticorps entiers ont des durées de vie in vivo relativement élevées (en particulier les IgG) du fait de leur domaine Fc, qui ne sont pas souhaitables, en particulier pour le diagnostic. Ces deux problématiques de barrière extrêmement sélective et de durée de vie in vivo pourraient être contournées à l’aide de format d’anticorps plus petits. Ainsi, un conjugué entre un VHH anti-EGFR, un fluorophore photosensibilisant (IRDye700DX) et un agent chélatant (acide diéthylènetriamine-pentaacétique ou ADTP) via une plateforme tétrazine a été synthétisé. Le greffage du VHH sur la plateforme tétrazine a été fait par greffage sur une cystéine ajoutée en C-terminal du VHH (Renard, E. et al. Site-Specific Dual-Labeling of a VHH with a Chelator and a Photosensitizer for Nuclear Imaging and Targeted Photodynamic Therapy of EGFR-Positive Tumors. Cancers 2021, 13, 428). WDO2011/003622A1 décrit un nanobody anti-HER2 bivalent comprenant deux domaines VH fusionnés via un linker (Nanobody 1-(VVTS)C de séquence SEQ ID NO :17). Dans le 2ème domaine VH du nanobody, l’acide aminé en position 128 IMGT a été remplacé par une cystéine. Si le nanobody a été produit, sa capacité à lier son antigène avec la même affinité que sans la substitution en position 128 IMGT n’a pas été vérifiée. De plus, aucun conjugué de ce nanobody avec un autre groupement chimique au niveau du groupe thiol de la cystéine insérée en position 128 IMGT n’est décrit. WO2011/006914A2 décrit un variant dénommé DSM0162 d’un anticorps simple domaine anti- TNFR1 (dénommé DOM1h-574-16), dont l’acide aminé en position 128 IMGT a été substitué par une cystéine, ainsi qu’un conjugué de ce fragment à du polyéthylène glycol (PEG) via un linker de type maléimide, dans le but d’augmenter sa demi-vie in vivo. Une demi-vie a été calculée sur la base d’un test ELISA utilisant une capture par TNFR1. Cependant, aucun rendement de couplage n’est indiqué et il n’est pas démontré que l’affinité pour l’antigène n’est pas affectée par la substitution. US2006/062784A1 décrit un variant (appelé DOM8-24cys de séquence SEQ ID NO :85) d’un anticorps simple domaine anti-CD40 (DOM-24, SEQ ID NO :26), dans lequel l’acide aminé en position 128 IMGT a été substitué par une cystéine, ainsi que la possibilité de le conjuguer à du polyéthylène glycol (PEG). Cependant, aucun procédé précis de conjugaison n’est décrit, aucun rendement de couplage n’est mentionné et aucune donnée confirmant que le variant et le conjugué maintiennent la même affinité pour leur antigène CD40 ne sont présentées. WO2018/106895A1 décrit deux protéines de fusion de séquences SEQ ID NO :816 et 817 (Tableau 4 de l’Exemple 2) comprenant la sous-unité A de la toxine Shiga fusionnée à un VHH de spécificité antigénique inconnue, dans lequel l’acide aminé en position 128 IMGT a été substitué par une cystéine. Cependant, l’activité de ces deux protéines de fusion n’a pas été testée, et il n’a donc pas été démontré qu’elles maintiennent leur affinité pour leur antigène. De plus, aucun conjugué de ces fusions spécifiques n’est décrit. WO2022/133089A1 décrit un anticorps simple chaine (sdAb) dirigé contre CEA6 dénommé Cap03-04-CEA6-R3-39/19 de séquence SEQ ID NO :154, dans laquelle l’acide aminé en position 128 IMGT a été substitué par une cystéine. Cependant, aucune donnée fonctionnelle confirmant que ce sdAB maintient une affinité équivalente pour son antigène n’est présentée. Aucune conjugué de ce sdAb spécifique n’est décrit non plus. Néanmoins, des VHH ne sont pas nécessairement disponibles pour toutes les cibles d’intérêt, alors que de nombreux anticorps contre des cibles d’intérêt sont disponibles. L’utilisation d’un petit fragment d’anticorps, tel qu’un fragment Fab ou scFv (ou tout autre format de fragment d’anticorps avec une chaine lourde et une chaine légère), pourrait donc permettre de bénéficier de l’ensemble des anticorps existants visant des cibles d’intérêt tout en limitant suffisamment la taille pour permettre de franchir la BHE, et en limitant la durée de vie in vivo, du fait de l’absence d’un domaine Fc. WO2010/115866A1 décrit un scFv anti-GPIIb/IIIa (AP3 LC-HC scFV C39S S248C). Dans la partie du scFv correspondant au domaine VH, l’acide aminé en position 128 IMGT a été substitué par une cystéine. Des conjugué du scFv avec un groupement chimique comprenant du polyéthylène glycol (PEG) (Exemple 13) ou un variant de FVIII (Exemple 14), la conjugaison impliquant le groupe thiol de la cystéine, sont également décrits. Cependant, aucun rendement de couplage n’est indiqué. De plus, ce document ne présente aucune donnée confirmant que les conjugués sont fonctionnels et conservent leur affinité pour l’antigène GPIIb/IIIa. Au contraire, dans les deux cas, les données d’analyse brute des conjugués suggèrent que le matériel obtenu contient une grande proportion de matériel agrégé, peu susceptible de conserver son affinité pour l’antigène. Un fragment Fab serait tout particulièrement adapté, du fait de son poids moléculaire intermédiaire (ni trop élevé ni trop faible), permettant de franchir la BHE et d’avoir une durée de vie in vivo ni trop longue ni trop courte. De plus, la présence de deux chaines lourdes partielles peut permettre une double conjugaison, qui serait absente dans des fragments de type VHH ou ScFv, permettant ainsi une meilleure activité spécifique aussi bien en imagerie par fluorescence qu’isotopique. La préparation de bioconjugués reposant sur un fragment Fab pose toutefois des difficultés. Notamment, un fragment Fab ne comprend généralement pas de N-glycane susceptible d’être modifié pour avoir un groupement azide capable de réagir avec le groupement BCN d’une lysine en outre fonctionnalisée par un agent chélatant et un fluorophore comme décrit dans Adumeau et al (Site-Specific Platform-Based Conjugation Strategy for the Synthesis of Dual-Labeled Immunoconjugates for Bi-modal PET/NIRF Imaging of HER2-Positive Tumors. Bioconjugate Chemistry, American ChemicalSociety, 2022, 33 (3), pp.530-540). WO2018172543A1 décrit un fragment Fab’ bifonctionnalisé via une plateforme tétrazine. La conjugaison est réalisée sur les cystéines de la région charnière, ce qui a pour inconvénient de causer des problèmes d’homogénéité et de reproductibilité. De plus, cette méthode requiert la présence d’une région charnière, qui n’est pas présente dans de nombreux fragments d’anticorps, tels qu’un fragment Fab, scFv, un fragment Fv, un diabody, un tribody, ou un tétrabody. Cette méthode est donc limitée à la conjugaison de fragments Fab’, avec une homogénéité et une reproductibilité limitée. Junutula JR et al ont testé la possibilité de remplacer certains résidus du fragment de chaine lourde ou légère du fragment Fab de l’anticorps Hu4D par une cystéine pour permettre une conjugaison site-spécifique (Junutula JR et al. Rapid identification of reactive cysteine residues for site-specific labeling of antibody-Fabs, Journal of Immunological Methods, Volume 332, Issues 1–2, 2008, Pages 41-52, https://doi.org/10.1016/j.jim.2007.12.011). La position sélectionnée dans la chaine lourde correspond au premier acide aminé de la partie constante, qui est la position 129 de la chaine lourde selon la nomenclature IMGT. Une telle position, située dans la région constante ne peut là encore être utilisée que pour les fragments d’anticorps comprenant une partie de la région constante, mais pas pour des fragments d’anticorps ne comprenant que les régions variables de l’anticorps, tels qu’un fragment scFv, un fragment Fv, un diabody, un tribody, ou un tétrabody. La méthode retenue est donc limitée aux fragments comprenant au moins une partie de la région constante. D’autres positions dans le domaine VH permettant une conjugaison site-spécifique ont été identifiées, mais il s’agit de positions peu conservées au sein des gène VH murins et humains et jouant un rôle crucial dans le bon repliement de la chaine lourde de l’anticorps (voir Exemple 1 ci-dessous), ce qui ne permet pas de les utiliser dans une méthode générale susceptible d’être appliquée à tout type d’anticorps initial et pour générer tout type de fragment d’anticorps comprenant un domaine VH. Enfin, ce document illustre à quel point il est difficile de prévoir l’effet de la mutation d’une position en cystéine sur la capacité de conjugaison, la réactivité des groupes thiols obtenus par mutation en cystéine de résidus très proches les uns des autres étant largement variable (voir Tableau 2 de Junutula JR et al). Il existe donc un besoin pour de nouvelles méthodes permettant d’obtenir facilement pour tout type de fragment d’anticorps des bioconjugués dont la stabilité et l’affinité pour l’antigène soient garanties par un greffage site-spécifique. Un tel besoin existe tout particulièrement pour les fragments Fab. Le rôle de l'axe endothéline dans le développement tumoral est largement décrit dans la littérature scientifique et répond à de nombreux processus pro-tumoraux. L'endothéline 1 agit comme un véritable facteur de croissance dans le développement tumoral, ce qui se traduit par des modifications de l'expression d'ETA, d'ETB et d'ET-1 dans différentes tumeurs comme le cancer du côlon, du sein, de l'ovaire, de la prostate, du rein, de la vessie, du poumon, de la sphère ORL, des gliomes ou encore du mélanome. Plus généralement, la stimulation du récepteur des endothélines de type A par l'endothéline 1 induirait la prolifération des tumeurs épithéliales. C'est par exemple le cas des cellules tumorales issues de cancer de l'ovaire, cervical, de la prostate ou encore du côlon. ETB est exprimé dans d'autres types tumoraux tels que dans le cancer de la peau et notamment dans le mélanome, le sarcome de Kaposi, le cancer du sein, de la vulve et certains gliomes. Dans ces différentes tumeurs ETB joue un rôle dans la progression et la prolifération tumorale. Lorsqu'un antagoniste de ce récepteur est utilisé, il y a alors une inhibition de la prolifération cellulaire. Dès lors, ces antagonistes semblent constituer des candidats de choix pour la thérapie de ces tumeurs. Différents essais cliniques d’antagonistes chimiques des Récepteurs des endothélines ont été ou sont conduits dans la prise en charge du cancer, notamment pour le cancer de la prostate (métastatique ou non), le cancer du poumon, le gliome, le carcinome à cellules rénales métastatique, le cancer de la vésicule biliaire, le mélanome métastatique, le cancer du pancréas, et le glioblastome. Ces antagonistes chimiques sont bien tolérés par l'organisme et présentent une biodistribution tout à fait classique. Cependant, ils ont démontré une efficacité clinique mitigée, pouvant souffrir de la présence en forte concentration du ligand endogène dans la tumeur. Afin de cibler les ETR et agir sur l'axe endothéline, suractivé au niveau tumoral, l'exploration d'autres alternatives thérapeutiques que les antagonistes ETR semble être plus judicieux. Les anticorps se liant spécifiquement à un récepteur aux endothélines (ETA ou ETB) sont donc des candidats d’intérêt, notamment sous la forme de conjugués avec soit une molécule thérapeutique (pour la thérapie), soit avec une molécule utile en imagerie (pour le diagnostic et l’aide à la résection tumorale chirurgicale). Cependant, les récepteurs aux endothélines appartiennent à la classe 1 ou famille A des Récepteurs Couplés aux Protéines G (RCPG ou GPCR). De ce fait, ils comprennent 7 domaines transmembranaires (TM). Couplés à des protéines G hétérotrimériques au niveau de l'extrémité carboxyle du GPCR, ils permettent la transduction du signal à l'intérieur de la cellule. Les domaines TM sont constitués d'hélices alpha reliées par des boucles intracellulaires (i1, i2 et i3) et extracellulaires (e1, e2 et e3). Il est également fréquent de retrouver 2 cystéines conservées entre les régions extracellulaires e1 et e2 (Figure 9). Les boucles extracellulaires e1, e2 et e3, auxquelles les anticorps se liant spécifiquement à ETA ou ETB se lient généralement, sont particulièrement courtes, avec une longueur de seulement 5 acides aminés (e1 de ETA et ETB), 20 ou 22 acides aminés (e2 de ETA et ETB, respectivement) et 6 acides aminés (e3 de ETA et ETB) (voir Figure 10). Cette caractéristique n’est pas partagée par de nombreux antigènes cancéreux, qui possèdent des domaines extracellulaires de taille beaucoup plus importante. C’est notamment le cas de HER-2 (aussi appelé ERBB2, son domaine extracellulaire correspond aux acides aminés 23- 652, soit 630 acides aminés, voir Uniprot P04626), TNFR1 (aussi appelé TNR1A ou TNFRSF1A, son domaine extracellulaire correspond aux acides aminés 30-211, soit 182 acides aminés, voir Uniprot P19438), CD40 (aussi appelé TNR5, son domaine extracellulaire correspond aux acides aminés 21-193, soit 172 acides aminés, voir Uniprot P25942), CEA6 (aussi appelé CEAM6 ou CEACAM6, son domaine extracellulaire correspond aux acides aminés 35-142, soit 108 acides aminés, voir Uniprot P40199), et GPIIb/IIIa (GPIIb est aussi appelé ITA2B ou ITGA2B, son domaine extracellulaire correspond aux acides aminés 32-993, soit 962 acides aminés, voir Uniprot P08514 ; GPIIIa est aussi appelé ITB3 ou ITGB3, son domaine extracellulaire correspond aux acides aminés 27-718, soit 692 acides aminés, voir Uniprot P05106). Du fait de la taille très courte des boucles extracellulaires (e1, e2 et e3), les contraintes de liaison à l’antigène sont fortes dans le cas des récepteurs A et B aux endothélines. Ces contraintes sont notamment illustrées par le fait que la fixation d’ET-1 à ETB conduit à des modifications allostériques du récepteur ETB (Shihoya, W., Nishizawa, T., Okuta, A. et al. Activation mechanism of endothelin ETB receptor by endothelin-1. Nature 537, 363–368 (2016)). Par conséquent, bien plus que pour d’autres antigènes, la personne du métier s’attendrait à ce que la moindre modification de structure d’un anticorps se liant spécifiquement à ETA ou ETB qui affecte sa conformation soit susceptible de conduire à l’abolition de la reconnaissance de l’antigène. Ceci est d’ailleurs illustré par le fait qu’une chimérisation simple (remplacement des régions constantes de souris par des régions constantes humaines) de l’anticorps RB49 a conduit à l’obtention d’un anticorps non fonctionnel ayant perdu la capacité à se lier au récepteur B aux endothélines (Marie Hautiere et al ., (2023) The functionality of a therapeutic antibody candidate restored by a single mutation from proline to threonine in the variable region, Human Vaccines & Immunotherapeutics, 19:3). Il existe toutefois un besoin pour des fragments d’anticorps capables de se lier à ETA ou ETB, en particulier après conjugaison avec une molécule thérapeutique (pour la thérapie) ou avec une molécule utile en imagerie (pour le diagnostic et l’aide à la résection tumorale chirurgicale). RESUME DE L'INVENTION L’invention répond à ce besoin. En effet, dans le contexte de l’invention, les inventeurs ont développé des fragments Fab mutants à partir d’anticorps se liant spécifiquement à ETA ou ETB, dans lesquels le résidu d’acide aminé en position 128 de la chaine lourde selon la nomenclature IMGT (c’est-à-dire le dernier acide aminé du domaine VH) est substitué par une cystéine, et montré que cette mutation n’altère pas l’affinité du Fab pour l’antigène, et permet le greffage site-spécifique (donc avec une bonne homogénéité et une bonne reproductibilité) : a) d’une plateforme tétrazine bi-fonctionnalisée, sans altération du point disulfure garantissant la stabilité du fragment Fab et sans altération de la liaison à l’antigène (voir Exemple 2 ci-dessous) ou b) d’un agent chélatant via un groupement maléimide (voir Exemple 3 ci-dessous). De plus, du fait que la mutation se trouve dans le domaine VH de la chaine lourde, elle peut être utilisée de manière large pour obtenir tout autre fragment d’anticorps possédant un domaine VH, sans nécessiter d’autre développement, rendant la méthode bien plus versatile que celles décrites dans l’art antérieur. Enfin, le dernier acide aminé du domaine VH est largement conservé aussi bien chez l’homme que chez la souris (voir Exemple 1), ce qui rend la mutation proposée utilisable chez un grand nombre d’anticorps. Selon un premier aspect, l’invention concerne donc un fragment d’anticorps mutant se liant à l’antigène comprenant un domaine variable de chaine lourde muté, le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde étant substitué par une cystéine, sous réserve que ledit fragment n’est pas un fragment Fab dont le fragment de chaine lourde muté correspond à la séquence d’acides aminés SEQ ID NO : 1 et le fragment de chaine légère correspond à la séquence d’acides aminés SEQ ID NO :2. Selon un deuxième aspect, l’invention concerne également une molécule d’acides nucléiques ou paire de molécules d’acides nucléiques codant pour le fragment d’anticorps mutant selon l’invention. Selon un troisième aspect, l’invention concerne également un vecteur comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention. Selon un quatrième aspect, l’invention concerne également une cellule hôte, un animal non- humain transgénique ou une plante transgénique comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention ou le vecteur selon l’invention. Selon un cinquième aspect, l’invention concerne également un conjugué comprenant le fragment d’anticorps mutant selon l’invention, lié à au moins une, notamment une ou deux, molécule d’intérêt, via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Selon un sixième aspect, l’invention concerne également un procédé de préparation d’un conjugué selon l’invention comprenant les étapes suivantes : a) réduction du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence de tris(2-carboxyéthyl)phosphine (TCEP), pour donner un fragment d’anticorps mutant réduit, b) réoxydation du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence d’acide déshydroascorbique, pour donner un fragment d’anticorps mutant partiellement réduit, c) conjugaison avec au moins une molécule d’intérêt de la fonction thiol de la cystéine en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant partiellement réduit pour donner un conjugué selon l’invention. Selon un septième aspect, l’invention concerne également un conjugué intermédiaire comprenant le fragment d’anticorps mutant selon l’invention, lié à un groupe chimique réactif, via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Selon un huitième aspect, l’invention concerne également un conjugué selon l’invention, pour son utilisation dans : a) une méthode de diagnostic d’une tumeur par imagerie, b) une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie nucléaire, c) une méthode de suivi par imagerie de l’efficacité d’un traitement antitumoral, ou d) toute combinaison des méthodes a), b) et c). DESCRIPTION DES FIGURES Figure 1 : La figure 1 représente les courbes de liaison à l’antigène sur les cellules CHO-ETA du fragment Fab non muté de l’anticorps xiRA63 et d’un conjugué obtenu par greffage aléatoire d’une tétrazine bifonctionnalisée par un agent chélatant du Zirconium-89 (DFO) et un fluorophore (IRDye800). Figure 2 : La figure 2 représente les courbes de liaison à l’antigène sur les cellules CHO-ETA du fragment Fab mutant avec une cystéine en position 128 de la chaine lourde selon la nomenclature IMGT de l’anticorps xiRA63 et d’un conjugué obtenu par greffage site- spécifique d’une tétrazine bifonctionnalisée par un agent chélatant du Zirconium-89 (DFO) et un fluorophore (IRDye800). Figure 3 : La figure 3 représente la validation par spectrométrie de masse MALDI-TOF de masse de la conjugaison du groupement DFO au fragment ThioFab-xiRA63 (ligne gris clair : ThioFab-xiRA63 natif, ligne gris foncé : ThioFab-xiRA63-DFO). Figure 4 : La figure 4 représente la validation de l’affinité du conjugué fragment ThioFab- xiRA63-DFO par cytométrie en flux. Comparaison de la courbe de liaison obtenue par cytométrie en flux entre le ThioFab-xiRA63 (orange) avec le ThioFab-xiRA63-DFO (bleu). Pour tester leur spécificité, les anticorps ont été testés sur CHO-ETA (trait plein) et CHO- WT (trait pointillé) non visible sur la figure. Les données sont présentées sous forme de moyenne ± SEM. Les comparaisons statistiques ont été effectuées avec le test t de Student bilatéral apparié (* p < 0,05, ** p < 0,01, **** p < 0,0001). MFI : Intensité Médiane de Fluorescence. Figure 5 : La figure 5 représente l’évaluation du radiomarquage du [89Zr]Zr-ThioFAb-xiRA63- DFO :(A.) Chromatogrammes HPLC-UV du ThioFab-xiRA63-DFO détectés à 280 nm avant et après radiomarquage au 89Zr avec un temps de rétention de 18 minutes pour le ThioFab- xiRA63-DFO. Le second pic après radiomarquage à 25 minutes correspond à l'acide gentisique. (B.) Chromatogramme HPLC-radio du [89Zr]-ThioFab-xiRA63. AU : unité arbitraire. Figure 6 : La figure 6 représente un récapitulatif de l’expérience in vivo: (A.) expériences et sacrifices d'animaux. 6 souris ont été implantée avec des cellules gli7 et 5 d’entre elles ont été injectées avec du [89Zr]Zr-ThioFab-xiRA63 (n=5). Une souris a été exclue de l'expérience et une autre souris n'avait pas de tumeur à l'IRM. À la fin, 4 souris avec une tumeur ont reçu une injection de [89Zr]Zr-ThioFab-xiRA63. Concernant l'analyse de la biodistribution, toutes les souris ont été utilisées, y compris celles sans tumeur. (B.) Tableau récapitulatif de l’injection du [89Zr]Zr-ThioFab-xiRA63 sur des souris porteuses d'une tumeur de glioblastome humain . Les données sont présentées sous forme de moyenne ± SD Figure 7 : La figure 7 représente la biodistribution du radioligand [89Zr]Zr-ThioFab-xiRA63 dans le temps sur un modèle de souris nude. Biodistribution [89Zr]Zr-ThioFab-xiRA63 extrapolée à partir de l'imagerie TEP à différents moments et dans des organes clés. (n=6 souris). Les données sont présentées en moyenne ± SD, N = 6 souris, %DI.cm-3 : pourcentage de dose injectée par volume de tissu. Figure 8 : La figure 8 représente une tumeur cérébrale imagée au cours du temps par TEP avec le radioligand [89Zr]Zr-ThioFab-xiRA63: (A.) Quantification de l’activité dans la tumeur obtenu avec l’anticorps [89Zr]Zr-ThioFab-xiRA63 à 1h, 5h, 24h, 48h, 72h, J7 p.i. (B.) Exemple d'une imagerie obtenue par TEP d’une des tumeurs cérébrales imagée avec le [89Zr]Zr- ThioFab-xiRA6348h p.i. avec les 3 vision (coupes transversales, axiales et coronales). DI.cm- 3 : pourcentage de dose injectée par volume de tissu. Figure 9 : Structure classique des RCPG (d’après Bockaert et al. Bull. Acad. Natle Méd., 2012, 196, no 9, 1765-1775). Récepteurs à 7 domaines TM liés par 3 boucles extracellulaires (e1, e2 et e3) et 3 boucles intracellulaires (i1, i2, i3). Le domaine N-terminal est localisé dans la région extracellulaire alors que le domaine C-terminal composé d'une 8ème hélice se situe du côté intracellulaire et peut entrer en interaction avec des protéines intracellulaires (GIPs pour « GPCR Interacting Proteins »). Figure 10 : Structure en 2 dimensions (2D) d'ETA et d'ETB humains obtenues par la GPCRdb. Figure 11 : Protocole du test de compétition. Les cellules ont été pré-incubées toute une nuit à 4°C en présence d'un excès molaire (500nM) de fragments d'anticorps Fab-xiRB49- P125T ou ThioFab-xiRB49-P125T. Par la suite, la gamme témoin d'anticorps xiRB49-P125T a été ajoutée à chaque point de cellule. Les gammes lues par cytométries en flux ont été révélées par l'anticorps secondaire polyclonal de chèvre anti-IgG-humain couplé à l'Alexa Fluor488 (1110120) ne ciblant que les région Fc des anticorps. Dans l'ensemble de cette expérience, trois lavages au PBS 1X (pH :7,4) ont été réalisés entre chaque étape pour éliminer le signal non spécifique. Figure 12 : Courbes de dénaturation thermique et températures d'inflexion Ta et T12 des anticorps xiRB49-P125T, Fab-xiRB49-P125T, et ThioFab-xiRB49-P125T. Figure 13 : Courbes de liaison obtenue en cytométrie en flux des anticorps Fab-xiRB49- P125T, et ThioFab-xiRB49-P125T permettant la détermination de leur Kd apparent et de leur Bmax. Figure 14 : Courbes de liaison obtenues par cytométrie en flux du test de compétition entre le xiRB49-P125T et le Thio-Fab-xiRB49-P125T ou le Fab-xiRB49-P125T. Figure 15 : Courbes de liaison obtenues par cytométrie en flux avec un anticorps secondaire anti-Fd. Schéma récapitulatif des anticorps secondaires reconnaissant les Fab-xiRB49-P125T et ThioFab-xiRB49-P125T. DESCRIPTION DETAILLEE DE L’INVENTION Définitions générales Par « un » ou « une », on entend un/une ou plusieurs. Autrement dit, lorsqu’on utilise « un » ou « une » vis-à-vis d’une caractéristique, on couvre à la fois les modes de réalisation avec une seule fois la caractéristique d’intérêt et ceux avec plusieurs fois la caractéristique d’intérêt. Par exemple, un fragment d’anticorps qui comprend un domaine variable de chaine lourde muté peut comprendre un seul domaine variable de chaine lourde muté (cas d’un fragment Fv ou scFv notamment) ou plusieurs domaines variables de chaine lourde mutés (cas d’un fragment Fab, d’un diaboby, tribody ou tetrabody notamment). Dans le présent document, lorsqu’ils sont utilisés pour définir des produits, des compositions et des méthodes, les termes « comprenant » (et toute forme de « comprenant », telle que « comprend » et « comprend »), « ayant » (et toute forme de « ayant », telle que « a » et « a »), « incluant » (et toute forme d’inclusion, telle que « inclut » et « inclut ») ou « contenant » (et toute forme de « contenant », telle que « contient » et « contient ») sont ouverts et n’excluent pas des éléments ou des étapes de méthode supplémentaires, non mentionnés. Ainsi, un polypeptide « comprend » une séquence d'acides aminés lorsque la séquence d'acides aminés fait partie de la séquence finale d'acides aminés du polypeptide. Un tel polypeptide peut avoir jusqu'à plusieurs centaines de résidus d'acides aminés supplémentaires. Par "consistant essentiellement en » ou « constitué essentiellement de », on entend l'exclusion d'autres composants ou étapes d'une quelconque importance essentielle. Ainsi, un polypeptide « consiste essentiellement en » une séquence d'acides aminés lorsqu'une telle séquence d'acides aminés est présente avec éventuellement seulement quelques résidus d'acides aminés supplémentaires (par exemple, un peptide d’au plus 20 acides aminés, tel qu’une étiquette de 6 histidines Hisx6, peut en outre être présent). "Consistant en » ou « constitué de » signifie excluant plus que des traces d'autres composants ou étapes. Par exemple, un polypeptide « consiste en » une séquence d'acides aminés lorsque le polypeptide ne contient pas d'autres acides aminés que la séquence d'acides aminés indiquée. Par « anticorps » ou « immunoglobuline » ou « Ig », on entend une molécule comprenant au moins un domaine de liaison à un antigène donné et un domaine constant comprenant un fragment Fc capable de se lier aux récepteurs FcR. Chez la plupart des mammifères, comme l’homme et la souris, un anticorps est composé de 4 chaînes polypeptidiques : 2 chaînes lourdes et 2 chaînes légères reliées entre elles par un nombre variable de ponts disulfures assurant une flexibilité à la molécule. Chaque chaîne légère est constituée d'un domaine constant (CL) et d'un domaine variable (VL); les chaînes lourdes étant composées d'un domaine variable (VH) et de 3 ou 4 domaines constants (CH1 à CH3 ou CH1 à CH4) selon l’isotype de l'anticorps. Chez quelques rares mammifères (les camélidés, notamment chameaux et les lamas) et chez les poissons cartilagineux (notamment les requins), les anticorps sont constitués de seulement deux chaines lourdes, chaque chaine lourde comprenant un domaine variable (VH) et une région constante. Les domaines variables sont impliqués dans la reconnaissance de l’antigène, tandis que les domaines constants sont impliqués dans les propriétés biologiques, pharmacocinétiques et effectrices, de l’anticorps. La région variable diffère d’un anticorps à un autre. En effet, les gènes codant pour les chaînes lourdes et légères des anticorps sont générés par recombinaison de respectivement trois et deux segments de gènes distincts appelés VH, DH et JH-CH pour la chaîne lourde et VL et JL-CL pour la chaîne légère. Les segments CH et CL ne participent pas à la recombinaison et forment les régions constantes des chaînes lourdes et légères respectivement. Les recombinaisons des segments VH-DH-JH et VL-JL forment les régions variables des chaînes lourdes et légères respectivement. Les régions VH et VL possèdent chacune 3 zones hyper variables ou régions déterminant la complémentarité (CDR), appelées CDR1, CDR2 et CDR3, la région CDR3 étant la plus variable, puisqu’elle se situe au niveau de la zone de recombinaison. Ces trois régions CDR, et particulièrement la région CDR3, se trouvent dans la partie de l’anticorps qui sera en contact avec l’antigène et sont donc très importantes pour la reconnaissance de l’antigène. Ainsi, les anticorps conservant les trois régions CDR et chacune des chaînes lourde et légère d’un anticorps conservent en grande majorité la spécificité antigénique de l’anticorps d’origine. Dans un certain nombre de cas, un anticorps ne conservant que l’un des CDR, et notamment le CDR3, conserve également la spécificité de l’anticorps d’origine. Les régions CDR1, CDR2 et CDR3 sont chacune précédées des régions FR1, FR2 et FR3 respectivement, correspondant aux régions charpentes (framework region FR) qui varient le moins d’un segment VH ou VL à un autre. La région CDR3 est également suivie d’une région charpente FR4. Les CDR d’un anticorps sont définis à partir de la séquence d’acides aminés de ses chaînes lourdes et légères par rapport à des critères connus de l’homme du métier. Différentes méthodes de détermination des CDR ont été proposées, et la portion de la séquence d’acides aminés d’une région variable de chaîne lourde ou légère d’un anticorps définiee comme un CDR varie en fonction de la méthode choisie. Une première méthode de détermination est celle proposée par Kabat et al (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Dans cette méthode, les CDR sont définis en recherchant les acides aminés responsables de la liaison à l’antigène de l’anticorps. Une 2ème méthode a été proposée par l’INTERNATIONAL IMMUNOGENETICS INFORMATION SYSTEM® (IMGT), fondée cette fois sur la détermination des régions hypervariables. Dans cette méthode, une numérotation unique a été définie pour comparer les régions variables quels que soient le récepteur à l’antigène, le type de chaîne ou l’espèce (Lefranc et al. 2003). Cette numérotation fournit une délimitation standardisée des régions charpentes ((FR1-IMGT : positions 1 à 26, FR2-IMGT : 39 à 55, FR3-IMGT : 66 à 104 et FR4-IMGT : 118 à 128) et des régions déterminant la complémentarité (CDR1-IMGT : positions 27 à 38, CDR2-IMGT : positions 56 à 65 et CDR3-IMGT : positions 105 à 117). Il existe encore d’autres méthodes de détermination, qui ne seront pas détaillées ici, mais sont connues de l’homme du métier. Un programme permettant de déterminer les CDRs à partir de la séquence d’acides aminés d’une chaine lourde ou légère d’anticorps selon différentes nomenclatures (notamment Kabat et IMGT) est l’outil «Annotate » d’abYsis disponible à l’adresse http://www.abysis.org/abysis/sequence_input/key_annotation/key_annotation.cgi. Pour une détermination des CDRs selon la nomenclature IMGT uniquement, l’outil « DomainGapAlign » de l’IMGT disponible à l’adresse https://www.imgt.org/3Dstructure- DB/cgi/DomainGapAlign.cgi décrit dans deux articles d’Ehrenmann F. et al (Ehrenmann F., Kaas Q. and Lefranc M.-P. Nucleic Acids Res., 38:D301-D307 (2010) ; Ehrenmann, F., Lefranc, M.-P. Cold Spring Harbor Protoc., 6:737-749 (2011)) peut aussi être utilisé. Contrairement aux régions variables dont la séquence varie fortement d’un anticorps à un autre, les régions constantes sont caractérisées par une séquence en acides aminés très proche d'un anticorps à l'autre, caractéristique de l'espèce et de l'isotype, avec éventuellement quelques mutations somatiques. La région constante de chaine lourde est composée de N en C-terminal d’un domaine CH1, d’une région charnière puis de des domaines CH2 et CH3 ou CH2 à CH4 (selon l’isotype). Le « fragment Fc » est naturellement composé de la région constante de la chaine lourde à l’exclusion du domaine CH1, c’est-à-dire de la région charnière inférieure et des domaines constants CH2 et CH3 ou CH2 à CH4 (selon l’isotype). Les positions des domaines CH1 à CH3 ou CH1 à CH4 et de la région charnière des différents isotypes d’anticorps de nombreuses espèces sont connues de l’homme du métier, et peuvent notamment être retrouvées sur le site de l’IMGT. Le fragment Fc est glycosylé au niveau du domaine CH2 avec la présence, sur chacune des 2 chaînes lourdes, d'un N-glycanne lié au résidu asparagine en position 297 (Asn 297). Les domaines de liaison suivants, situés dans le Fc, sont importants pour les propriétés biologiques de l’anticorps : - domaine de liaison au récepteur FcRn, impliqué dans les propriétés pharmacocinétiques (demi-vie in vivo) de l’anticorps : Différentes données suggèrent que certains résidus situés à l’interface des domaines CH2 et CH3 sont impliqués dans la liaison au récepteur FcRn. - domaine de liaison à la protéine du complément C1q, impliqué dans la réponse CDC (pour « cytotoxicité dépendante du complément ») : situé dans le domaine CH2; - domaine de liaison aux récepteurs FcR, impliqué dans les réponses de type phagocytose ou ADCC (pour « cytotoxicité cellulaire dépendante de l’anticorps) : situé dans le domaine CH2. La région constante de chaine légère (pour les anticorps possédant deux chaines lourdes et deux chaines légère) est composée d’un seul domaine appelé CL. Par « anticorps monoclonal » ou « composition d’anticorps monoclonal », on entend une composition comprenant des molécules d’anticorps possédant une spécificité antigénique identique et unique. Les molécules d’anticorps présentes dans la composition sont susceptibles de varier au niveau de leurs modifications post-traductionnelles, et notamment au niveau de leurs structures de glycosylation ou de leur point isoélectrique, mais ont toutes été codées par les mêmes séquences de chaines lourde et légère et ont donc, avant toute modification post-traductionnelle, la même séquence protéique. Certaines différences de séquences protéique, liées à des modifications post-traductionnelles (comme par exemple le clivage de la lysine C-terminale de la chaine lourde, la déamidation de résidus asparagine et/ou l’isomérisation de résidus aspartate), peuvent néanmoins exister entre les différentes molécules d’anticorps présentes dans la composition. Les anticorps peuvent être de plusieurs « isotypes », en fonction de la nature de leur région constante : les régions constantes γ, α, µ, ɛ et δ correspondent respectivement aux immunoglobulines IgG, IgA, IgM, IgE et IgD. Les régions constantes γ comprennent plusieurs sous-types : γ1, γ2, γ3, ces trois types de régions constantes présentant la particularité de fixer le complément humain, et γ4, créant ainsi les sous-isotypes IgG1, IgG2, IgG3, et IgG4. Par anticorps « chimérique », on entend désigner un anticorps qui contient une région variable (chaîne légère et chaîne lourde) naturelle dérivée d'un anticorps d'une espèce donnée en association avec les régions constantes de chaîne légère et chaîne lourde d'un anticorps d'une espèce hétérologue à ladite espèce donnée. Avantageusement, si la composition d’anticorps monoclonal pour son utilisation en tant que médicament selon l’invention comprend un anticorps monoclonal chimérique, celui-ci comprend des régions constantes humaines. Partant d’un anticorps non humain, un anticorps chimérique peut être préparé en utilisant les techniques de recombinaison génétique bien connues de l’homme du métier. Par exemple, l'anticorps chimérique pourra être réalisé en clonant pour la chaine lourde et la chaine légère un ADN recombinant comportant un promoteur et une séquence codant pour la région variable de l’anticorps non humain, et une séquence codant pour la région constante d'un anticorps humain. Pour les méthodes de préparation d'anticorps chimériques, on pourra par exemple se référer au document Verhoeyen et al (Verhoeyen et al. BioEssays, 8 : 74, 1988). Par anticorps « humanisé », on entend désigner un anticorps qui contient des régions CDRs dérivées d'un anticorps d'origine non humaine, les autres parties de la molécule d'anticorps étant dérivées d'un (ou de plusieurs) anticorps humains. En outre, certains des résidus des segments du squelette (dénommés FR) peuvent être modifiés pour conserver l'affinité de liaison (Jones et al. Nature, 321 : 522-525, 1986; Verhoeyen et al. Science, 239 : 1534-1536, Verhoeyen et al. BioEssays, 8 : 74, 1988 ; 1988; Riechmann et al. Nature, 332 : 323-327, 1988). Les anticorps humanisés selon l'invention peuvent être préparés par des techniques connues de l'homme de l'art telles les technologies de « CDR grafting », de « resurfacing », de SuperHumanisation, de « Human string content », de « FR libraries », de « Guided selection », de « FR shuffling » et de « Humaneering », comme résumé dans la revue de Almagro et al (Almagro et al. Frontiers in Bioscience 13, 1619-1633, January 1, 2008). Par anticorps « humain », on entend un anticorps qui ne contient que des séquences d’acide aminé d’origine humaine. Un anticorps humain reconnaissant un antigène donné peut être obtenu soit en immunisant un volontaire sain humain, soit par d’autres méthodes, telles que l’exposition sur phage (ou « phage display » en anglais, voir par exemple Hammers CM, Stanley JR. Antibody phage display: technique and applications. J Invest Dermatol. 2014 Feb;134(2):1-5. doi: 10.1038/jid.2013.521) ou l’immunisation de mammifères (notamment souris) chez lesquels les loci des gènes d’immunoglobulines natifs ont été délétés et les loci des gènes d’immunoglobulines humains ont été insérés (voir par exemple Brüggemann, M., Osborn, M.J., Ma, B. et al. Human Antibody Production in Transgenic Animals. Arch. Immunol. Ther. Exp. 63, 101–108 (2015). https://doi.org/10.1007/s00005-014-0322-x). Par « fragment d’anticorps se liant à l’antigène », on entend un fragment d’un anticorps conservant le domaine de liaison à l’antigène et ayant donc la même spécificité antigénique que l’anticorps d’origine. Des exemples de tels fragments d’anticorps se liant à l’antigène incluent : - pour les anticorps double chaines (issus de la plupart des mammifères, notamment la souris et l’homme) : les fragments Fv, scFv, Fab, F(ab’)2, Fab’, les dianticorps (généralement appelés « diabodies »), les trianticorps (généralement appelés « tribodies »), les tétraanticorps (généralement appelés « tetrabodies ») ; et - pour les fragments d’anticorps simple chaine (issus des camélidés ou poissons cartilagineux), les fragments VHH (domaine VH d’un anticorps de camélidé) ou VNAR (domaine VH d’un anticorps de poisson cartilagineux). Par « fragment Fv » ou « fragment variable », on entend un fragment d’anticorps formé des domaines VH et VL associés de manière non covalente. Par « fragment scFv » ou « scFv » ou « fragment variable simple chaine » ou « FV simple chaine », on entend un fragment formé par la fusion du domaine VH au domaine VL d’un anticorps via un peptide appelé « linker » constitué d’un nombre réduit d’acides aminés (généralement 15 à 20), soit sous le format VH-linker-VL soit sous le format VL-linker-VH. Les acides aminés du linker sont le plus souvent choisis parmi la glycine, la sérine, la thréonine, l’asparagine, l’alanine et la proline, la glycine et la sérine étant le plus souvent utilisés de manière majoritaire. Un format courant de scFv est de formule VH-linker-VL où le linker est de séquence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO :23). Un scFv possède généralement une masse molaire d’environ 25 kDa. Par « fragment Fab », on entend un fragment formé par l’assemblage de la partie de la chaine lourde située en amont du site de clivage à la papaïne (le domaine CH1 est inclus, mais la région charnière ni les autres domaines CH) et de la chaîne légère entière de l’anticorps d’intérêt. Les 2 chaines sont reliées par un pont disulfure comme dans les Ig entières. Les fragments Fab sont des monomères d’environ 50 kDa. Par « fragment Fab’ », on entend un fragment formé par l’assemblage de la partie de la chaine lourde située en amont du site de clivage à la pepsine (le domaine CH1 et la région charnière sont inclus, mais pas les autres domaines CH) et de la chaîne légère entière de l’anticorps d’intérêt. Par « fragment F(ab’)2 », on entend un fragment formé par l’appariement de 2 fragments Fab’ par des ponts disulfures au niveau des cystéines de la région charnière. Par « dianticorps » ou « diabody », on entend un dimère composé de deux fragments scFv. Les deux fragments scFv peuvent être identiques (le diabody possède alors une unique spécificité antigénique) ou différents (le diabody peut alors être bispécifique si les deux scFv reconnaissent des antigènes différents). Un diabody possède généralement une masse molaire d’environ 50 kDa (2 fois celle d’un scFv). Par « trianticorps » ou « tribody » ou « triabody », on entend un trimère composé de trois fragments scFv. Les trois fragments scFv peuvent être identiques (le tribody possède alors une unique spécificité antigénique) ou différents (le tribody peut alors être bi- ou tri- spécifique en fonction de la spécificité antigénique des trois scFv). Un tribody possède généralement une masse molaire d’environ 75 kDa (3 fois celle d’un scFv). Par « tétraanticorps » ou « tetrabody », on entend un quadrimère composé de quatre fragments scFv. Les quatre fragments scFv peuvent être identiques (le tetrabody possède alors une unique spécificité antigénique) ou différents (le tetrabody peut alors être bi-, tri- ou quadri-spécifique en fonction de la spécificité antigénique des quatre scFv). Un tetrabody possède généralement une masse molaire d’environ 100 kDa (4 fois celle d’un scFv). Par « minianticorps » ou « minibody », on entend un fragment formé par la fusion d’un scFv à un domaine qui tend à se dimériser, et notamment à un domaine CH3. Un minibody possède généralement une masse molaire d’environ 75 kDa. Par « nanobody » ou « anticorps simple domaine », on entend le domaine variable de la chaine lourde d’un anticorps simple chaine. Un nanobody peut notamment être un VHH ou un VNAR. Par « VHH », on entend le domaine variable de la chaine lourde d’un anticorps simple chaine de camélidé (notamment lama et alpaga). Par « VNAR », on entend e domaine variable de la chaine lourde d’un anticorps simple chaine de poisson cartilagineux (notamment requin). Un VHH ou un VNAR possède généralement une masse molaire d’environ 12 à 15 kDa. Un anticorps ou un fragment d’anticorps se « lie spécifiquement à » un antigène lorsqu’il se lie à cet antigène avec une affinité de liaison significativement supérieure (par exemple au moins 10 fois supérieure) à celle avec laquelle il se lie à d’autres antigènes. Il existe différentes techniques pour mesurer l’affinité d’un anticorps pour un antigène, bien connues de l’homme du métier. Par « antigène », on entend une substance qui, lorsqu’elle est administrée à un sujet, peut stimuler le système immunitaire et engendrer la production d’anticorps reconnaissant cette substance. En termes de composition, un antigène peut être un peptide ou une protéine, mais peut aussi être un acide nucléique, un lipide, un sucre… En termes d’origine, un antigène peut notamment être un antigène cancéreux, un antigène de microorganisme pathogène (par exemple d’un virus, d’une bactérie, d’un parasite), ou un antigène du soi. Par « antigène cancéreux », on entend un antigène exprimé à la surface d’une cellule cancéreuse. Cet antigène cancéreux est de préférence exprimé spécifiquement à la surface des cellules cancéreuses (par exemple du fait d’une mutation tumeur-spécifique), à l’exclusion des cellules saines du sujet, exprimé majoritairement à la surface des cellules cancéreuses (i.e. la majorité des cellules saines du sujet n’expriment pas l’antigène cancéreux), ou surexprimé à la surface des cellules cancéreuses (i.e. son niveau d’expression à la surface des cellules cancéreuses est significativement, par exemple au moins 2, au moins 5 ou au moins 10 fois, supérieur au niveau d’expression à la surface des cellules saines). De nombreux antigènes cancéreux sont connus dans l’art antérieur. Par « endothéline », on entend un neuropeptide sécrété par l'endothélium vasculaire, ayant un effet vasoconstricteur puissant sur les cellules musculaires lisses. Chez l’homme, il existe trois endothélines appelées ET-1, ET-2 et ET-3 composées de 21 acides aminés et comprenant deux ponts disulfures entre les cystéines 1 et 15 et 3 et 11. ET-1, ENT-2 et ET- 3 sont issues de trois précurseurs beaucoup plus gros : la préproendothéline 1,2 et 3 (polypeptides d'environ 200 acides aminés). Les « endothélines » ou « ET » constituent une famille de 3 peptides de 21 acides aminés, ET-1, ET-2 et ET-3, qui se lient à deux récepteurs distincts à 7 domaines transmembranaires : ETA (pour " Endothelin subtype A receptor", aussi appelé EDNRA, les informations concernant le gène humain codant pour ETA sont disponible sur la base de donnée Entrez Gene du NCBI sous le numéro d’accession Gene ID: 1909) et ETB (pour " Endothelin subtype B receptor", aussi appelé EDNRB, les informations concernant le gène humain codant pour ETB sont disponibles sur la base de donnée Entrez Gene du NCBI sous le numéro d’accession Gene ID: 1910), ces deux récepteurs appartenant à la famille des récepteurs couplés aux protéines G (GPCR). L'axe des endothélines (endothélines et leurs récepteurs) est fortement impliqué dans les processus physiologiques et pathologiques. L'ET-1 joue un rôle crucial dans la régulation de la motilité physiologique des muscles lisses, mais l'ET-1 est également impliqué dans une grande variété de pathologies, notamment l'hypertension, l'insuffisance cardiaque, les troubles rénaux et les maladies infectieuses. En outre, l'axe ET est surexprimé dans le cancer de différents organes contribuant à la croissance tumorale en agissant sur la prolifération cellulaire, la survie, la migration, la différenciation, l'angiogenèse et le recrutement de cellules inflammatoires. Les ETA sont upregulés dans les cancers de la prostate, de l'ovaire et du sein alors que les ETB sont surexprimés dérégulés dans les mélanomes, les cancers du poumon, du rein et de la vulve réf (Rosanò, L., Spinella, F., Bagnato, A., 2013. Endothelin 1 in cancer: biological implications and therapeutic opportunities. Nat Rev Cancer 13, 637–651). Par « antigène de microorganisme pathogène », on entend un antigène exprimé à la surface d’un microorganisme pathogène ou de cellules infectées par un microorganisme pathogène. Par « antigène du soi », on entend un antigène naturellement exprimé par certaines cellules saines d’un sujet. Il existe des mécanismes de tolérance au soi et le système immunitaire ne génère normalement pas d’anticorps se liant spécifiquement à un antigène du soi, mais il arrive que les mécanismes de contrôles soient insuffisants et qu’un sujet produise des anticorps contre un ou plusieurs antigènes du soi. On parle alors de maladie autoimmune. Les « pourcentages d’identité » auxquels il est fait référence dans le cadre de l’exposé de la présente invention sont déterminés sur la base d’un alignement global des séquences (nucléiques ou protéiques) à comparer, c’est-à-dire sur un alignement des séquences prises dans leur intégralité sur toute leur longueur en utilisant tout algorithme bien connu de l'homme du métier tel que l’algorithme de Needleman et Wunsch (Needleman et Wunsch. J.Mol. Biol. 48,443-453, 1970). Cette comparaison de séquences peut être effectuée à l'aide de tout logiciel bien connu de l'homme du métier, par exemple le logiciel needle en utilisant le paramètre « Gap open » égal à 10.0, le paramètre « Gap extend » égal à 0.5 et une matrice « Blosum 62 ». Le logiciel needle est par exemple disponible sur le site internet ebi.ac.uk world wide sous la dénomination « Align ». Par « acide aminé équivalent » à un autre acide aminé, on entend tout acide aminé dont la structure est proche de celle de l’acide aminé d’origine et est donc peu probable de modifier les activités biologiques de l’anticorps. Des exemples d’acides aminés équivalents sont présentés dans le Tableau 1 suivant : [Table 1] Acide aminé d’origine Substitution(s) Ala (A) Val, Gly, Pro Arg (R) Lys, His Asn (N) Gln Asp (D) Glu Cys (C) Ser Gln (Q) Asn Glu (G) Asp Gly (G) Ala His (H) Arg Ile (I) Leu Leu (L) Ile, Val, Met Lys (K) Arg Met (M) Leu Phe (F) Tyr Pro (P) Ala Ser (S) Thr, Cys Thr (T) Ser Trp (W) Tyr Tyr (Y) Phe, Trp Val (V) Leu, Ala Tableau 1. Substitutions par des acides aminés équivalents Par « molécule d’intérêt », on entend une molécule utile pour une application du conjugué selon l’invention, notamment dans le domaine du diagnostic ou des outils de recherche in vitro. De telles molécules d’intérêt incluent notamment les molécules détectables ou susceptible de devenir détectables, les molécules d’affinité (et les molécules pharmacomodulatrices. Par « molécule détectable ou susceptible de devenir détectable », on entend une molécule qui peut être détectée, directement (molécule détectable) ou indirectement après modification (molécule susceptible de devenir détectable), en utilisant des techniques d'imagerie médicale connues de l'homme du métier, notamment l’imagerie isotopique (tel que la tomographie par émission de positons (TEP ou PET pour le sigle anglais), la tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais) et l'imagerie par Cerenkov Luminescence (CLI)); l'imagerie optique ; l'imagerie par fluorescence. Ces différentes techniques d’imagerie médicale utilisent différents types de molécules détectables. L’« imagerie isotopique » ou « imagerie nucléaire » détecte des « radionucléides » ou « radioisotopes », c’est-à-dire des isotopes radioactifs d’un atome donné. Dans la tomographie par émission de positons (TEP ou PET pour le sigle anglais) et la tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais), les rayons gamma d’un radionucléide à émission directe ou indirecte de photons gamma sont détectés par des caméras gamma. En TEMP, les radionucléides utilisés émettent directement un rayon gamma lorsqu’ils se désintègrent, alors qu’en TEP, les radionucléides utilisés émettent un positon lors de leur désintégration, qui après annihilation avec un électron environnant, conduit à l’émission de 2 rayons gamma, ainsi obtenus de manière indirecte. Dans l'imagerie par Cerenkov Luminescence (CLI), le rayonnement Cerenkov (CR) est détecté avec des instruments d’imagerie optique (on est donc à la jonction de l’imagerie isotopique et de l’imagerie optique). Les radioisotopes peuvent être présents directement dans la sonde (molécule détectable), ou bien on peut aussi utiliser une sonde avec un agent chélatant (molécule susceptible de devenir détectable), qui est couplée juste avant administration avec un radiométal. Par « agent chélatant », on entend une substance qui possède la capacité de fixer des cations métalliques en constituant un complexe stable. Par « radiométal », on entend un isotope radioactif d’un atome de métal. L’imagerie optique peut détecter l’absorbance, notamment celle d’un chromophore. Par « chromophore », on entend un groupement d'atomes comportant une ou plusieurs doubles liaisons, et formant avec le reste de la molécule une séquence de doubles liaisons conjuguées, donnant ainsi sa couleur à la molécule le comprenant. L’imagerie optique peut également détecter le rayonnement Cerenkov (CR). L'imagerie par fluorescence détecte l’émission de fluorescence d’une sonde comprenant une molécule fluorescente ou fluorophore. Par « molécule fluorescente » ou « fluorophore », on entend une molécule qui émet de la lumière lorsqu'elle est exposée à la lumière ou à un autre rayonnement, la lumière émise ayant une longueur d'onde plus élevée que la lumière à laquelle la molécule a été exposée. De nombreux fluorophores sont des molécules comprenant plusieurs noyaux aromatiques conjugués ou des molécules planes et cycliques possédant une ou plusieurs liaisons π. Par « molécule d’affinité », on entend une molécule qui peut être liée de façon sélective et non covalente à un autre groupement chimique partenaire, formant ainsi un complexe. Par « molécule pharmacomodulatrice », on entend une molécule chimique, synthétique ou naturelle, permettant de modifier les propriétés pharmacocinétiques d’une autre molécule à laquelle elle est liée. Par « halogéno », on entend bromo, chloro, iodo, ou fluoro. Par « (C1-Cx)alkyle », on entend une chaîne hydrocarbonée saturée, linéaire ou ramifiée, comportant 1 à x atomes de carbone. Un groupe (C1-C6)alkyle est donc une chaîne hydrocarbonée saturée, linéaire ou ramifiée, comportant 1 à 6, de préférence 1 à 4, atomes de carbone. A titre d’exemple, on peut citer les groupes méthyle, éthyle, propyle, isopropyle, butyle, isobutyle, sec-butyle, tert-butyle, pentyle ou encore hexyle. Par « cycloalcane », on entend un monocycle ou polycycle hydrocarboné saturé comprenant un ou plusieurs, notamment 1 ou 2 cycles, les cycles pouvant être accolés (c’est-à-dire qu’ils partagent une liaison entre deux atomes de carbone) ou pontés (c’est-à-dire qu’ils partagent une séquence d’au moins trois atomes de carbone). De préférence, le cycloalcane comprendra 3 à 9 atomes de carbone. Il s’agira de préférence de cyclopropane, cyclohexane, cyclooctane, bicyclononane, norbonane. Par « hétérocycloalcane », on entend un cycloalcane dans lequel un ou plusieurs, notamment 1, 2, 3 ou 4, atomes de carbone ont été remplacés respectivement par un hétéroatome choisi parmi O, S et N, notamment O ou N. Il peut s’agir notamment de pipéridine, 1,2-pipérazine, 1,4-pipérazine, pyrrolidine, morpholine. Par « cycloalcène », on entend un monocycle ou polycycle hydrocarboné comprenant au moins une double liaison et comprenant un ou plusieurs, notamment 1 ou 2 cycles, les cycles pouvant être accolés (c’est-à-dire qu’ils partagent une liaison entre deux atomes de carbone) ou pontés (c’est-à-dire qu’ils partagent une séquence d’au moins trois atomes de carbone). De préférence, le cycloalcène comprendra 3 à 10 atomes de carbone. Il s’agira de préférence de cyclopropène, cyclohexène, cyclooctène, bicyclononène, norbornène. Par « hétérocycloalcène », on entend un cycloalcène dans lequel un ou plusieurs, notamment 1, 2, 3 ou 4, atomes de carbone ont été remplacés respectivement par un hétéroatome choisi parmi O, S et N, notamment O ou N. Il peut s’agir notamment de 3- pyrroline, 1,2,3,6-tétrahydropyridazine. Par « cycloalcyne », on entend un monocycle ou polycycle hydrocarboné comprenant au moins une triple liaison et comprenant un ou plusieurs, notamment 1 ou 2 cycles, les cycles pouvant être accolés (c’est-à-dire qu’ils partagent une liaison entre deux atomes de carbone) ou pontés (c’est-à-dire qu’ils partagent une séquence d’au moins trois atomes de carbone). De préférence, le cycloalcyne comprendra 3 à 9 atomes de carbone. Il s’agira de préférence de cyclooctyne, bicyclononyne. Par « hétérocycloalcyne », on entend on entend un cycloalcyne dans lequel un ou plusieurs, notamment 1, 2, 3 ou 4, atomes de carbone ont été remplacés respectivement par un hétéroatome choisi parmi O, S et N, notamment O ou N. Il peut s’agir notamment d’azacyclooctyne. Par « cycle aromatique », on entend un monocycle ou polycycle hydrocarboné aromatique comprenant un ou plusieurs, notamment 1 ou 2 cycles accolés. Il comprendra avantageusement 6 à 14, notamment 6 à 10 atomes de carbone. Il peut s’agir d’un benzène ou d’un naphtalène. Lorsqu’un cycle aromatique est accolé avec un autre cycle, cela signifie que les deux cycles partagent une liaison entre deux atomes de carbone. Par « cycle hétéroaromatique », on entend un monocycle ou polycycle aromatique comprenant un ou plusieurs, notamment 1, 2 ou 3, cycles accolés, les atomes constituant le cycle ou les cycles comprenant un ou plusieurs, notamment 1, 2, 3 ou 4 hétéroatomes choisis parmi O, S et N, notamment O et N, les autres atomes constituant le ou les cycles étant des atomes de carbone. Le ou les cycles seront formés avantageusement de 5 à 15, notamment 5 à 10 atomes. De préférence, chaque cycle sera un cycle à 5 ou 6 chaînons. Il peut s’agir notamment de tétrazine, triazine, 1,2,3-triazole, pyridazine, thiophène, thiazole, thiadiazole, pyridine. Fragment d’anticorps mutant Dans un premier aspect, l’invention concerne un fragment d’anticorps mutant se liant à l’antigène comprenant un domaine variable de chaine lourde muté, le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde étant substitué par une cystéine, sous réserve que ledit fragment n’est pas un fragment Fab dont le fragment de chaine lourde muté correspond à la séquence d’acides aminés SEQ ID NO : 1 et le fragment de chaine légère correspond à la séquence d’acides aminés SEQ ID NO :2. Type de fragment L’invention couvre tout type de fragment d’anticorps mutant se liant à l’antigène et comprenant un domaine variable de chaine lourde muté tel que défini ici. Notamment, l’invention couvre à la fois un fragment : a) qui comprend en outre un domaine variable de chaine légère (issus d’anticorps possédant deux chaines lourdes et deux chaines légères) et b) qui ne comprend pas de domaine variable de chaine légère (issus d’anticorps simple chaine comprenant uniquement une chaine lourde). Les fragments qui comprennent en outre un domaine variable de chaine légère (issus d’anticorps possédant deux chaines lourdes et deux chaines légères) sont cependant préférés, car les séquences d’acides aminés des chaines lourdes et légères de nombreux anticorps possédant deux chaines lourdes et deux chaines légères contre de nombreux antigènes sont disponibles dans l’art antérieur et donc accessibles à l’homme du métier. Parmi les fragments qui comprennent en outre un domaine variable de chaine légère (issus d’anticorps possédant deux chaines lourdes et deux chaines légères), le fragment d’anticorps mutant selon l’invention peut être n’importe quel type de fragment possédant un domaine variable de chaine lourde (VH) muté et un domaine variable de chaine légère (VH), mais peut être avantageusement choisi parmi un fragment Fab, un fragment scFv, un fragment Fv, un diabody, un tribody, un tétrabody, et un minibody. En particulier, les fragments Fab, scFv et diabody sont préférés (notamment le fragment Fab), car ce sont ceux avec le poids moléculaire le plus bas, et donc les plus à même de traverser la barrière hématoencéphalique et avec une faible durée de vie in vivo adaptée au diagnostic. Parmi les fragments qui ne comprennent pas de domaine variable de chaine légère (issus d’anticorps simple chaine comprenant uniquement une chaine lourde), le fragment d’anticorps mutant selon l’invention peut notamment être un nanobody, avantageusement choisi parmi les fragments VHH et VNAR. La substitution du résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde par une cystéine vise à permettre une conjugaison sélective sur cette cystéine. En effet, les inventeurs ont montré que, sous réserve d’utiliser un procédé particulier, il est possible de réaliser une conjugaison spécifique sur cette cystéine dans un fragment Fab, sans toucher aux autres cystéines présentes dans ce fragment. Les fragments d’anticorps mutant selon l’invention sont destinés à être conjugués à des groupements utiles pour une utilisation in vivo (diagnostic notamment), en particulier chez l’homme. Par conséquent, le fragment d’anticorps mutant selon l’invention est avantageusement chimérique (s’il contient une partie de la région constante, comme un Fab, alors cette partie est humaine), humanisé ou humain. Pour une utilisation chez un animal non humain, on utilisera par analogie un fragment d’anticorps mutant selon l’invention (s’il contient une partie de la région constante, comme un Fab, alors cette partie est de l’espèce de l’animal chez qui le fragment est utilisé), modifié pour remplacer les régions charpentes des domaines variables par des régions de l’espèce de l’animal chez qui le fragment est utilisé, ou entièrement de l’espèce chez qui le fragment est utilisé. Antigène reconnu par le fragment d’anticorps mutant L’antigène reconnu par le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention importe peu, l’invention étant applicable quel que soit l’antigène auquel l’anticorps d’origine se lie spécifiquement. Cependant, les fragments d’anticorps mutant selon l’invention sont destinés à être conjugués à des groupements utiles pour une utilisation in vivo (diagnostic notamment), et l’antigène sera donc avantageusement choisi parmi des antigènes d’intérêt diagnostique. En particulier, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement à un antigène cancéreux, un antigène de microorganisme pathogène (notamment un antigène viral, bactérien ou parasitaire), ou un antigène du soi. Un fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se liant spécifiquement à un antigène cancéreux sera utile pour des utilisations in vivo dans le cadre du diagnostic, et éventuellement du traitement, de cancers, et est particulièrement préféré. Un fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention peut se lier spécifiquement à n’importe quel antigène cancéreux d’intérêt. Des antigènes cancéreux d’intérêt incluent notamment CD19, CD20, CD22, CD38, HER2, CEA, PD1, PD-L1, CTLA-4, B7-H3 (also known as CD276), EpCAM, Folate receptor alpha, BCMA, LAG-3, gp100, GD2, TROP-2, Nectin-4, CD79b, CCR4, PDGRFα, SLAMF7, EGFR, et le récepteur A ou le récepteur B aux endothélines. Le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention peut notamment se lier spécifiquement au récepteur A ou au récepteur B aux endothélines. Un fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se liant spécifiquement à un antigène de microorganisme pathogène sera utile pour des utilisations in vivo dans le cadre du diagnostic, et éventuellement du traitement, d’une infection par le microorganisme pathogène dont est issu l’antigène. Un fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se liant spécifiquement à un antigène du soi sera utile pour des utilisations in vivo dans le cadre du diagnostic, et éventuellement du traitement, d’une maladie autoimmune impliquant la production d’anticorps contre un antigène du soi. Anticorps préférés dont le fragment d’anticorps mutant est dérivé Les inventeurs ont démontré qu’il était possible de conjuguer spécifiquement un fragment Fab mutant dérivé d’un anticorps RA63 anti-récepteur A aux endothélines dont le résidu alanine en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde a été substitué par une cystéine. Comme expliqué dans l’Exemple 1 ci-dessous, le résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps possédant une région FR4 murine ou humaine est, sauf mutation somatique à cette position, une sérine (majorité des cas) ou une alanine. Le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention est donc avantageusement dérivé (par substitution du résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps par une cystéine) d’un fragment d’anticorps dont le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est une sérine ou une alanine. Le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention peut donc être dérivé (par substitution du résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps par une cystéine) d’un fragment d’anticorps dont le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est une sérine. Alternativement, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention peut donc être dérivé (par substitution du résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps par une cystéine) d’un fragment d’anticorps dont le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est une alanine. Dans ce cas, le fragment d’anticorps mutant selon l’invention peut être dérivé (par substitution du résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps par une cystéine) d’un fragment de l’anticorps RB49 ou RA63 ou d’un variant de ceux-ci, qui se lient spécifiquement au récepteur B aux endothélines. L’anticorps RB49 se lie spécifiquement au récepteur B aux endothélines et possède 6 CDRs définis selon la nomenclature IMGT comme : - chaine lourde : GYTFISYW (SEQ ID NO :3, CDR1-H), IDPDSGGT (SEQ ID NO :4, CDR2-H) et AREGDYAWFAY (SEQ ID NO :5, CDR3-H), et - chaine légère : QSIVHSNGNTY (SEQ ID NO :6, CDR1-L), KVS (SEQ ID NO :7, CDR2-L) et FQGSHVPWT (SEQ ID NO :8, CDR3-L). L’anticorps RA63 se lie spécifiquement au récepteur A aux endothélines et possède 6 CDRs définis selon la nomenclature IMGT comme : - chaîne lourde :GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) et VSSYYSGSFFAY (SEQ ID NO :11), et - chaîne légère : SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) et FQGSHLPLT (SEQ ID NO :14). Ainsi, dans un mode de réalisation préféré, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur B aux endothélines, et comprend (outre la substitution du résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde par une cystéine) : - un domaine variable de chaine lourde (VH) comprenant trois CDR de chaîne lourde CDR1- H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GYTFISYW (SEQ ID NO :3), IDPDSGGT (SEQ ID NO :4) et AREGDYAWFAY (SEQ ID NO :5) ou une séquence avec au moins 80% d’identité avec GYTFISYW (SEQ ID NO :3), IDPDSGGT (SEQ ID NO :4) ou AREGDYAWFAY (SEQ ID NO :5), et - un domaine variable de chaine légère (VL) comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives QSIVHSNGNTY (SEQ ID NO :6), KVS (SEQ ID NO :7) et FQGSHVPWT (SEQ ID NO :8) ou une séquence avec au moins 80% d’identité avec QSIVHSNGNTY (SEQ ID NO :6), KVS (SEQ ID NO :7) ou FQGSHVPWT (SEQ ID NO :8). Lorsqu’au moins un des 6 CDRs définis au paragraphe ci-dessus n’a pas 100% d’identité avec SEQ ID NO :3 à 8, le ou les acide(s) aminé(s) qui diffèrent de la séquence native sont de préférence substitués par un acide aminé équivalent, de façon à maintenir l’affinité pour l’antigène ETB. De manière encore plus préférée, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur B aux endothélines, et comprend en outre (en sus des CDRs indiqués ci-dessus qui correspondent à celui de l’anticorps RB49 ou à des variants de ceux-ci) : - un domaine VH possédant la séquence SEQ ID NO :15 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVPVSA) ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :15 telle que la séquence SEQ ID NO :27 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVTVSC), et - un domaine VL possédant la séquence SEQ ID NO :16 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIK) ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :16. Les séquences des domaines VH et VL les plus importants pour la liaison à l’antigène sont celles des 6 CDRs. Par conséquent, dans un mode de réalisation préféré, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur B aux endothélines, et comprend : - un domaine VH possédant une séquence ayant au moins 80% d’identité avec SEQ ID NO :15 et comprenant trois CDR de chaîne lourde CDR1-H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GYTFISYW (SEQ ID NO :3), IDPDSGGT (SEQ ID NO :4) et AREGDYAWFAY (SEQ ID NO :5) ; et - un domaine VL possédant une séquence ayant au moins 80% d’identité avec SEQ ID NO :16 comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives QSIVHSNGNTY (SEQ ID NO :6), KVS (SEQ ID NO :7) et FQGSHVPWT (SEQ ID NO :8). De manière particulièrement avantageuse, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur B aux endothélines, et comprend : - un domaine VH possédant la séquence SEQ ID NO :15 ou SEQ ID NO :27, et - un domaine VL possédant la séquence SEQ ID NO :16. Dans un autre mode de réalisation préféré, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur A aux endothélines, et comprend (outre la substitution du résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde par une cystéine) : - un domaine VH comprenant trois CDR de chaîne lourde CDR1-H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) et VSSYYSGSFFAY (SEQ ID NO :11) ou une séquence avec au moins 80% d’identité avec GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) ou VSSYYSGSFFAY (SEQ ID NO :11), et - un domaine VL comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) et FQGSHLPLT (SEQ ID NO :14) ou une séquence avec au moins 80% d’identité avec SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) ou FQGSHLPLT (SEQ ID NO :14). Lorsqu’au moins un des 6 CDRs définis au paragraphe ci-dessus n’a pas 100% d’identité avec SEQ ID NO :9 à 14, le ou les acide(s) aminé(s) qui diffèrent de la séquence native sont de préférence substitués par un acide aminé équivalent, de façon à maintenir l’affinité pour l’antigène ETA. De manière encore plus préférée, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur A aux endothélines, et comprend en outre (en sus des CDRs indiqués ci-dessus qui correspondent à celui de l’anticorps RA63 ou à des variants de ceux-ci) : - un domaine VH possédant la séquence SEQ ID NO :17 (EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTI SRDDSQNMVYLQMNNLKTEDTAMYYCVSSYYSGSFFAYWGQGTLVTVSA) ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :17 telle que la séquence SEQ ID NO :28 (EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTI SRDDSQNMVYLQMNNLKTEDTAMYYCVSSYYSGSFFAYWGQGTLVTVSC), et - un domaine VL possédant la séquence SEQ ID NO :18 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVYSNGKIYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG TDFTLKISRVEAEDLGVYYCFQGSHLPLTFGAGTKLELKR) ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :18. Les séquences des domaines VH et VL les plus importants pour la liaison à l’antigène sont celles des 6 CDRs. Par conséquent, dans un mode de réalisation préféré, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur A aux endothélines, et comprend : - un domaine VH possédant une séquence ayant au moins 80% d’identité avec SEQ ID NO :17 et comprenant trois CDR de chaîne lourde CDR1-H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) et VSSYYSGSFFAY (SEQ ID NO :11) ; et - un domaine VL possédant une séquence ayant au moins 80% d’identité avec SEQ ID NO :18 comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) et FQGSHLPLT (SEQ ID NO :14). De manière particulièrement avantageuse, le fragment d’anticorps (notamment Fab, scFv ou diabody, en particulier Fab) mutant selon l’invention se lie spécifiquement au récepteur B aux endothélines, et comprend : - un domaine VH possédant la séquence SEQ ID NO :17 ou SEQ ID NO :28, et - un domaine VL possédant la séquence SEQ ID NO :18. Les anticorps RB49 et RA63 dont le fragment d’anticorps mutant selon l’invention est avantageusement dérivé sont des anticorps chimériques, et lorsque le fragment d’anticorps mutant selon l’invention contient une partie des régions constante (par exemple pour un fragment Fab), celle-ci est de préférence humaine. En particulier, le fragment d’anticorps mutant selon l’invention peut notamment être choisi parmi : a) un fragment Fab mutant se liant spécifiquement au récepteur B aux endothélines et comprenant un fragment de chaine lourde de séquence SEQ ID NO :19 (QVQLQQPGAALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATL TVDKSSSTAYMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVTVSCASTKGPSVFPLAPSSKSTSGGTA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVD KKVEPKSCDKTH) et une chaine légère de séquence SEQ ID NO :20 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNF YPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN RGEC) ; et b) un fragment Fab mutant se liant spécifiquement au récepteur A aux endothélines et comprenant un fragment de chaine lourde de séquence SEQ ID NO :21 (EVQLVESGGGLVQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTI SRDDSQNMVYLQMNNLKTEDTAMYYCVSSYYSGSFFAYWGQGTLVTVSCASTKGPSVFPLAPSSKSTSGGT AALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTH) et une chaine légère de séquence SEQ ID NO :22 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVYSNGKIYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG TDFTLKISRVEAEDLGVYYCFQGSHLPLTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYP REAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRG EC). De manière alternative, le fragment d’anticorps mutant selon l’invention peut notamment être choisi parmi. a) un fragment scFv se liant spécifiquement au récepteur B aux endothélines comprenant ou constitué de la séquence d’acides aminés SEQ ID NO :25 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGS GTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKGGGGSGGGGSGGGGSGGGGSQVQLQQPG AALVKPGASVKLSCKASGYTFISYWMLWVKQRPGRGLEWIGRIDPDSGGTKYNEKFKSKATLTVDKSSSTA YMQLSSLTSEDSAVYYCAREGDYAWFAYWGQGTLVTVSC) ; et b) un fragment scFv se liant spécifiquement au récepteur A aux endothélines comprenant ou constitué de la séquence d’acides aminés SEQ ID NO :26 (DVLMTQTPLSLPVSLGDQASISCRSSQSIVYSNGKIYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG TDFTLKISRVEAEDLGVYYCFQGSHLPLTFGAGTKLELKGGGGSGGGGSGGGGSGGGGSEVQLVESGGGL VQPKGSLKLSCAASGFTFNIYAMNWIRQAPGKGLEWIARIRSKSNNYATYYADSVKDRFTISRDDSQNMVYL QMNNLKTEDTAMYYCVSSYYSGSFFAYWGQGTLVTVSC). Fragments exclus Le fragment d’anticorps mutant selon l’invention n’est pas un fragment Fab dont le fragment de chaine lourde muté correspond à la séquence d’acides aminés SEQ ID NO : 1 et le fragment de chaine légère correspond à la séquence d’acides aminés SEQ ID NO :2. Un tel fragment Fab correspondrait au fragment Fab de l’anticorps Hu4D5 (anticorps humanisé se liant spécifiquement à HER2), dans lequel le résidu sérine en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est substitué par une cystéine. Un fragment d’anticorps mutant selon l’invention peut plus largement ne pas être un fragment d’anticorps dont le domaine variable de chaine lourde (VH) correspond à la séquence d’acides aminés SEQ ID NO :1. Cela exclut tous les fragments d’anticorps mutant dont le domaine VH correspond au domaine VH de l’anticorps Hu4D5 (anticorps humanisé se liant spécifiquement à HER2), dans lequel le résidu sérine en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est substitué par une cystéine (quelle que soit le type de fragment ou la séquence de la chaine légère éventuelle). Encore plus largement, un fragment d’anticorps mutant selon l’invention peut ne pas être un fragment d’un anticorps se liant à l’antigène HER2 humain. Alternativement, le fragment d’anticorps mutant selon l’invention n’est pas dérivé (par substitution du résidu en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde d’anticorps par une cystéine) d’un fragment d’anticorps dont le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde est une sérine. Molécule d’acides nucléiques ou paire de molécules d’acides nucléiques codant pour le fragment d’anticorps mutant selon l’invention La présente invention concerne également une molécule d’acides nucléiques ou paire de molécules d’acides nucléiques codant pour le fragment d’anticorps mutant selon l’invention. Une telle molécule ou paire de molécules est utile notamment pour produire le fragment d’anticorps mutant selon l’invention. Selon le fragment d’anticorps mutant désiré, celui-ci peut comprendre une seule chaine (par exemple, les fragments de type scFv, diabody, tribody, tetrabody, minibody, VHH, VNAR) ou deux chaines (par exemple, les fragments de type Fv, Fab, Fab’, F(ab’)2). Lorsque le fragment d’anticorps mutant selon l’invention comprend une seule chaine, une seule molécule d’acides nucléiques est de préférence utilisée pour coder cette chaine. Lorsque le fragment d’anticorps mutant selon l’invention comprend deux chaines, les deux chaines peuvent être codées soit par une seule molécule d’acides nucléiques soit par deux molécules d’acides nucléiques. Du fait de la dégénérescence du code génétique, toutes les séquences nucléiques différentes, codant pour une séquence d’acides aminés particulière d’un fragment d’anticorps mutant selon l’invention sont dans la portée de l’invention. En particulier, la séquence d’un acide nucléique selon l’invention peut avoir été optimisée pour favoriser son expression dans une cellule hôte, un animal non-humain transgénique ou une plante transgénique d’intérêt En effet, il existe en général plusieurs combinaisons de trois nucléotides codant le même acide-aminé (sauf pour la méthionine et le tryptophane), appelés codons synonymes. Cependant, certaines de ces combinaisons sont en général utilisées préférentiellement par une cellule ou un organisme donné (on parle alors de biais d’usage du code génétique). Cette préférence dépend notamment de l’organisme producteur ou dont est issue la cellule. Par conséquent, lorsqu’une protéine dérivée d’un ou plusieurs organismes est produite dans un organisme hétérologue ou dans une cellule d’un tel organisme hétérologue, il peut être utile de modifier la séquence nucléique codant pour la protéine de façon à utiliser principalement les codons préférés de l’organisme hétérologue. Des données sont disponibles dans la littérature concernant l’usage des codons préféré par différentes espèces et l’homme du métier sait comment optimiser l’expression d’une protéine donnée dans un organisme ou une cellule d’un organisme hétérologue. La ou les molécule(s) d’acides nucléiques codant pour le fragment d’anticorps mutant selon l’invention peut en outre comprendre une séquence nucléique codant un peptide signal en N-terminal de la ou des chaines du fragment d’anticorps mutant selon l’invention. Vecteur La présente invention concerne également un vecteur comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention, tel que décrit ci- dessus. Un tel vecteur est également utile pour produire le fragment d’anticorps mutant selon l’invention, celui-ci pouvant être utilisé pour transformer (de manière stable ou transitoire) une cellule hôte qui produira alors le fragment d’anticorps mutant selon l’invention. Un tel vecteur comprend les éléments nécessaires à l’expression de ladite séquence nucléique, et notamment un promoteur, un codon d’initiation de la transcription, des séquences de terminaison, et des séquences de régulation de la transcription appropriées. Ces éléments varient en fonction de l’hôte servant pour l’expression et sont choisis aisément par l’homme du métier au vu de ses connaissances générales. En particulier, pour un vecteur destiné à une expression dans des cellules eucaryotes, le vecteur comprend avantageusement une « séquence de Kozak », c’est-à-dire une séquence conservée que l'on trouve sur les ARN messagers eucaryotes au niveau du site de démarrage de la traduction, autour du codon de démarrage AUG (généralement GCCGCCRCCATGG (SEQ ID NO :24), le codon d’initiation de la traduction étant souligné, R=A ou G). Le vecteur peut notamment être plasmidique ou viral. Des exemples de vecteurs plasmidiques et viraux appropriés pour exprimer un fragment d’anticorps sont connus de l’homme du métier (voir notamment Sandomenico, A., Sivaccumar, J.P., Ruvo, M., 2020. Evolution of Escherichia coli Expression System in Producing Antibody Recombinant Fragments. International Journal of Molecular Sciences 21, 6324; Spadiut, O., Capone, S., Krainer, F., Glieder, A., Herwig, C., 2014. Microbials for the production of monoclonal antibodies and antibody fragments. Trends in Biotechnology 32, 54–60). Cellule hôte, animal non-humain transgénique ou plante transgénique La présente invention concerne également une cellule hôte, un animal non-humain transgénique ou une plante transgénique comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention ou le vecteur selon l’invention tel que décrit ci-dessus. Une telle cellule hôte, un tel animal non-humain transgénique et une telle plante transgénique sont également utiles pour produire le fragment d’anticorps mutant selon l’invention, ceux-ci exprimant le fragment d’anticorps mutant selon l’invention. La cellule hôte peut être d’origine procaryote ou eucaryote, et peut notamment être choisie parmi les cellules bactériennes, les cellules d’insecte, de plantes, de levure ou de mammifères. Le fragment d’anticorps mutant selon l’invention peut alors être produit en cultivant la cellule hôte dans des conditions appropriées. Une cellule hôte selon l’invention peut notamment être obtenue par transformation d’une lignée cellulaire par un vecteur selon l’invention et séparation des différents clones cellulaires obtenus. La lignée cellulaire transformée est de préférence d’origine eucaryote, et peut notamment être choisie parmi les cellules d’insecte, de plantes, de levure ou de mammifères. Des lignées cellulaires appropriées pour la production du fragment d’anticorps mutant selon l’invention incluent notamment Escherichia coli parmi les bactéries, Saccharomyces cerevisiae et Pichia pastoris parmi les levures, et les lignées cellulaires CHO, NS0, Sp2/0, HEK293, and PER.C6 parmi les cellules de mammifères. Un animal non-humain transgénique selon l’invention peut être obtenu par injection directe du ou des gène(s) d’intérêt (ici la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention) dans un œuf fertilisé (Gordon et al., 1980 Proc Natl Acad Sci U S A.;77:7380-4). Un animal non-humain transgénique peut également être obtenu par introduction du ou des gène(s) d’intérêt (ici la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention) dans une cellule souche embryonnaire et préparation de l’animal par une méthode d’agrégation de chimère ou une méthode d’injection de chimère (voir Manipulating the Mouse Embryo, A Laboratory Manual, Second edition, Cold Spring Harbor Laboratory Press (1994); Gene Targeting, A Practical Approach, IRL Press at Oxford University Press (1993)). Un animal non-humain transgénique peut également être obtenu par une technique de clonage dans laquelle un noyau, dans lequel le ou les gène(s) d’intérêt (ici la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon l’invention) a été introduit, est transplanté dans un œuf énucléé (Ryan et al, 1997 Science; 278: 873 – 876; Cibelli et al., 1998 Science, 280 : 1256-1258 ; WO00/26357). Le fragment d’anticorps mutant selon l’invention peut alors être accumulé dans l’animal transgénique et récolté, notamment à partir du lait ou des œufs de l’animal. Pour la production d’anticorps dans le lait d’animaux non humains transgéniques, des procédés de préparation sont notamment décrits dans WO90/04036, WO95/17085, WO01/26455, WO2004/050847, WO2005/033281, WO2007/048077. Des procédés de purification de protéines d’intérêt à partir du lait sont également connus (voir WO01/26455, WO2007/106078). Les animaux non humains transgéniques d’intérêt incluent notamment la souris, le lapin, le rat, la chèvre, les bovins (notamment la vache), et les volailles (notamment le poulet). Une plante transgénique selon l’invention peut être choisie parmi toute plante permettant la production de fragments d’anticorps. De nombreux anticorps ont déjà été produits dans des plantes transgéniques et les technologies nécessaires à l’obtention d’une plante transgénique exprimant un anticorps d’intérêt et à la récupération de l’anticorps sont bien connues de l’homme du métier (voir Stoger E, et al. Molecular Breeding 9: 149–158, 2002, Fisher R, et al. Vaccine 21 (2003) 820–825, Ma JK, et al. Nat Rev Genet. 2003 Oct;4(10):794- 805, Schillberg S, et al. Vaccine 23 (2005) 1764–1769). Conjugué L’invention concerne également un conjugué comprenant le fragment d’anticorps mutant selon l’invention, lié à au moins une, notamment une ou deux, molécules d’intérêt, avantageusement via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Molécule(s) d’intérêt conjuguées au fragment d’anticorps mutant selon l’invention Différents types de molécules d’intérêt sont susceptibles d’être conjuguées au fragment d’anticorps mutant selon l’invention, selon l’utilisation envisagée pour le conjugué. Le fragment d’anticorps mutant selon l’invention peut notamment être conjugué à une ou plusieurs molécules choisies parmi une molécule détectable ou susceptible de devenir détectable, une molécule d’affinité, et une molécule pharmacomodulatrice. Dans un mode de réalisation, le fragment d’anticorps mutant selon l’invention peut notamment être conjugué à une ou plusieurs molécule(s) détectable(s) ou susceptible(s) de devenir détectable(s), en particulier dans le cadre d’utilisations diagnostiques du conjugué. Le fragment d’anticorps mutant selon l’invention peut notamment être conjugué à une (conjugué destiné à être utilisé dans un seul type d’imagerie) ou deux (conjugué destiné à être utilisé dans plusieurs types d’imagerie détectant des phénomènes physiques différents portant deux molécules détectables ou susceptibles de devenir détectables de type différent, ou conjugué destiné à être utilisé dans un seul type d’imagerie porteur de deux exemplaires de la même molécule détectable ou susceptible de devenir détectable afin d’augmenter le signal) molécule(s) détectable(s) ou susceptible(s) de devenir détectable(s). Chaque molécule détectable ou susceptible de devenir détectable est choisie en fonction du type d’imagerie auquel le conjugué est destiné. Des exemples de molécules détectables ou susceptibles de devenir détectables susceptibles d’être conjuguées au fragment d’anticorps mutant selon l’invention sont : a) un radioisotope (molécule détectable), un agent chélatant (molécule susceptible de devenir détectable, qui devient détectable après mise en contact avec un radiométal), ou une molécule d’affinité (molécule susceptible de devenir détectable, qui devient détectable après mise en contact du fragment d’anticorps mutant conjugué à la molécule d’affinité avec un radioisotope conjugué à un partenaire de liaison de la molécule d’affinité, ou avec un agent chélatant conjugué à un partenaire de liaison de la molécule d’affinité puis un radiométal). De telles molécules détectables sont utiles tout d’abord lorsque le conjugué est destiné à être utilisé en imagerie isotopique. Le radioisotope peut être conjugué de manière covalente au fragment d’anticorps mutant selon l’invention, ou de manière non covalente par complexation avec un agent chélatant conjugué de manière covalente au fragment d’anticorps mutant selon l’invention. Les radioisotopes ou radiométaux émetteurs de façon directe (émission directe d’un photon gamma lors de la décomposition) ou indirecte (émission d’un positon lors de sa désintégration, qui après annihilation avec un électron environnant, conduit à l’émission de 2 rayons gamma) de rayons gamma sont préférés car ils sont détectables par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais). Une partie des radioisotopes utilisés en imagerie isotopique sont des radiométaux, généralement conjugués indirectement à la sonde utilisée (ici le fragment d’anticorps mutant selon l’invention), la sonde comprenant un agent chélatant qui fixe le radiométal. Des exemples d’agents chélatants incluent les agents chélatants linéaires ou cycliques, tels que le DOTA, le NOTA, la déféroxamine B, et leurs dérivés. Des dérivés préférentiels du DOTA et du NOTA sont par exemple respectivement le DOTAGA et le (R)-NODAGA. Des exemples de radiométaux émetteurs directs ou indirects (via l’émission d’un positon, qui après annihilation avec un électron environnant, conduit à l’émission de 2 rayons gamma) de rayons gamma incluent99mTc, 111In, 64Cu, 68Ga, 89Zr, et 44Sc.99mTc, 111In sont des émetteurs directs de rayons gamma détectables par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais), tandis que 64Cu, 68Ga, 89Zr, et 44Sc sont des émetteurs indirects de rayons gamma détectables tomographie par émission de positons (TEP ou PET pour le sigle anglais). L’utilisation d’un agent chélatant peut être avantageuse car elle permet notamment de pouvoir stocker le conjugué prêt à chélater et de n'y ajouter le radioisotope, qui peut avoir une demi vie très courte, seulement au dernier moment avant utilisation. Dans ce cas, la complexation peut être réalisée juste avant utilisation du conjugué de l'invention pour une application d'imagerie isotopique. Bien que la conjugaison à l’agent chélatant puisse être indirecte via une molécule d’affinité et son partenaire de liaison, le fragment d’anticorps mutant selon l’invention est avantageusement conjugué directement à un agent chélatant. Un autre radioisotope qui peut être utilisé en imagerie TEP est le 18F, qui est un émetteur de positons (et donc un émetteur indirect de photons gamma) et qui peut notamment être introduit sur des groupements dits prosthétiques, connus de l’homme du métier, qui peuvent être conjugués au fragment d’anticorps mutant selon l’invention. b) un fluorophore (molécule détectable) ou une molécule d’affinité (molécule susceptible de devenir détectable, le fluorophore est alors détecté après mise en contact du fragment d’anticorps mutant conjugué à la molécule d’affinité avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité). Les fluorophores sont utiles lorsque le conjugué est destiné à être utilisée en imagerie par fluorescence. Comme pour les radiométaux dans le cas des radioisotopes, le fluorophore peut être conjugué de manière covalente au fragment d’anticorps mutant selon l’invention, ou de manière non covalente lorsqu’il est préalablement conjugué à un partenaire de liaison de la molécule d’affinité qui vient se complexer avec la molécule d’affinité conjuguée de manière covalente au fragment d’anticorps mutant selon l’invention. Des exemples de fluorophores susceptibles d’être détectés en imagerie par fluorescence et donc d’être conjugués au fragment d’anticorps mutant selon l’invention incluent des composés de la famille des cyanines (notamment Cyanine3, Cyanine5, Cyanine5.5, Cyanine7, Cyanine7.5, porteuses ou non de groupements hydrosolubilisants, tels que des sulfones) ; des composés de la famille des xanthènes (notamment les composés de la famille des rhodamines tels que X-rhodamine, rhodamine B et les composés de la famille des fluorescéines, porteurs ou non de groupements hydrosolubilisants, tels que des sulfones); des composés de la famille des coumarines (notamment, hydroxycoumarine, aminocoumarine, méthoxycoumarine, porteuses ou non de groupements hydrosolubilisants, tels que des sulfones) ; et des composés de la famille des bore-dipyrrométhene (BODIPY, y compris les dérivés azaBODIPY). De préférence le fluorophore est sélectionné parmi la Cyanine5, la Cyanine 7, une rhodamine ou un azaBODIPY. Des exemples de couples (molécule d’affinité/partenaire de liaison) incluent (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine). c) un chromophore (molécule détectable) ou une molécule d’affinité (molécule susceptible de devenir détectable, le chromophore est alors détecté après mise en contact du fragment d’anticorps mutant conjugué à la biotine avec un chromophore conjugué à une molécule de streptavidine). Les chromophores sont utiles lorsque le conjugué est destiné à être utilisée en imagerie optique par mesure d’absorbance. Comme pour les radiométaux dans le cas des radioisotopes, le chromophore peut être conjugué de manière covalente au fragment d’anticorps mutant selon l’invention, ou de manière non covalente lorsqu’il est préalablement conjugué à un partenaire de liaison de la molécule d’affinité qui vient se complexer avec la molécule d’affinité conjuguée de manière covalente au fragment d’anticorps mutant selon l’invention Des exemples de chromophores susceptibles d’être conjugués au fragment d’anticorps mutant selon l’invention pour une utilisation en imagerie optique incluent la phénolphtaléine, le violet de gentiane ou le Congo Red. Des exemples de couples (molécule d’affinité/partenaire de liaison) incluent (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine). Ainsi, les molécules détectables ou susceptibles de devenir détectables peuvent être choisies parmi un fluorophore, un chromophore, une molécule d’affinité, un radioisotope et un agent chélatant. Lorsque le fragment d’anticorps mutant selon l’invention est conjugué à deux molécules détectables ou susceptibles d’être détectables, il peut notamment être conjugué à : 1) un radioisotope ou un agent chélatant pour utilisation en imagerie isotopique et un fluorophore ou une molécule d’affinité pour utilisation en imagerie par fluorescence ; 2) deux molécules détectables ou susceptibles d’être détectables de même type et de préférence identiques, pour augmenter le signal détecté. Dans ce mode de réalisation, la molécule détectable ou susceptible d’être détectable peut notamment être choisie parmi : a) les radioisotopes ou agents chélatants pour une utilisation en imagerie isotopique, ou b) les fluorophores ou les molécules d’affinité pour une utilisation en imagerie par fluorescence. Le fragment d’anticorps mutant selon l’invention peut en outre ou alternativement être conjugué à une molécule d’affinité. Un tel conjugué peut ensuite être complexé à une molécule détectable ou à une molécule susceptible d’être détectable (par exemple, un agent chélatant) capable de former un complexe avec la molécule d’affinité qui est conjuguée au fragment d’anticorps mutant selon l’invention. Des exemples de molécules d’affinité incluent une biotine (capable notamment de former un complexe avec une streptavidine préalablement conjuguée à un fluorophore, un chromophore, un radioisotope ou un agent chélatant), une avidine (capable notamment de former un complexe avec une biotine préalablement conjuguée à un fluorophore, un chromophore, un radioisotope ou un agent chélatant), et une streptavidine (capable notamment de former un complexe avec une biotine préalablement conjuguée à un fluorophore, un chromophore, un radioisotope ou un agent chélatant). La molécule d’affinité peut alternativement servir à purifier facilement le fragment d’anticorps mutant selon l’invention. Dans ce cas, outre les molécules d’affinité mentionnées au paragraphe précédent, on peut en outre utiliser un peptide hexa-histidine, permettant de facilement purifier le fragment sur une colonne comprenant du nickel (partenaire de liaison auquel le peptide hexa-histidine se complexe). La molécule d’affinité peut donc être choisie parmi la biotine, l'avidine, la streptavidine et un peptide hexa-histidine. Le fragment d’anticorps mutant selon l’invention peut en outre ou alternativement être conjugué à une molécule pharmacomodulatrice. Une telle conjugaison peut permettre d’améliorer la pharmacocinétique du fragment d’anticorps mutant selon l’invention. Des exemples de molécules pharmacomodulatrices incluent des chaînes linéaires ou ramifiées de poly(éthylène glycol), des chaînes linéaires ou ramifiées de poly(acide glutamique), le cholestérol, et des molécules capables de se lier à l’albumine (par exemple les acides gras, les ions métalliques, la bilirubine, une toxine, le groupement p-iodophenyl butyryl, le groupement biphenyl). Structure des conjugués Le conjugué selon l’invention est lié à au moins une, notamment une ou deux, molécules d’intérêt, avantageusement via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Selon un premier mode de réalisation, le conjugué est lié à deux molécules d’intérêt, avantageusement via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Avantageusement, au moins l’une de ces molécules est une molécule détectable ou susceptible de devenir détectable, et de préférence les deux molécules représentent chacune indépendamment une molécule détectable ou susceptible de devenir détectable, tel qu’un fluorophore, un chromophore, une molécule d’affinité, un radioisotope, ou un agent chélatant. Par exemple, l’une de ces molécules détectables pourra être un fluorophore et l’autre pourra être un radioisotope ou un agent chélatant. A titre d’exemple, une des molécules pourra être l’agent chélatant DOTA (permettant la chélation d’un radioisotope métallique comme le 68Ga) et l’autre une cyanine 7 tétrasulfonatée (fluorophore émettant dans le proche infrarouge). Un tel conjugué pourra répondre à la formule (I) suivante : dans laquelle : R1 représente un fragment d’anticorps mutant selon l’invention lié à X1 via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT ; avec X4 représentant une liaison simple, O, S, ou NR4, et R4 représentant H ou (C1-C6)alkyle, la liaison ondulée indiquant le point d’attachement à R1 et la liaision pointillée indiquant le point d’attachement à L1 ; L1, L2 et L3 représentent chacun indépendamment une liaison simple ou un espaceur, l’espaceur étant une chaîne (C1-C30)-alkyle, par exemple (C1-C20)-alkyle, éventuellement précédé et/ou interrompue et/ou suivie par un ou plusieurs motifs choisis dans le groupe constitué par les cycles aromatiques, hétéroaromatiques, cycloalcanes, cycloalcènes, hétérocycloalcanes, hétérocycloalcènes, -O-, -S-, -NR5-, -C(O)-, -C(S)-, -C≡C-, et - C(R6)=C(R7)-, avec R5 représentant H ou (C1-C6)alkyle, R6 et R7 représentant chacun indépendamment H ou (C1-C6)alkyle, et les cycles aromatiques, hétéroaromatiques, cycloalkyle, cycloalcényle, hétérocycloalkyle et hétérocycloalcényle étant éventuellement substitués par un ou plusieurs groupes (C1-C6)alkyle ; représente une liaison double ou une liaison simple, de préférence une liaison double ; le cycle A1 représente un cycle cycloalcane, cycloalcène, hétérocycloalcane ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy ; X2 et X3, identiques ou différents, représentent chacun O, S ou NR8, avec R8 représentant H ou (C1-C6)alkyle, de préférence H ; R2 et R3, identiques ou différents, de préférence différents, représentent chacun un résidu d’une molécule d’intérêt avantageusement choisie parmi les molécules détectables ou susceptibles de devenir détectable, les molécules d'affinité et les molécules pharmacomodulatrices. De préférence, X1 représente . De préférence, L1, L2 et L3 représentent chacun indépendamment un espaceur. Selon un premier mode de réalisation, l’espaceur est une chaîne (C1-C30)-alkyle, notamment (C1-C20)- alkyle, tel que (C1-C10)-alkyle ou (C1-C6)-alkyle, et en particulier un groupe éthyle ou hexyle (e.g. n-hexyle). Selon un deuxième mode de réalisation, l’espaceur est une chaîne PEG de formule –(CH2CH2O)x- ou –(CH2CH2O)x-CH2CH2- avec x un nombre entier de 1 à 12, notamment de 2 à 8 et en particulier 2, 4 ou 8. Selon un troisième mode de réalisation, l’espaceur est un groupe (C1-C30)-alkyle, notamment (C1-C20)-alkyle, tel que (C1-C10)-alkyle ou (C1-C6)- alkyle, précédée ou suivie par un groupe C(O) tel qu’un groupe propanoyle. De préférence, au moins l’un de X2 et X3 représente S. Avantageusement, X2 et X3 sont choisis indépendamment parmi S et NR8. De préférence, l’un de X2 et X3 est S et l’autre est S ou NR8. Avantageusement, R8 est H. , , , liaision pointillée indiquant le point d’attachement à L1 et les liaisons ondulées indiquant les points d’attachements aux atomes de carbone portant X2 ou X3. De préférence, au moins l’un de R2 et R3 est un résidu d’une molécule détectable ou susceptible de devenir détectable, et en particulier R2 et R3 représentent chacun indépendamment un résidu d’une molécule détectable ou susceptible de devenir détectable, avantageusement R2 et R3 représentent respectivement un résidu d’un fluorophore et un résidu d’un radioisotope ou d’un agent chélatant. Notamment, R2 et R3 peuvent représenter respectivement un résidu d’une Cyanine 7 sulfonatée et un résidu du R-NODAGA (agent chélatant). Selon un deuxième mode de réalisation, le conjugué est lié à une seule molécule d’intérêt qui est avantageusement une molécule détectable ou susceptible de devenir détectable, tel qu’un fluorophore, un chromophore, une molécule d’affinité, un radioisotope, ou un agent chélatant ; et ce avantageusement via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. Un tel conjugué pourra répondre à la formule (IIa) ou (IIb) suivante : R1-X1-L1-R2 (IIa) ou R1-X1-L1-X1’-L4-R2 (IIb) dans laquelle : R1 représente un fragment d’anticorps mutant selon l’invention lié à X1 via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT ; avec X4 représentant une liaison simple, O, S, ou NR4, et R4 représentant H ou (C1-C6)alkyle, la liaison ondulée indiquant le point d’attachement à R1 et la liaision pointillée indiquant le point d’attachement à L1 ; tel que défini ci-dessus et le cycle A2 représentant un cycle cycloalcène ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy, la liaison ondulée indiquant le point d’attachement à L4, et la liaision pointillée indiquant le point d’attachement à L1 ; L1 et L4 représentent chacun indépendamment une liaison simple ou un espaceur, l’espaceur étant une chaîne (C1-C30)-alkyle, par exemple (C1-C20)-alkyle, éventuellement précédé et/ou interrompue et/ou suivie par un ou plusieurs motifs choisis dans le groupe constitué par les cycles aromatiques, hétéroaromatiques, cycloalcanes, cycloalcènes, hétérocycloalcanes, hétérocycloalcènes, -O-, -S-, -NR5-, -C(O)-, -C(S)-, -C≡C-, et -C(R6)=C(R7)-, avec R5 représentant H ou (C1-C6)alkyle, R6 et R7 représentant chacun indépendamment H ou (C1- C6)alkyle, et les cycles aromatiques, hétéroaromatiques, cycloalkyle, cycloalcényle, hétérocycloalkyle et hétérocycloalcényle étant éventuellement substitués par un ou plusieurs groupes (C1-C6)alkyle ; R2 représente un résidu d’une molécule d’intérêt avantageusement choisie parmi les molécules détectables ou susceptibles de devenir détectables, les molécules d'affinité et les molécules pharmacomodulatrices. De préférence, X1 représente . De préférence, L1 et L4 représentent chacun indépendamment un espaceur. Selon un premier mode de réalisation, l’espaceur est une chaîne (C1-C30)-alkyle, notamment (C1-C20)-alkyle, tel que (C1-C10)-alkyle ou (C1-C6)-alkyle, et en particulier un groupe éthyle ou hexyle (e.g. n-hexyle). Selon un deuxième mode de réalisation, l’espaceur est une chaîne PEG de formule –(CH2CH2O)x- ou –(CH2CH2O)x-CH2CH2- avec x un nombre entier de 1 à 12, notamment de 2 à 8 et en particulier 2, 4 ou 8. Selon un troisième mode de réalisation, l’espaceur est un groupe (C1-C30)-alkyle, notamment (C1-C20)-alkyle, tel que (C1-C10)-alkyle ou (C1-C6)-alkyle, précédée ou suivie par un groupe C(O) tel qu’un groupe propanoyle. De préférence, X1' représente , la liaision pointillée indiquant le point d’attachement à L1 ou L4 et les liaisons ondulées indiquant les points d’attachements au motif N-N=N ou O-N=N. De préférence, R1 est un résidu d’une molécule détectable ou susceptible de devenir détectable, avantageusement choisie parmi un fluorophore, un chromophore, une molécule d’affinité, un radioisotope, et un agent chélatant, et notamment parmi un fluorophore, un radioisotope et un agent chélatant. Méthodes de conjugaison et intermédiaires de synthèse Lorsque le fragment d’anticorps mutant selon l’invention comprend un ou plusieurs ponts disulfures (notamment fragment Fab, minibody, scFv, diabody, tribody et tetrabody), les conjugués selon l’invention peuvent avantageusement être préparés par un procédé de préparation comprenant les étapes suivantes dans l’ordre indiqué : a) réduction du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence de tris(2-carboxyéthyl)phosphine (TCEP), pour donner un fragment d’anticorps mutant réduit, b) réoxydation du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence d’acide déshydroascorbique, pour donner un fragment d’anticorps mutant partiellement réduit, c) conjugaison avec au moins une molécule d’intérêt de la fonction thiol de la cystéine en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant partiellement réduit pour donner un conjugué selon l’invention. En effet, ce procédé comprenant des étapes a) et b) telles que décrites ici préalablement à l’étape c) de conjugaison permet une conjugaison extrêmement spécifique au niveau de la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. L’étape a) vise à réduire tous les ponts disulfures du fragment d’anticorps mutant, que ce soit les ponts disulfures reliant les chaînes lourdes du fragment d’anticorps mutant (encore appelés ponts disulfures inter-chaînes), que le pont disulfure formé avec la fonction thiol de la cystéine en position 128. L’étape b) vise à réoxyder uniquement les ponts disulfures inter-chaînes, de sorte à obtenir un fragment d’anticorps mutant partiellement réduit, c’est-à-dire dans lequel seul le thiol de la cystéine en position 128 est sous forme réduite. Ce thiol se trouve alors sous forme d’un groupe SH qui pourra servir de groupement chimique réactif pour venir conjuguer de manière covalente au moins une molécule d’intérêt. L’étape c) vise à conjuguer le au moins une molécule d’intérêt à la fonction SH de la cystéine en positon 128. Pour cela, le fragment d’anticorps mutant partiellement réduit obtenu à l’étape b) va être couplé avec une molécule portant, d’une part, au moins une molécule d’intérêt et, d’autre part, un groupe chimique capable de réagir avec une fonction thiol SH. Un tel groupe chimique capable de réagir avec une fonction SH peut être notamment , avec Hal représentant Br ou I et X4 représentant une liaison simple, O, S, ou NR4, R4 représentant H ou (C1-C6)alkyle. Le procédé décrit ci-dessus comprenant des étapes a) et b) telles que décrites ici préalablement à l’étape c) de conjugaison est également préféré pour les fragments d’anticorps notamment le fragments Fv, VHH, VNAR, car ces fragments sont souvent isolés sous la forme de dimères ou d’adduits au glutathion, cystéines, etc. Des étapes a) de réduction et b) de réoxydation avant conjugaison sont donc avantageusement aussi utilisées. Selon un premier mode de réalisation particulier de l’invention, le conjugué selon l’invention est un conjugué de formule (I) tel que défini ci-dessus et l’étape c) peut être réalisée par couplage entre le fragment d’anticorps mutant partiellement réduit (correspondant à la molécule R1H) et un composé de formule (III) suivante : pour lequel : L1 est tel que défini ci-dessus, le cycle A3 représente un cycle cycloalcyne, cycloalcène, hétérocycloalcyne ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy, et X1a représente un groupe chimique réactif vis-à-vis d’une fonction SH, pour donner un composé de formule (IV) suivante : X1 R1 (IV) pour lequel R1, X1, L1 et le cycle A3 sont tels que définis ci-dessus, suivi du couplage entre le composé de formule (IV) et un composé de formule (V) suivante : pour lequel R2, R3, L2, L3, X2 et X3 sont tels que définis ci-dessus.
De préférence, X1a, qui représente un groupe chimique réactif vis-à-vis d’une fonction SH, représentant une liaison simple, O, S, ou NR4, et R4 représentant H ou (C1-C6)alkyle. La réaction de X1a avec la fonction SH de la cystéine en position 128 permettra de former le groupe X1 et de lier le composé de formule (III) de manière covalente au fragment d’anticorps mutant partiellement réduit. De préférence, Une telle réaction entre la fonction SH d’une cystéine et un groupe chimique réactif vis-à-vis d’une fonction SH est bien connu dans l’art. Le cycle A3 porté par le composé de formule (IV) ainsi formé pourra servir ensuite à greffer deux molécules d’intérêt via la réaction de ce cycle A3 avec le groupement tétrazine du composé de formule (V) qui porte les deux molécules d’intérêt (R2 et R3). Cette réaction de couplage est bien connue de l’homme du métier et décrite notamment dans WO2018/172543. Le composé de formule (V) portant le groupe tétrazine peut également être préparé selon un procédé décrit dans WO2018/172543. Selon un deuxième mode de réalisation particulier de l’invention, le conjugué est un conjugué de formule (IIa) ou (IIb) telle que définie ci-dessus. L’étape c) impliquera avantageusement un couplage du fragment d’anticorps mutant partiellement réduit (R1H) avec un composé portant un groupe chimique réactif vis-à-vis d’une fonction SH (X1a). Un tel couplage faisant réagir une fonction thiol SH avec un groupe chimique réactif vis-à-vis d’une fonction SH (X1a) est bien connu dans l’art. Le groupe chimique X1a réactif vis-à-vis d’une fonction SH peut être greffé directement sur une molécule d’intérêt via un espaceur L1 ou non (lorsque L1 représente une liaison simple). Cela permet de préparer un conjugué de formule (IIa). Dans ce cas, l’étape c) peut être réalisée par couplage du fragment d’anticorps mutant partiellement réduit (R1H) avec un composé de formule X1a-L1-R2 dans lequel L1, X1a et R2 sont tels que définis ci-dessus. Au contraire, un groupe chimique réactif différent (G2) peut être greffé à la molécule d’intérêt via un espaceur L4 ou non (lorsque L4 représente une liaison simple). Dans ce cas, le fragment d’anticorps mutant partiellement réduit (R1H) est conjugué à la molécule d’intérêt (portant un groupant réactif G2) en utilisant un composé bifonctionnel portant : ^ à une extrémité un groupe chimique réactif vis-à-vis d’une fonction SH (X1a) pour pouvoir se coupler au fragment d’anticorps mutant partiellement réduit (R1H), et ^ à l’autre extrémité un groupe chimique G1 capable de réagir avec G2 de sorte à permettre le couplage avec la molécule d’intérêt. Cela permet de préparer un conjugué de formule (IIb). Selon un premier aspect, l’étape c) peut être réalisée par couplage du fragment d’anticorps mutant partiellement réduit (R1H) avec un composé de formule X1a-L1-X1’-L4-R2 respectivement dans lequel L1, X1’, X1a, L4 et R2 sont tels que définis ci-dessus. Le composé de formule X1a-L1-X1’-R2 peut alors être préparé par couplage entre un composé de formule X1a-L1-G1 et un composé de formule G2-L4-R2 dans lesquels X1a, L1, L4 et R2 sont tels que définis ci-dessus et G1 et G2 sont différents et représentent chacun un groupe chimique réactif capable de réagir ensemble pour former un groupe X1’. Les groupements chimiques G1 et G2 peuvent être choisis selon le Tableau 2 ci-dessous, le cycle A3 étant tel que défini ci-dessus et le cycle A4 représentant un cycle cycloalcyne ou hétérocycloalcyne éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy : [Table 2] 1er groupe réactif 2ème groupe réactif (G1 ou G2) (G1 ou G2) capable de réagir avec le 1er groupe réactif N3 A4 N+ O- A4 N N A3 N N Selon un deuxième aspect, l’étape c) peut être réalisée par couplage du fragment d’anticorps mutant partiellement réduit (R1H) avec un composé de formule X1a-L1-G1 dans lequel L1, G1 et X1a sont tels que définis ci-dessus, pour donner un conjugué de formule R1-X1-L1-G1, suivi du couplage entre le conjugué de formule R1-X1-L1-G1 et un composé de formule G2-R2 dans lequel G2 et R2 sont tels que définis ci-dessus. La présente invention a donc également pour objet des conjugués intermédiaires utiles comme intermédiaire de synthèse lors de la préparation des conjugués selon l’invention. La présente invention a ainsi également pour objet un conjugué intermédiaire comprenant le fragment d’anticorps mutant selon l’invention, lié, via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant, à un groupe chimique réactif. érence, le groupe chimique réactif est choisi parmi N , N+ - De préf 3 O , , , , les cycles A3 et A4 étant tels que définis ci-dessus. De préférence, le cycle A3 sera choisi parmi , , avantageusement choisi parmi 5
, Selon un mode de réalisation particulier, le conjugué intermédiaire selon l’invention répond à la formule R1-X1-L1-Z dans lequel R1, X1 et L1 sont tels que définis ci-dessus, et Z représente un groupe chimique réactif tel que défini ci-dessus. Utilisations du conjugué Selon la ou les molécule(s) conjuguée(s) au fragment d’anticorps mutant selon l’invention au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT, le conjugué selon l’invention pourra être utilisé dans différentes applications in vivo. Notamment, la présente invention concerne également le conjugué selon l’invention, pour son utilisation dans : a) une méthode de diagnostic d’une tumeur par imagerie, b) une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie isotopique, c) une méthode de suivi par imagerie de l’efficacité d’un traitement antitumoral, ou d) toute combinaison des méthodes a), b) et c) (telles que a) et b) ; a) et c) ; b) et c) ; ou a), b) et c)). Méthode de diagnostic d’une tumeur par imagerie L’invention concerne donc le conjugué selon l’invention, pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie. La présente invention concerne également l’utilisation d’un conjugué selon l’invention dans une méthode de diagnostic d’une tumeur par imagerie. La présente invention concerne également une méthode de détection de cellules tumorales chez un sujet par imagerie, comprenant : a) l’administration à un sujet suspecté de souffrir d’une tumeur dans un organe d’un conjugué selon l’invention dont le fragment d’anticorps se lie spécifiquement à un antigène de la tumeur suspectée, b) l’obtention par imagerie d’une ou plusieurs images de l’organe suspecté de comprendre une tumeur, et c) la détection de la présence ou de l’absence de cellules tumorales marquées par le conjugué dans la ou les image(s) obtenue(s) à l’étape b). La présente invention concerne également une méthode de détermination de la charge tumorale chez un patient souffrant d’une tumeur par imagerie, comprenant : a) l’administration au patient souffrant d’une tumeur d’un conjugué selon l’invention dont le fragment d’anticorps se lie spécifiquement à un antigène de la tumeur du patient, b) l’obtention par imagerie d’une ou plusieurs images d’un ou plusieurs organes du patient, et c) la détermination de la charge tumorale du patient à partir de la ou des image(s) obtenue(s) à l’étape b). Dans cette application, la ou le(s) molécule(s) conjuguée(s) au fragment d’anticorps mutant selon l’invention au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT est avantageusement choisie parmi les molécules détectables ou susceptibles de devenir détectables. La ou les molécule(s) détectable(s) ou susceptible(s) de devenir détectable(s) sera(seront) choisie(s) en fonction du ou des types d’imagerie envisagé(s). Pour une utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique, le fragment d’anticorps mutant selon l’invention est avantageusement conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à un radioisotope ou un agent chélatant (un complexe avec un radiométal est alors formé juste avant administration au patient). Notamment, pour la tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou la tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais), le fragment d’anticorps mutant selon l’invention est avantageusement conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à un radioisotope émetteur direct ou indirect de rayons gamma (notamment 18F) ou à un agent chélatant (un complexe avec un radiométal émetteur direct ou indirect de rayons gamma, notamment choisi parmi 99mTc, 111In, 64Cu, 68Ga, 89Zr, et 44Sc, est alors formé juste avant administration au patient). Pour l’imagerie par Cerenkov Luminescence (CLI), le fragment d’anticorps mutant selon l’invention est avantageusement conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à 90Y, 68Ga, 225Ac. Pour une utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique, le fragment d’anticorps mutant selon l’invention est avantageusement conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à un chromophore ou une molécule d’affinité (un complexe avec un chromophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), et (avidine/biotine), (streptavidine/biotine)). Pour une utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence, le fragment d’anticorps mutant selon l’invention est avantageusement conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à un fluorophore ou une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)). Le fragment d’anticorps mutant selon l’invention peut aussi être conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à deux molécules détectables ou susceptibles de devenir détectables différentes permettant son utilisation dans deux types d’imagerie différente. Par exemple, le fragment d’anticorps mutant selon l’invention peut être conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à deux molécules détectables ou susceptibles d’être détectables par des techniques d’imagerie différentes, et notamment à : a1) un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)) et un fluorophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence ; a2) un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)) et une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence ; b1) un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)) et un chromophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ; b2) un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)) et une molécule d’affinité (un complexe avec un chromophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ; c1) un fluorophore ou une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence et un chromophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ; ou c2) un fluorophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence et une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique. Parmi les conjugués avec deux molécules détectables ou susceptibles d’être détectables par des techniques d’imagerie différentes décrits ci-dessus, les conjugués a1 et b1) sont préférés. Alternativement, le fragment d’anticorps mutant selon l’invention peut être conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à deux molécules détectables ou susceptibles d’être détectables par la même technique d’imagerie (ceci permettant d’augmenter le signal et donc la sensibilité de détection), et notamment à : a) deux radioisotopes émetteurs direct ou indirect de rayons gamma (différents ou de préférence identiques) ou deux agents chélatants (différents ou de préférence identiques) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)), b) deux fluorophores (différents ou de préférence identiques) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence, c) deux chromophores (différents ou de préférence identiques) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique, ou d) deux molécules d’affinité (différentes ou de préférence identiques) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ou par fluorescence. Parmi les conjugués avec deux molécules détectables ou susceptibles d’être détectables par la même technique d’imagerie décrits ci-dessus, les conjugués a) (deux radioisotopes émetteurs direct ou indirect de rayons gamma (différents ou de préférence identiques) ou deux agents chélatants, différents ou de préférence identiques) et b) (deux fluorophores, différents ou de préférence identiques) sont préférés. Alternativement, le fragment d’anticorps mutant selon l’invention peut aussi être conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à une molécule détectable ou susceptible de devenir détectable et une molécule pharmacomodulatrice, celle-ci permettant de modifier les propriétés pharmacocinétiques du conjugué diagnostique. Dans ce mode de réalisation, le fragment d’anticorps mutant selon l’invention peut aussi être conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à : a) une molécule pharmacomodulatrice et un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie isotopique (notamment par tomographie par émission de positons (TEP ou PET pour le sigle anglais) ou par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais)) ; b) une molécule pharmacomodulatrice et un fluorophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie par fluorescence ; c) une molécule pharmacomodulatrice et un chromophore pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ; d) une molécule pharmacomodulatrice et une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de diagnostic d’une tumeur par imagerie optique ou par fluorescence. Parmi les conjugués avec une molécule détectable ou susceptible de devenir détectable et une molécule pharmacomodulatrice décrits ci-dessus, les conjugués a) (une molécule pharmacomodulatrice et un radioisotope émetteur direct ou indirect de rayons gamma ou un agent chélatant) et b) (une molécule pharmacomodulatrice et un fluorophore) sont préférés. Méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie nucléaire L’invention concerne également le conjugué selon l’invention, pour son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie isotopique. La présente invention concerne également une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie isotopique, comprenant : a) l’administration à un patient d’un conjugué selon l’invention dont le fragment d’anticorps se lie spécifiquement à un antigène de la tumeur du patient, b) l’obtention par imagerie en temps réel d’images de la tumeur marquée par le conjugué, et la résection chirurgicale de toute la tumeur à l’aide des images en temps réel obtenues. Dans cette application, le fragment d’anticorps mutant selon l’invention est conjugué au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT à : a1) un fluorophore pour son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ; a2) une molécule d’affinité (un complexe avec un fluorophore conjugué à un partenaire de liaison de la molécule d’affinité est alors formé avant administration au patient, le couple (molécule d’affinité/partenaire de liaison) étant avantageusement choisi parmi (biotine/avidine), (biotine/streptavidine), (avidine/biotine), et (streptavidine/biotine)) pour son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par imagerie par fluorescence ; b1) un agent chélatant (dans ce cas, un complexe avec un radiométal, émetteur direct ou indirect de rayons gamma, est formé juste avant administration au patient) pour son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par sonde d’imagerie isotopique, notamment par sonde d’imagerie par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais, le radiométal est alors un émetteur direct de rayons gamma, tels que 99mTc et 111In) ou par tomographie par émission de positons (TEP ou PET pour le sigle anglais, , le radiométal est alors un émetteur indirect de rayons gamma, tels que 64Cu, 68Ga, 89Zr, et 44Sc), avec une préférence pour une utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par sonde d’imagerie par tomographie par émission monophotonique (TEMP ou SPECT pour le sigle anglais, le radiométal est alors un émetteur direct de rayons gamma, tels que 99mTc et 111In) ; b2) un radioisotope émetteur direct ou indirect (par exemple 18F) de rayons gamma pour son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par sonde d’imagerie isotopique ; c1) une molécule définie en a1) et une molécule définie en b), permettant ainsi son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou par sonde d’imagerie isotopique ; ou c2) une molécule définie en a2) et une molécule définie en b), permettant ainsi son utilisation dans une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou par sonde d’imagerie isotopique . Dans cette méthode, les conjugués a1), b1) et c1) sont préférés. Méthode de suivi par imagerie de l’efficacité d’un traitement antitumoral L’invention concerne également le conjugué selon l’invention, pour son utilisation dans une méthode de suivi par imagerie de l’efficacité d’un traitement antitumoral. La présente invention concerne également une méthode de traitement d’un patient cancéreux, comprenant : a) la détermination de la charge tumorale du patient par la méthode de détermination de la charge tumorale selon l’invention avant ou concomitamment avec le début de l’administration du traitement antitumoral, b) l’administration du traitement antitumoral au patient, c) la détermination de la charge tumorale du patient par la méthode de détermination de la charge tumorale selon l’invention après le début de l’administration du traitement antitumoral, d) la comparaison des charges tumorales déterminées aux étapes a) et c), et e) l’administration au patient d’un traitement antitumoral, où : - si la charge tumorale déterminée à l’étape c) est inférieure ou également à celle déterminée à l’étape a), alors le traitement antitumoral administré à l’étape e) est le même qu’à l’étape b) ; - si la charge tumorale déterminée à l’étape c) est supérieure à celle déterminée à l’étape a), alors le traitement antitumoral administré à l’étape e) est différent de celui administré à l’étape b). Dans cette application, la ou le(s) molécule(s) conjuguée(s) au fragment d’anticorps mutant selon l’invention au niveau de la cystéine en position 128 de la chaine lourde selon la nomenclature IMGT est avantageusement choisie parmi les molécules détectables ou susceptibles de devenir détectables. La molécule détectable ou susceptible de devenir détectable sera choisie en fonction du ou des types d’imagerie envisagé(s), tel que décrit ci-dessus dans la section visant l’utilisation du conjugué selon l’invention dans une méthode de diagnostic d’une tumeur par imagerie. Pour déterminer l’efficacité d’un traitement antitumoral, le conjugué selon l’invention est avantageusement utilisé : a) avant ou concomitamment avec le début de l’administration du traitement antitumoral, et b) au moins une fois après le début de l’administration du traitement antitumoral, et la charge tumorale détectée après le début de l’administration du traitement antitumoral est comparée à celle détectée avant ou concomitamment avec le début de l’administration du traitement antitumoral. Si la charge tumorale a diminué ou reste stable après le début de l’administration du traitement antitumoral, alors le traitement antitumoral est considéré comme efficace. Si la charge tumorale a augmenté après le début de l’administration du traitement antitumoral, alors le traitement antitumoral est considéré comme non efficace. La présente invention est maintenant illustrée par des exemples ci-dessous. EXEMPLES Exemple 1 : Comparaison de la conservation des résidus aux positions 5, 24 et 128 de la chaine lourde selon la nomenclature IMGT Junutula JR et al ont montré pour un Fab Hu4D5 (Fab d’un anticorps humains anti-HER2) que la substitution des positions 5 et 23 de la chaine lourde (selon une numérotation séquentielle, chaque numéro de position correspondant au numéro de l’acide aminé dans la séquence d’acides aminés) par une cystéine permet une bonne réactivité du groupement thiol de la cystéine (voir Table 2 de Junutula JR et al. Rapid identification of reactive cysteine residues for site-specific labeling of antibody-Fabs, Journal of Immunological Methods, Volume 332, Issues 1–2, 2008, Pages 41-52, https://doi.org/10.1016/j.jim.2007.12.011). Ces positions correspondent aux positions 5 et 24 selon la nomenclature IMGT. Dans le Fab Hu4D5, les acides aminés aux positions 5 et 24 de la chaine lourde selon la nomenclature IMGT sont une valine (V) et une alanine (A) respectivement. La conservation des acides aminés présents dans les anticorps murins ou humains aux positions 5, 24, et 128 de la chaine lourde selon la nomenclature IMGT a été analysée. Matériels et méthodes La chaine lourde d’un anticorps est générée par recombinaison entre 3 segments de gènes appelés V, D et J. Les positions 5 et 24 de la chaine lourde selon la nomenclature IMGT sont situées dans le segment V. Par conséquent, pour analyser leur conservation au sein des anticorps murins et humain, les alignements des segments V murins, d’une part, et des segments V humains, d’autre part, ont été obtenus de la base de données IMGT. Au sein de ces alignements, les différents résidus présents en position 5 ou 24 de la chaine lourde selon la nomenclature IMGT ont été identifiés et leur fréquence (nombre d’occurrences / nombre de segments V) déterminée. La position 128 de la chaine lourde selon la nomenclature IMGT est située dans le segment J. Par conséquent, pour analyser sa conservation au sein des anticorps murins et humain, les alignements des segments J murins, d’une part, et des segments J humains, d’autre part, ont été obtenus de la base de données IMGT. Au sein de ces alignements, les différents résidus présents en position 128 de la chaine lourde selon la nomenclature IMGT ont été identifiés et leur fréquence (nombre d’occurrences / nombre de segments V) déterminée. Résultats Les résultats concernant la position 5 de la chaine lourde selon la nomenclature IMGT sont présentés dans la Table 3 ci-dessous, et montrent que cette position est peu conservée et varie significativement selon le segment V qui est utilisé dans le domaine VH. [Table 3] Segments V murins Segments V humains Acides aminés en position 5 Q (60%), V (17%), K (17%), L V (63%), Q (19%), I (6%), de la chaine lourde (IMGT) (2%), E (2%), P (0,7%), H L (5%), K (4%), G (1%), (0,4%), N (0,4%), D (0,4%) M R (1%), T (1%) (0,4%) Ainsi, un grand nombre d’acides aminés différents peuvent être présents à cette position, selon le segment V utilisé dans le domaine VH du fragment d’anticorps d’origine, dont certains ont des propriétés tout à fait différentes (par exemple, la valine V fait partie des acides aminés avec une chaine latérale non chargée légèrement hydrophobe, tandis que l’arginine R et la lysine K font partie des acides aminés à chaine latérale chargée positivement, et la glutamine Q et la thréonine T font partie des acides aminés à chaine latérale polaire non chargée). De plus, l’arginine R, la lysine K et la glutamine Q possèdent des chaines latérales significativement plus longues que la valine. Si le remplacement d’une valine (V) par une cystéine permet une bonne réactivité du thiol de la cystéine, il n’est pas clair que le remplacement d’une arginine R, d’une lysine K, d’une glutamine Q ou d’une thréonine T par une cystéine conduirait au même résultat. De plus, la position 5 de la chaine lourde selon la nomenclature IMGT n’est pas indiquée pour introduire une substitution car les positions 6 et 7 situées juste à côté sont connues pour jouer un rôle crucial dans le bon repliement de la chaine de l’anticorps. Introduire une cystéine C à cette position pourrait donc perturber le bon repliement de la chaine lourde (Honegger, A., Pluckthun, A., 2001. The Influence of the Buried Glutamine or Glutamate Residue in Position 6 on the Structure of Immunoglobulin Variable Domains. Journal of Molecular Biology 309, 687–699. https://doi.org/10.1006/jmbi.2001.4664; Jung S, Spinelli S, Schimmele B, Honegger A, Pugliese L, Cambillau C, et al. The Importance of Framework Residues H6, H7 and H10 in Antibody Heavy Chains: Experimental Evidence for a New Structural Subclassification of Antibody VH Domains. Journal of Molecular Biology 2001;309:701–16). Par conséquent, remplacer le résidu en position 5 par une cystéine, puis conjuguer celle-ci à un groupement chimique, pourrait générer une instabilité dans la conformation de la région variable. La position 5 de la chaine lourde selon la nomenclature IMGT n’est donc pas adaptée à une méthode générale de substitution de cette position par une cystéine pour permettre une conjugaison site-spécifique. Les résultats concernant la position 24 de la chaine lourde selon la nomenclature IMGT sont présentés dans la Table 4 ci-dessous, et montrent également que cette position est peu conservée et varie significativement selon le segment V qui est utilisé dans le domaine VH. [Table 4] Segments V murins Segments V humains Acides aminés en position 24 K (48%), A (16%), V (15%), S A (68%), K (22%), T (13% 6%), de la chaine lourde (IMGT) (8%), T (7,6%), E (1,8%), Q V (5%), S (1%) et leur fréquence (%) (1,3%), M (1,3%), P (0,4%), D (0,4%), I (0,4%) Ainsi, un certain nombre d’acides aminés distincts sont utilisés à cette position selon le segment V utilisé dans le domaine VH du fragment d’anticorps d’origine, dont certains ont des propriétés tout à fait différentes (par exemple, la valine V et l’alanine A font partie des acides aminés avec une chaine latérale non chargée légèrement hydrophobe, tandis que la lysine K fait partie des acides aminés à chaine latérale chargée positivement, et la thréonine T fait partie des acides aminés à chaine latérale polaire non chargée). De plus, la lysine K possède une chaine latérale significativement plus longue que l’alanine. Si le remplacement d’une alanine (A) par une cystéine permet une bonne réactivité du thiol de la cystéine, il n’est pas clair que le remplacement d’une lysine K ou d’une thréonine T par une cystéine conduirait au même résultat. De plus, la position 24 de la chaine lourde selon la nomenclature IMGT n’est pas indiquée pour introduire une substitution car elle joue un rôle crucial dans le bon repliement de la chaine de l’anticorps, étant située juste à côté de la cystéine en position 23 IMGT réalisant le pont S-S entre la position de la C23 et C104 (IMGT). Introduire une C à la position 24 pourrait donc perturber le bon repliement et la stabilisation de la chaine lourde. La proximité du CDR1-H (qui commence 3 acides aminés plus loin seulement) pourrait en outre perturber l’interaction avec l’antigène une fois la conjugaison du groupement chimique réalisée à cette position. La position 24 de la chaine lourde selon la nomenclature IMGT n’est donc pas adaptée à une méthode générale de substitution de cette position par une cystéine pour permettre une conjugaison site-spécifique. Enfin, les résultats concernant la position 128 de la chaine lourde selon la nomenclature IMGT sont présentés dans la Table 5 ci-dessous, et montrent au contraire que cette position est fortement conservée, un seul acide aminé (S) étant utilisé par tous les segments J humains, et seulement deux acides aminés distincts (S ou A), dont un commun à celui des segments J humains, étant utilisé par les segments J de souris. [Table 5] Segments V murins Segments V humains Acides aminés en position S (75% ), A (25% ) S (100%) 128 de la chaine lourde (IMGT) Ainsi, un seul acide aminé (S) est présent à la position 128 IMGT de la chaine lourde dans les segments J humains, et la majorité des acides aminés présents à la position 128 IMG de la chaine lourde dans les segments J murins sont également une sérine, le seul autre acide aminé utilisé à cette position est une alanine. De plus, la sérine et la valine ont en commun d’être des acides aminés avec une chaine latérale courte, et donc avec un encombrement stérique similaire, ce qui rend plausible que ce qui fonctionne en remplaçant une alanine en position 128 IMGT de la chaine lourde par une cystéine fonctionnera aussi en en remplaçant une sérine en position 128 IMGT de la chaine lourde par une cystéine. De plus, la position 128 IMGT de la chaine lourde correspond au dernier acide aminé du domaine VH et n’est donc pas impliquée dans la reconnaissance de l’antigène ou dans le repliement de la chaine lourde. Pour toutes ces raisons, la position 128 IMGT de la chaine lourde est donc beaucoup plus adaptée que les positions 5 et 24 IMGT de la chaine lourde à une méthode générale de substitution de cette position par une cystéine pour permettre une conjugaison site- spécifique. Conclusion En résumé, les positions 5 et 24 IMGT de la chaine lourde sont peu conservées et impliquées dans le repliement correct de la chaine lourde (la position 24 IMGT se trouve en outre à proximité du CDR1-H et également à proximité de la cystéine en position 23 et leur remplacement par une cystéine pourrait donc interférer avec le pont disulfure canonique entre les cystéines en position 23 et 104. Ces positions ne sont donc pas adaptées à une méthode générale de substitution de cette position par une cystéine pour permettre une conjugaison site-spécifique. Au contraire, la position 128 IMGT de la chaine lourde, dernier acide aminé avant la région constante, est fortement conservée et n’est impliquée ni dans la reconnaissance de l’antigène ni dans le repliement de la chaine lourde. Elle se prête donc particulièrement bien à une méthode générale de substitution de cette position par une cystéine pour permettre une conjugaison site-spécifique. De plus, sa position dans le domaine VH lui permet d’être utilisée quel que soit le type de fragment d’anticorps d’intérêt, pourvu qu’il comprenne un domaine VH. Ce n’est pas le cas de la position 129 IMGT identifiée dans Junutula JR et al. comme la meilleure position de la chaine lourde du Fab Hu4D5 pour une conjugaison site-spécifique (Junutula JR et al. Rapid identification of reactive cysteine residues for site-specific labeling of antibody-Fabs, Journal of Immunological Methods, Volume 332, Issues 1–2, 2008, Pages 41-52, https://doi.org/10.1016/j.jim.2007.12.011). Cette position est en effet le premier acide aminé de la région constante. Ainsi, aucun fragment sans région constante (par exemple un fragment scFv, un fragment Fv, un diabody, un tribody, ou un tétrabody) ne peut être conjugué en utilisant cette position. Exemple 2 : Préparation d’un Fab mutant de l’anticorps chimérique xiRA63 avec une cystéine en position 128 (nomenclature IMGT) de la chaine lourde et greffage aléatoire ou site-spécifique sur une tétrazine déjà bifonctionnalisée par un agent chélatant du Zirconium-89 (DFO) et un fluorophore (IRDye800) Matériels et méthodes Production du ThioFab-xiRA63 : Les chaînes lourdes et légères du Thiofab-xiRA63 ou du Fab-xiRA63 ont été clonées dans le vecteur d'expression eucaryote pTT5 (Durocher et al., 2002). Les plasmides ont été co- transfectés dans des cellules ExpiCHO-S (ThermoFisher) conformément aux instructions du fabricant "ExpiCHO™ Expression System User Guide" (MAN0014337 ThermoFisher Scientific). Jour 12 post-transfection, le surnageant a été clarifié par centrifugation à 4000-5000xg pendant 30 min à 4°C et filtré à travers un filtre de 0,22 pm. LeThioFab xiRA63 a été ensuite purifié par affinité sur une colonne HiTrap KappaSelect (GE Healthcare). Après l'élution, les solutions d'anticorps ont été dialysées avec la cassette de dialyse Slide-A-Lyzer™ G2 (Thermoscientific) avec un seuil de coupure de 10kDa dans 1 litre de PBS. Conjugaison du ThioFab-DFO-IRDye800 Le ThioFab xiRA63 porteur d’une cystéine est réduit en présence de 15 équivalents de TCEP (20mM, PBS) à 37°C pendant 1h. Après purification par ultrafiltration (Amicon 10kDa cut- off), 20 équivalents d’acide déshydroascorbique (dhAA, 50mM, tampon carbonate- bicarbonate pH 9) sont ajoutés et le milieu réactionnel est agité à 25°C pendant 1h afin de réoxyder spécifiquement les ponts disulfures. L’excès de dhAA est éliminé par ultrafiltration puis 20 équivalents de TCO-PEG3-maléimide (15 mM, DMSO) sont ajoutés avant d’agiter 2h à 25°C. La purification se fait ensuite par centrifugation. Finalement, 15 équivalents de DFO- Tz-IRDye800 (30mM, DMSO) sont ajoutés et la réaction de IEDDA se déroule sur la nuit à 25°C. Le ThioFab conjugué est alors purifié par chromatographie d’exclusion stérique (Superdex 7510/300 GL). Analyse du fragment [89Zr]-ThioFab-xiRA63-DFO par cytométrie en flux : Nous avons utilisé le protocole de Herbet et al., 2018 (Herbet A. et al. Antibodies Targeting Human Endothelin-1 Receptors Reveal Different Conformational States in Cancer Cells. Physiol. Res. 67 (Suppl. 1): S257-S264, 2018. https://doi.org/10.33549/physiolres.933848). Deux lignées cellulaires ont été utilisées pour évaluer l'affinité apparente des différents formats d’anticorps : Chinese Hamster Ovary Wild-Type (CHO-WT) et Chinese Hamster Ovary stablement transfectées avec un vecteur d’expression eucaryote codant pourETA humain (CHO-ETA). Les cellules ont été remises en suspension dans un tampon de saturation (PBS 1X, 5 % de sérum normal de chèvre, 0,1 % d'albumine de sérum bovin) et 3.105 cellules vivantes ont été ensemencées dans chaque tube. L'affinité apparente a été déterminée avec une gamme de dilution de 0,1 nM à 500 nM pour les fragments ThioFab-xiRA63, ThioFab- xiRA63-DFO-IRDye800 et Fab-xiRA63 et Fab-xiRA63-DFO-IRDye800. Les échantillons ont été incubés à 4°C pendant une nuit. Le lendemain, le système a été révélé par un anticorps secondaire Fd anti-IgG Humain de chèvre (CliniSciences 2046-02) conjugué à une molécule fluorescente, le FITC, dilué au 500eme et incubé pendant 4 heures à 4°C. Trois lavages au PBS des échantillons sont effectués entre chaque étape. La fluorescence de l'échantillon a été mesurée à une longueur d'onde de 488nm avec le cytomètre en flux FACSCalibur (BD Biosciences, San Jose, CA, USA) et exprimée en pourcentage de l'intensité de fluorescence moyenne par échantillon. La fonction "one site specific binding" sur GraphPad a été appliquée pour obtenir la courbe de liaison, le Bmax et le Kd apparent ±SEM. Résultats La Figure 1 présente des courbes de liaison à l’antigène comparant le fragment Fab non muté de l’anticorps xiRA63 et un conjugué obtenu par greffage aléatoire d’une tétrazine bifonctionnalisée par un agent chélatant du Zirconium-89 (DFO) et un fluorophore (IRDye800). La Figure 2 présente des courbes de liaison à l’antigène comparant le fragment Fab mutant avec une cystéine en position 128 (IMGT) de la chaine lourde selon la nomenclature IMGT de l’anticorps xiRA63 et d’un conjugué obtenu par greffage site-spécifique d’une tétrazine bifonctionnalisée par un agent chélatant du Zirconium-89 (DFO) et un fluorophore (IRDye800). Les Tables 6 et 7 ci-dessous présente en outre les valeurs de Bmax et Kd obtenues à partir des courbes. [Table 6] Fab non muté Conjugué aléatoire Bmax 70,39 28,43 Kd 1,811 2,9712 [Table 7] Fab mutant Conjugué site-spécifique Bmax 63,64 55,27 Kd 0,9418 0,4562 Alors que la conjugaison aléatoire du Fab non muté engendre une perte d’affinité et de reconnaissance de la cible (voir Figure 1 et Table 6), la conjugaison site spécifique du Fab mutant avec une cystéine en position 128 de la chaine lourde selon la nomenclature IMGT n’induit pas de changement significatif de liaison à l’antigène par rapport au Fab mutant natif (voir Figure 2 et Table 7). Conclusion Le conjugué site-spécifique obtenu à partir du Fab mutant avec une cystéine en position 128 de la chaine lourde selon la nomenclature IMGT présente de meilleures caractéristiques de conjugaison que le conjugué aléatoire obtenu à partir du Fab classique qui se retrouve extrêmement perturbé. Du fait de ses bien meilleures propriétés, l’utilisation en clinique du conjugué site-spécifique obtenu à partir du Fab mutant avec une cystéine en position 128 de la chaine lourde selon la nomenclature IMGT peut alors être envisagée. Exemple 3 : Préparation d’un Fab mutant de l’anticorps chimérique xiRA63 avec une cystéine en position 128 (nomenclature IMGT) de la chaine lourde, greffage, caractérisation in vitro et utilisation in vivo pour de l’imagerie dans un modèle de glioblastome Matériels et méthodes Production du ThioFab-xiRA63 : Les chaînes lourdes et légères du ThioFab-xiRA63 ont été clonées dans le vecteur d'expression eucaryote pTT5 (Durocher et al., 2002). Les plasmides ont été co-transfectés dans des cellules ExpiCHO-S (ThermoFisher) conformément aux instructions du fabricant "ExpiCHO™ Expression System User Guide" (MAN0014337 ThermoFisher Scientific). Jour 12 post-transfection, le surnageant a été clarifié par centrifugation à 4000-5000xg pendant 30 min à 4°C et filtré à travers un filtre de 0,22 pm. LeThioFab xiRA63 a été ensuite purifié par affinité sur une colonne HiTrap KappaSelect (GE Healthcare). Après l'élution, les solutions d'anticorps ont été dialysées avec la cassette de dialyse Slide-A-Lyzer™ G2 (Thermoscientific) avec un seuil de coupure de 10kDa dans 1 litre de PBS. Conjugaison du ThioFab-xiRA63-DFO : ThioFab-xiRA63 (500 µg, 459 µL à 1,1 g/L) a été réduit avec 30,8 µL de TCEP (20mM) à 37°C pendant 1 heure. Après purification à l'aide d'unités de filtres à centrifuger avec un seuil de poids moléculaire de 10 000 Da, la réoxydation de la liaison disulfure interchaîne native a été réalisée avec 6,75 µL d'acide déhydroascorbique (dhAA, 20 équiv., 50 mmol/L dans un tampon carbonate/bicarbonate pH 9) pendant 1 heure à 37°C. Après élimination de l'excès de dhAA avec des unités de filtration centrifugeables, 3,62 µL de déféroxamine-maléimide (10 équiv., 15 mmol/L dans du DMSO) ont été ajoutés au mélange réactionnel et agités à 37 °C pendant 2 heures. Le conjugué a ensuite été purifié par chromatographie d'exclusion stérique (Superdex 7510/300 GL) pour éliminer les dimères potentiels. La validation de la conjugaison du DFO sur le ThioFab-xiRA63 a été réalisée par spectrométrie de masse (MALDI- TOF). Radiomarquage du ThioFab-xiRA63-DFO avec du Zirconium 89 [89Zr]: Pour radiomarquer ce fragment d’anticorps avec du zirconium-89 (PerkinElmer), un protocole précédemment décrit de Vosjan et al., 2010 (Vosjan, M., Perk, L., Visser, G. et al. Conjugation and radiolabeling of monoclonal antibodies with zirconium-89 for PET imaging using the bifunctional chelate p-isothiocyanatobenzyl-desferrioxamine. Nat Protoc 5, 739–743 (2010). https://doi.org/10.1038/nprot.2010.13) a été utilisé. Le jour précédant l'injection 0,65 mg de ThioFab-xiRA63-DFO, pH ajusté à 7.2, a été incubé avec le radioélément 89Zr pendant 1 h à 37 °C avec une agitation de 300 tr/min. L'acide oxalique de la solution de 89Zr (274 µL, 11,17 mCi) a été neutralisé avec 90 µL de Na2CO3 (2 M) avant de les ajouter à la solution d’anticorps. Le [89Zr]Zr-ThioFab-xiRA63-DFO a ensuite été purifié sur une colonne PD-10 avec une solution d'acide gentisique (5 mg/mL dans de l'acétate de sodium 0.25 M, pH 5.5) comme phase mobile et concentrés avec des tubes d'ultrafiltration Vivaspin® (Satorius) avec un seuil de 10 kDa. Évaluation de la pureté radiochimique du fragment [89Zr]Zr-ThioFab-xiRA63-DFO par HPLC: La pureté radiochimique du radioligand a été vérifiée via chromatographie liquide haute performance (HPLC) par exclusion de taille, couplée à un détecteur UV (UVD 170U UV/VIS) et gamma à scintillation (Packard). Les mesures ont été effectuées sur une colonne analytique bioZen 1,8 µm SEC-2 LC (Phenomenex) couplée sur un système HPLC DIONEX (Thermo-Fisher). L’élution a été effectuée par un gradient linéaire avec une solution de KH2PO4 (50 mM) et de KCl (250 mM) (pH 6.8), à un débit de 0.2 mL/min. Analyse du fragment [89Zr]Zr-ThioFab-xiRA63-DFO par cytométrie en flux : Nous avons utilisé le protocole de Herbet et al., 2018 (Herbet A. et al. Antibodies Targeting Human Endothelin-1 Receptors Reveal Different Conformational States in Cancer Cells. Physiol. Res. 67 (Suppl. 1): S257-S264, 2018. https://doi.org/10.33549/physiolres.933848). Deux lignées cellulaires ont été utilisées pour évaluer l'affinité apparente des différents formats d’anticorps : Chinese Hamster Ovary Wild-Type (CHO-WT) et Chinese Hamster Ovary stablement transfectées avec l'ETA humain (CHO-ETA). Les cellules ont été remises en suspension dans un tampon de saturation (PBS 1X, 5 % de sérum normal de chèvre, 0,1 % d'albumine de sérum bovin) et 3.105 cellules vivantes ont été ensemencées dans chaque tube. L'affinité apparente a été déterminée avec une gamme de dilution de 0,01 nM à 50 nM pour les fragments ThioFab-xiRA63-DFO et ThioFab-xiRA63. Les échantillons ont été incubés à 4°C pendant une nuit. Le lendemain, le système a été révélé par un anticorps secondaire Fd anti-IgG Humain de chèvre (CliniSciences 2046-02) conjugué à une molécule fluorescente, le FITC, dilué au 500eme et incubé pendant 4 heures à 4°C. Trois lavages au PBS des échantillons sont effectués entre chaque étape. La fluorescence de l'échantillon a été mesurée à une longueur d'onde de 488nm avec le cytomètre en flux FACSCalibur (BD Biosciences, San Jose, CA, USA) et exprimée en pourcentage de l'intensité de fluorescence moyenne par échantillon. La fonction "one site specific binding" sur GraphPad a été appliquée pour obtenir la courbe de liaison, le Bmax et le Kd apparent ±SEM. Modèle préclinique : Toutes les expérimentations animales ont été réalisées conformément à la directive européenne 2010/63/UE et à sa transposition dans la loi française (décret n° 2013-118). Six souris nude, NMRI, femelles, âgées de quatre semaines (Janvier Labs) ont été implantées orthotopiquement avec 5.105 cellules de glioblastome (Gli7; ETA+), dans le striatum (à 2 mm à droite du bregma et à 2,5 mm de profondeur de la dure-mère) sous anesthésie à l’isoflurane associé à de la xylocaïne en local. Une seringue Hamilton de 10 µL a été utilisée avec un débit de 0.25 µL/min. Lors de l'injection, 0.05mg.kg-1 de buprénorphine a été administré en sous-cutané à chaque souris. Les souris ont été logées par quatre dans des cages ventilées avec une humidité de 40% et une pièce à température contrôlée à 22°C. Injection de l’anticorps : 78 jours après l'implantation des cellules de glioblastome (Herbet A. et al. Antibodies Targeting Human Endothelin-1 Receptors Reveal Different Conformational States in Cancer Cells. Physiol. Res. 67 (Suppl. 1): S257-S264, 2018. https://doi.org/10.33549/physiolres.933848), un total de 5 souris ont reçu un bolus intraveineux de [89Zr]Zr-ThioFab-xiRA63 (100 µC ± 5 µC). Acquisitions des images PET-CT : Nous avons réalisé une première acquisition dynamique de 60 minutes immédiatement après l'injection de l’anticorps à l'aide d'un scanner Inveon microPET ou d'un scanner Inveon microPET/CT (Siemens). Ensuite, une acquisition TEP de 20 minutes a été réalisée aux temps : 5h, 24h, 48h, 72h et 7 jours après l'injection. Les séances d'imagerie des souris ont été réalisées sous anesthésie. Analyse PET-CT : Nous avons utilisé le logiciel PMOD (Version 3.9) pour analyser les différentes acquisitions. Des volumes d'intérêts sphériques (VI) d'une taille fixe de 8mm3 ont été créés dans plusieurs organes : cœur, foie, reins, rate et muscle. Pour l'os et la tumeur cérébrale, les VI ont été tracées à l’aide de l’outil « iso-contour ». Nous avons appliqué les mêmes VI dans le côté controlatéral à la tumeur (utilisé comme contrôle négatif) que pour celle de la tumeur. L'activité volumique moyenne (kBq.cm-3) dans chaque VI a été corrigée en fonction de la demi-vie du 89Zr (t1/2=3.3 jours) en suivant la loi de décroissance de radioactive. Ensuite, pour quantifier l’anticorps, nous l'avons divisée par l'activité totale injectée pour obtenir le pourcentage de dose injectée par volume de tissu (%DI.cm-3). Statistiques : Le logiciel GraphPad Prism (v9.0.1) a été utilisé pour les analyses statistiques. Le test t de Student (bilatéral) a été effectué pour comparer deux groupes de données (* P < 0,05, ** P < 0,01, *** P < 0,001, **** P < 0,0001). Résultats Validation par spectrométrie de masse des anticorps DFO : Le ThioFab-xiRA63 a un m/z équivalent à 48631.5 Dalton alors que le ThioFab-xiRA63-DFO à un m/z de 49342.5 Dalton. La différence de 711 Dalton correspond parfaitement au poids moléculaire du DFO-maléimide (Figure 3). Validation par cytométrie en flux des anticorps DFO : Les ThioFab-xiRA63 avec et sans DFO montrent une haute affinité pour les récepteurs ETA humains (voir Figure 4), avec des constantes d'affinités apparentes similaires de l’ordre du nanomolaire (Kd) montrant que la conjugaison DFO sur le thiol supplémentaire libre ne modifie pas l’affinité de notre fragment pour sa cible (valeur p> 0,1). Leur spécificité a été testée avec les cellules contrôles négatives CHO-WT et contrôles positives CHO-ETA. Le signal obtenu sur CHO-WT est dans le bruit de fond soit inférieur à 2 % de la MFI obtenue avec la concentration de ThioFab xiRA63-DFO. Imagerie TEP Pour les expériences d’imagerie TEP, le ThioFab-xiRA63-DFO a été radiomarqué avec du Zirconium 89 [89Zr] selon la procédure préalablement publiée par Vosjan et al. (Vosjan, M., Perk, L., Visser, G. et al. Conjugation and radiolabeling of monoclonal antibodies with zirconium-89 for PET imaging using the bifunctional chelate p-isothiocyanatobenzyl- desferrioxamine. Nat Protoc 5, 739–743 (2010). https://doi.org/10.1038/nprot.2010.13). Leur pureté radiochimique a été évaluée par chromatographie liquide haute performance (HPLC) par exclusion de taille, et a été estimée à 100% (Figure 5). Modèle préclinique Une fois l’anticorps radiomarqué ([89Zr]Zr-ThioFab-xiRA63) validé, nous l’avons injecté (5,1 ± 0,13 MBq, 3,3 ± 0,1 nmol) dans des souris (n=5) préalablement xénogreffées de façon orthotopique avec des cellules tumorales de glioblastome nommées Gli7 exprimant ETA à leur membrane (ETA+, Herbet A. et al. Antibodies Targeting Human Endothelin-1 Receptors Reveal Different Conformational States in Cancer Cells. Physiol. Res. 67 (Suppl. 1): S257- S264, 2018. https://doi.org/10.33549/physiolres.933848) (Figure 6). Par la suite, les souris ont été imagées en corps entiers par microPET/CT à différents temps (pendant 1h après l’injection, puis à 5h, 24h, 48h, 72h, et 168h soit 7 jours p.i.) nous permettant ainsi d'étudier la distribution tissulaire (biodistribution) de notre immuno-traceur PET au cours du temps. Dans cette expérience (Figure 7), le [89Zr]Zr-ThioFab-xiRA63 (<60kDa) semble suivre une voie d'élimination rénale (70% ID.cm-3 d'accumulation dans le rein la première heure p.i.). En effet, les petites molécules sont rapidement éliminées de la circulation sanguine en raison de la filtration glomérulaire et de l'excrétion rénale. Notre traceur suit une des voies d'élimination classiques dû à son faible poids moléculaire, sans cibler des organes non spécifiques dans lesquels nous pourrions trouver du récepteur aux endothélines A murins (muscle, os, vessie, ovaires…). Concernant l’accumulation du [89Zr]Zr-ThioFab-xiRA63 dans les tumeurs cérébrales Gli 7 (Figure 8A), sa détection est visualisable dès 1h p.i. (~1%DI.cm-3). Du fait de son élimination plasmatique et sanguine rapide, son signal s’affaiblit rapidement et se retrouve proche de ~0,3%DI.cm-3 après 5 heures p.i.. Toutefois, cette rapide élimination nous permet un meilleur contraste pour visualiser la tumeur dû aux faibles signaux parasites et la quasi absence de bruit de fond (Figure 8B). Conclusion Nous avons démontré la fonctionnalité du fragment conjugué [Zr89]Zr-ThioFab-xiRA63-DFO in vivo. Ce dernier est bien capable de reconnaitre la tumeur cérébrale exprimant les récepteurs aux endothélines. Sa biodistribution est en outre conforme à un fragment Fab (mutant ou non) et aux molécules ayant un poids moléculaire inférieur à 60kDa, à savoir une élimination rapide par les reins. Exemple 4 : Préparation d’un thioFab (thioFab-xiRB49) de l’anticorps RB49 chimérisé (xiRB49) De manière inattendue, la chimérisation simple (substitution des régions constantes de souris par des régions constantes humaines) du RB49 a conduit à un anticorps chimérique non fonctionnel, incapable de se lier spécifiquement au récepteur ETB. Des études in silico ont mis en évidence que la présence d’une proline, inhabituelle, en position 125 de la région variable de la chaine lourde du RB49 pouvait induire un repliement de la région variable différent lors de sa chimérisation. Les CDR3 de la chaine lourde et légère entrent alors en contact prolongé, les rendant non disponibles pour une interaction avec l'antigène de ETB. Une mutation de la P125 par une thréonine canonique a permis de rétablir la fonctionnalité de l’anticorps chimérique (xiRB49) (Marie Hautiere et al ., (2023) The functionality of a therapeutic antibody candidate restored by a single mutation from proline to threonine in the variable region, Human Vaccines & Immunotherapeutics, 19:3). Ces résultats suggèrent que l’affinité de l’anticorps RB49 pour son antigène ETB peut être affectée par une unique mutation dans le domaine VH (partie FR4). Ils soulignent en effet la complexité structurelle de l’anticorps RB49, rendant ainsi l’effet de toute modification de celui-ci difficilement prévisible. Malgré une modification de la conformation de la région constante Kappa associée à la substitution de l’alanine en position 128 IMGT par une cystéine (A128C IMGT), il est démontré ici qu’un Fab de cet anticorps comprenant en outre une mutation de la cystéine en position 128 IMGT du domaine VH (thioFab-xiRB49) conserve son affinité pour son antigène ETB. Matériels et méthodes Production est purification de l’anticorps chimérique xiRB49-P125T, du Fab-xiRB49-P125T et du ThioFab-xiRB49-P125T Nous avons généré une version chimérique de RB49 appelée xiRB49. Les chaînes lourdes et légères codant pour IgG-xiRB49, le Fab-xiRB49-P125T et le ThioFab-xiRB49-P125T ont été sous-clonées dans le plasmide d'expression pTT5. Les vecteurs ont été co-transfectés dans des cellules ExpiCHO-S (ThermoFisher Scientific) avec le kit ExpiCHO Expression System (ThermoFisher Scientific) selon les instructions du fabricant (MAN0014337 ThermoFisher Scientific). Au jour 12 post-transfection, le surnageant a été clarifié par centrifugation à 4000-5000 × g pendant 30 min à 4 °C et filtré à travers un filtre de 0,22 μm. xiRA63 a été purifié sur une colonne HiTrap Protein A HP (GE HealthCare) et le Fab et ThioFab sur la HiTrap KappaSelect (GE HealthCare). Après élution, les solutions d'anticorps ont été dialysées avec la cassette de dialyse Slide-A-Lyzer™G2 (ThermoFisher Scientific) dans 1 L de solution saline tamponnée au phosphate (PBS).Etude de stabilité thermique Des échantillons à 1 mg⋅mL-1 ont été déposés dans les capillaires pour déterminer les courbes de température de dénaturation des anticorps (instrument Tycho NT6, NanoTemper). Le rapport A350 nm/ A330 nm a été calculé, et sa dérivée première nous a donné une température d'inflexion (Ti) correspondant au changement de conformation du domaine protéique de l'état natif à l'état dénaturé. Détermination des courbes de liaison des anticorps sur ETB avec un anticorps secondaire de chèvre polyclonal anti-Kappa-humain Les expériences de liaison ont été réalisées sur des cellules CHO exprimant ou non des récepteurs de l'endothéline. Les cellules ont été incubées pendant une nuit à 4°C avec les Fab-xiRB49-P125T ou ThioFab-xiRB49-P125T allant de 0,01 nM à 150 nM et détectés avec un anticorps secondaire polyclonal de chèvre anti-Kappa humain conjugué à l’Alexa Fluor 488 (A18854). Dans l'ensemble de cette expérience, trois lavages au PBS 1X (pH :7,4) ont été réalisés entre chaque étape pour éliminer le signal non spécifique. Test de compétition Les cellules ont été pré-incubées toute une nuit à 4°C en présence d'un excès molaire (500nM) de fragments d'anticorps Fab-xiRB49-P125T ou ThioFab-xiRB49-P125T. Par la suite, une gamme témoin d'anticorps xiRB49-P125T a été ajoutée pour chacune des conditions (voir Figure 11). Les gammes lues par cytométrie en flux ont été révélées par l'anticorps secondaire polyclonal de chèvre anti-IgG-humain couplé à l'Alexa Fluor488 (1110120) ne ciblant que les région Fc des anticorps. Dans l'ensemble de cette expérience, trois lavages au PBS 1X (pH :7,4) ont été réalisés entre chaque étape pour éliminer le signal non spécifique. Détermination des courbes de liaison des anticorps sur ETB avec un anticorps secondaire anti- Fd Les expériences de liaison ont été réalisées sur des cellules CHO exprimant ou non des récepteurs de l'endothéline. Les cellules ont été incubées pendant une nuit à 4°C avec les Fab-xiRB49-P125T ou ThioFab-xiRB49-P125T allant de 0,01 nM à 150 nM et détectés avec un anticorps secondaire polyclonal de chèvre anti-IgG Fd-humain conjugué au FITC (Southern Biotech™ 204602). Dans l'ensemble de cette expérience, trois lavages au PBS 1X (pH :7,4) ont été réalisés entre chaque étape pour éliminer le signal non spécifique. Résultats Paramètres physico-chimiques du ThioFab-xiRB49-P125T Après la construction des vecteurs nécessaires à sa production et sa purification, les propriétés physico-chimiques du ThioFab-xiRB49-P125T ont été déterminées. Le fragment ThioFab-xiRB49-P125T, comme le fragment ThioFab-xiRA63, présentait un poids moléculaire attendu de 50kDa avec une pureté tout à fait acceptable (> 95 %) évaluée par SDS PAGE. Le rayon hydrodynamique obtenu par DLS était d'environ 2,6 nm ± 0,1 nm et identique à celui de l'ensemble des Fabs obtenus (résultats non présentés). Nous avons étudié la stabilité thermique des anticorps et obtenu des courbes de dénaturation thermique (Tycho NT, Nanotemper). Dans la Figure 12 est présentée la dérivée première du ratio A350 nm/A330 nm des anticorps xiRB49-P125T, Fab-xiRB49-P125T et ThioFab-xiRB49- P125T, permettant l'obtention des températures d'inflexion (Ti). Les trois anticorps montrent une même Ti 2, reflétant le domaine Fab de l'ordre de 90°C. Après avoir confirmé les propriétés physico-chimiques des différents fragments, leur fonctionnalité a été évaluée. Etudes fonctionnelles des anticorps : première détermination des courbes de liaison des anticorps sur ETB La fonctionnalité des Fab-xiRB49-P125T et ThioFab-xiRB49-P125T a été évaluée en réalisant des courbes de liaison par cytométrie en flux sur des cellules CHO-ETB (Figure 13). Les résultats montrent que le Fab-xiRB49-P125T présente une forte affinité apparente de l'ordre du nanomolaire et un Bmax proche de 83% MFI (Figure 13). De manière surprenante, aucune courbe de liaison n'a été obtenue pour le ThioFab-xiRB49- P125T (Figure 13) alors que sa Ti2 indique que son domaine Fab semble être replié de la même manière que l'anticorps et le Fab correspondants suggérant que le ThioFab devrait être fonctionnel. L'hypothèse que le ThioFab-xiRB49-P125T n'était pas reconnu par l'anticorps secondaire a été émise. En effet, dans cette expérience de liaison, les Fab sont révélés par un anticorps secondaire de chèvre polyclonal anti-Kappa-humain-AlexaFluor 488 (ref A18854). Il est possible d'envisager que la cystéine ajoutée en fin de région variable, position A128C IMGT, ait pu modifier cette interaction nécessaire à sa détection. Validation fonctionnelle du ThioFab-xiRB49-P125T Afin de vérifier cette hypothèse, un test de compétition entre le xiRB49-P125T et le Fab- xiRB49-P125T ou le ThioFab-xiRB49-P125T a été élaboré (cf. Annexe-Partie matériel et méthode supplémentaire). Les cellules CHO-ETB ont été pré-incubées une nuit en présence de fragments Fab-xiRB49-P125T ou ThioFab-xiRB49-P125T à une concentration de 500 nM. Le lendemain et après lavage, le xiRB49-P125T est ajouté à des concentrations croissantes. Ainsi, 3 conditions sont testées (Figure 11) : 1. Une condition de référence (témoin positif) avec les cellules CHO -ETB pré-incubées en présence de PBS (véhicule) et donc sans déplacement de signal lors de l'ajout de xiRB49-P125T à différentes concentrations ; 2. Une condition de témoin de validité du test de compétition : le fragment Fab-xiRB49- P125T étant fonctionnel, il devrait interférer avec la fixation du xiRB49-P125T sur ETB. Ainsi, une plus forte concentration d'anticorps xiRB49-P125T sera nécessaire pour déplacer ce signal, ce qui aura pour conséquence la modification d'un Kd apparent. 3. Une condition test avec le fragment ThioFab-xiRB49-P125T. Si l'effet observé avec la condition Fab-xiRB49-P125T est similaire à celui obtenu avec le ThioFab-xiRB49-P125T alors cet anticorps est fonctionnel mais non reconnu par l'anticorps secondaire anti-Kappa- humain. La Figure 14 présente les résultats des courbes de liaison obtenues avec le test de compétition. Comme attendu, le Fab-xiRB49-P125T déplace bien le signal émis par le xiRB49- P125T avec une affinité apparente passant alors de 2,49 nM à 16,62 nM. De même, le ThioFab-xiRB49-P125T induit un déplacement équivalent du signal émis par le xiRB49-P125T avec un Kd apparent passant alors à 11,69 nM. Aucune différence significative n'est observée entre les deux conditions de compétition mettant en jeu le Fab-xiRB49-P125T et le ThioFab- xiRB49-P125T. Ce résultat prouve que l'anticorps ThioFAb-xiRB49-P125T est bien fonctionnel comme le suggérait sa courbe de dénaturation thermique et sa température d'inflexion Ti2. Indirectement, l'absence de reconnaissance du ThioFab-xiRB49-P125T par un anticorps secondaire anti-Kappa-Humain-polyclonal suggère fortement que l'ajout de la cystéine modifie malgré tout la conformation de la région constante Kappa. Un nouvel anticorps secondaire ciblant cette fois-ci la région Fd des anticorps (CH1+VH) a été utilisé pour valider la fonctionnalité du ThioFab-xiRB49-P125T. Dans ces conditions, la liaison à l’antigène ETB du ThioFAb-xiRB49-P125T est bien mise en évidence (Figure 15), avec un Kd apparent et un Bmax similaires au Fab-xiRB49-P125T. L'ensemble de ces résultats corroborent l'hypothèse selon laquelle la Cystéine en position 128 IMGT modifie la région Kappa dans le ThioFab-xiRB49-P125T, qui n'est alors plus reconnue par un anticorps secondaire anti-Kappa-Humain-polyclonal. Le ThioFab-xiRB49- P125T conserve cependant une capacité intacte de liaison à l’antigène ETB. Conclusion Malgré l’effet d’abolition de l’affinité pour l’antigène ETB liée à une simple chimérisation, une substitution de la proline en position 125 IMGT par une thréonine (P125T IMGT) a permis de restaurer l’affinité pour l’antigène ETB de l’anticorps chimérique (xiRB49-P125T) et d’un fragment Fab d’un tel anticorps chimérique (Fab-xiRB49-P125T). En outre, malgré une déstructuration partielle de la région Kappa (qui n'est alors plus reconnue par un anticorps secondaire polyclonal anti-Kappa-humain) associée à la substitution supplémentaire dans le Fab-xiRB49-P125T de l’alanine en position 128 IMGT par une cystéine (A128C IMGT), cette substitution n’affecte pas l’affinité pour l’antigène ETB du ThioFab-xiRB49-P125T. Etrangement, cette déstructuration de la région Kappa n'est pas retrouvé pour le ThioFab-xiRA63 suite à l'insertion de la C121 suggérant un phénomène propre aux régions variables du RB49.

Claims

REVENDICATIONS 1. Fragment d’anticorps mutant se liant spécifiquement au récepteur A ou au récepteur B aux endothélines comprenant un domaine variable de chaine lourde muté, le résidu d’acide aminé en position 128 selon la nomenclature IMGT du domaine variable de chaine lourde étant substitué par une cystéine, sous réserve que ledit fragment n’est pas un fragment Fab dont le fragment de chaine lourde muté correspond à la séquence d’acides aminés SEQ ID NO : 1 et le fragment de chaine légère correspond à la séquence d’acides aminés SEQ ID NO :2. 2. Fragment d’anticorps mutant selon la revendication 1, caractérisé en ce qu’il comprend en outre un domaine variable de chaine légère et est avantageusement choisi parmi un fragment Fab, un fragment scFv, un fragment Fv, un diabody, un tribody, un tétrabody, et un minibody ; ou 3. Fragment d’anticorps mutant selon la revendication 2, caractérisé en ce qu’il s’agit d’un fragment Fab. 4. Fragment d’anticorps mutant selon la revendication 1, caractérisé en ce qu’il ne comprend pas de domaine variable de chaine légère et est avantageusement un nanobody. 5. Fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 4, caractérisé en ce qu’il est chimérique, humanisé ou humain. 6. Fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 5, caractérisé en ce que le fragment d’anticorps se lie spécifiquement au récepteur B aux endothélines, et comprend : - un domaine variable de chaine lourde (VH) comprenant trois CDR de chaîne lourde CDR1- H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GYTFISYW (SEQ ID NO :3), IDPDSGGT (SEQ ID NO :4) et AREGDYAWFAY (SEQ ID NO :5) ou une séquence avec au moins 80% d’identité avec GYTFISYW (SEQ ID NO :3), IDPDSGGT (SEQ ID NO :4) ou AREGDYAWFAY (SEQ ID NO :5), et - un domaine variable de chaine légère (VL) comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives QSIVHSNGNTY (SEQ ID NO :6), KVS (SEQ ID NO :7) et FQGSHVPWT (SEQ ID NO :8) ou une séquence avec au moins 80% d’identité avec QSIVHSNGNTY (SEQ ID NO :6), KVS (SEQ ID NO :7) ou FQGSHVPWT (SEQ ID NO :8). 7. Fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 5, caractérisé en ce que le fragment d’anticorps se lie spécifiquement au récepteur A aux endothélines, et comprend : - un domaine VH comprenant trois CDR de chaîne lourde CDR1-H, CDR2-H et CDR3-H ayant selon la nomenclature IMGT pour séquences respectives GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) et VSSYYSGSFFAY (SEQ ID NO :11) ou une séquence avec au moins 80% d’identité avec GFTFNIYA (SEQ ID NO :9), IRSKSNNYAT (SEQ ID NO :10) ou VSSYYSGSFFAY (SEQ ID NO :11), et - un domaine VL comprenant trois CDR de chaîne légère CDR1-L, CDR2-L et CDR3-L ayant selon la nomenclature IMGT pour séquences respectives SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) et FQGSHLPLT (SEQ ID NO :14) ou une séquence avec au moins 80% d’identité avec SQSIVYSNGKIYL (SEQ ID NO :12), KVS (SEQ ID NO :13) ou FQGSHLPLT (SEQ ID NO :14). 8. Fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 6, caractérisé en ce que le fragment d’anticorps se lie spécifiquement au récepteur B aux endothélines, et comprend : - un domaine VH possédant la séquence SEQ ID NO :15 ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :15, et - un domaine VL possédant la séquence SEQ ID NO :16 ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :16 . 9. Fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 5 et 7, caractérisé en ce que le fragment d’anticorps se lie spécifiquement au récepteur A aux endothélines, et comprend : - un domaine VH possédant la séquence SEQ ID NO :17 ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :17, et - un domaine VL possédant la séquence SEQ ID NO :18 ou une séquence ayant au moins 80% d’identité avec SEQ ID NO :18. 10. Molécule d’acides nucléiques ou paire de molécules d’acides nucléiques codant pour le fragment d’anticorps mutant selon l’une quelque des revendications 1 à 9. 11. Vecteur comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon la revendication 10. 12. Cellule hôte, animal non-humain transgénique ou plante transgénique comprenant la molécule d’acides nucléiques ou la paire de molécules d’acides nucléiques selon la revendication 10 ou le vecteur selon la revendication 11. 13. Conjugué comprenant le fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 9, lié à au moins une, notamment une ou deux, molécule d’intérêt, via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. 14. Conjugué selon la revendication 13, répondant à la formule (I), (IIa) ou (IIb) suivante : R1-X1-L1-R2 (IIa) R1-X1-L1-X1’-L4-R2 (IIb) dans laquelle : R1 représente un fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 6 lié à X1 via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT ; avec X4 représentant une liaison simple, O, S, ou NR4, et R4 représentant H ou (C1-C6)alkyle, la liaison ondulée indiquant le point d’attachement à R1 et la liaision pointillée indiquant le point d’attachement à L1 ; ondulée indiquant le point d’attachement à L4, et la liaision pointillée indiquant le point d’attachement à L1 ; L1, L2, L3 et L4 représentent chacun indépendamment une liaison simple ou un espaceur, l’espaceur étant une chaîne (C1-C30)-alkyle, par exemple (C1-C20)-alkyle, éventuellement précédé et/ou interrompue et/ou suivie par un ou plusieurs motifs choisis dans le groupe constitué par les cycles aromatiques, hétéroaromatiques, cycloalcanes, cycloalcènes, hétérocycloalcanes, hétérocycloalcènes, -O-, -S-, -NR5-, -C(O)-, -C(S)-, -C≡C-, et - C(R6)=C(R7)-, avec R5 représentant H ou (C1-C6)alkyle, R6 et R7 représentant chacun indépendamment H ou (C1-C6)alkyle, et les cycles aromatiques, hétéroaromatiques, cycloalkyle, cycloalcényle, hétérocycloalkyle et hétérocycloalcényle étant éventuellement substitués par un ou plusieurs groupes (C1-C6)alkyle ; représente une liaison double ou une liaison simple, de préférence une liaison double ; le cycle A1 représente un cycle cycloalcane, cycloalcène, hétérocycloalcane ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy ; le cycle A2 représente un cycle cycloalcène ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy ; X2 et X3, identiques ou différents, représentent chacun O, S ou NR8, avec R8 représentant H ou (C1-C6)alkyle, de préférence H ; R2 et R3, identiques ou différents, de préférence différents, représentent chacun un résidu d’ une molécule d’intérêt avantageusement choisi parmi les molécules détectables ou susceptibles de devenir détectables, les molécules d'affinité et les molécules pharmacomodulatrices. 15. Conjugué selon la revendication 14, dans lequel la molécule d’intérêt est : - une molécule détectable ou susceptible de devenir détectable choisie parmi un fluorophore, un chromophore, une molécule d’affinité, un radioisotope et un agent chélatant ; - une molécule d'affinité choisie parmi la biotine, l'avidine, la streptavidine et un peptide hexa-histidine ; et/ou - une molécule pharmacomodulatrice choisie parmi des composés portant des chaînes linéaires ou ramifiées de poly(éthylène glycol), des chaînes linéaires ou ramifiées de poly(acide glutamique), le cholestérol, et des molécules capables de se lier à l’albumine. 16. Conjugué selon l’une quelconque des revendications 14 ou 15, répondant à la formule (I) et dans lequel au moins l’un de R1 et R2 est un résidu d’une molécule détectable ou susceptible de devenir détectable, et en particulier R1 et R2 représentent chacun indépendamment un résidu d’une molécule détectable ou susceptible de devenir détectable, avantageusement R1 et R2 représentent respectivement un résidu d’un fluorophore et un résidu d’un radioisotope ou d’un agent chélatant. 17. Procédé de préparation d’un conjugué selon l’une quelconque des revendications 13 à 16 comprenant les étapes suivantes : a) réduction du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence de tris(2-carboxyéthyl)phosphine (TCEP), pour donner un fragment d’anticorps mutant réduit, b) réoxydation du ou des ponts disulfures du fragment d’anticorps mutant, en particulier en présence d’acide déshydroascorbique, pour donner un fragment d’anticorps mutant partiellement réduit, c) conjugaison avec au moins une molécule d’intérêt de la fonction thiol de la cystéine en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant partiellement réduit pour donner un conjugué selon l’une quelconque des revendications 13 à 16. 18. Procédé selon la revendication 17, dans lequel : - le conjugué est un conjugué de formule (I) selon l’une quelconque des revendications 14 à 16 et l’étape c) est réalisée par couplage entre le fragment d’anticorps mutant partiellement réduit et un composé de formule (III) suivante : pour lequel L1 est tel que défini à la revendication 14, le cycle A3 représente un cycle cycloalcyne, cycloalcène, hétérocycloalcyne ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy, et X1a représente un groupe chimique réactif vis-à-vis d’une fonction SH, avantageusement , avec Hal représentant Br ou I, X4 représentant une liaison simple, O, S, ou NR4, et R4 représentant H ou (C1-C6)alkyle, pour donner un composé de formule (IV) suivante : pour lequel R1, X1 et L1 sont tels que définis à la revendication 14, et le cycle A3 est el que défini ci-dessus, suivi du couplage entre le composé de formule (IV) et un composé de formule (V) suivante : pour lequel R2, R3, L2, L3, X2 et X3 sont tels que définis à la revendication 14 ; ou - le conjugué est un conjugué de formule (IIa) selon l’une quelconque des revendications 14 à 16 et l’étape c) est réalisée par couplage du fragment d’anticorps mutant partiellement réduit avec un composé de formule X1a-L1-R2 dans lequel L1 et R2 sont tels que définis à la revendication 14 et X1a est tel que défini ci-dessus ; ou - le conjugué est un conjugué de formule (IIb) selon l’une quelconque des revendications 14 à 16 et l’étape c) est réalisée : i) par couplage du fragment d’anticorps mutant partiellement réduit avec un composé de formule X1a-L1-X1’-L4-R2 dans lequel L1, L4, X1’ et R2 sont tels que définis à la revendication 14 et X1a est tel que défini ci-dessus ; ou ii) par couplage du fragment d’anticorps mutant partiellement réduit avec un composé de formule X1a-L1-G1 dans lequel X1a est tel que défini ci-dessus, L1 est tel que défini à la revendication 14 et G1 représente un groupe chimique réactif, pour donner un conjugué de formule R1-X1-L1-G1, suivi du couplage entre le conjugué de formule R1-X1-L1-G1 et un composé de formule G2-L4-R2 dans lequel L4 et R2 sont tels que définis à la revendication 14 et G2 est un groupe chimique réactif différent de G1 et capable de réagir avec G1 pour former un groupe X1’. 19. Conjugué intermédiaire comprenant le fragment d’anticorps mutant selon l’une quelconque des revendications 1 à 9, lié à un groupe chimique réactif, via la cystéine, et plus particulièrement la fonction thiol de la cystéine, en position 128 du domaine variable de chaine lourde selon la nomenclature IMGT du fragment d’anticorps mutant. 20. Conjugué intermédiaire selon la revendication 19, répondant à la formule R1-X1-L1-Z dans lequel R1, X1 et L1 sont tels que définis à la revendication 14, et Z représente un groupe chimique réactif. 21. Conjugué intermédiaire selon la revendication 19 ou 20, dans lequel le groupe chimique réactif est choisi parmi , avec le cycle A3 représentant un cycle cycloalcyne, cycloalcène, hétérocycloalcyne ou hétérocycloalcène, éventuellement accolé avec un ou plusieurs, notamment un ou deux, cycles aromatiques et optionnellement substitué par un ou plusieurs groupes choisis parmi (C1-C6)alkyle, halogéno, et hydroxy. 22. Conjugué selon l’une quelconque des revendications 13 à 16, pour son utilisation dans : a) une méthode de diagnostic d’une tumeur par imagerie, b) une méthode de traitement chirurgical par résection tumorale guidée par fluorescence ou sonde d’imagerie nucléaire, c) une méthode de suivi par imagerie de l’efficacité d’un traitement antitumoral, ou d) toute combinaison des méthodes a), b) et c).
EP24714531.1A 2023-02-09 2024-02-09 Fragment fab mutant pour l'obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques Pending EP4662240A2 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR2301200 2023-02-09
PCT/FR2024/050178 WO2024165823A2 (fr) 2023-02-09 2024-02-09 Fragment fab mutant pour l'obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques

Publications (1)

Publication Number Publication Date
EP4662240A2 true EP4662240A2 (fr) 2025-12-17

Family

ID=86604718

Family Applications (1)

Application Number Title Priority Date Filing Date
EP24714531.1A Pending EP4662240A2 (fr) 2023-02-09 2024-02-09 Fragment fab mutant pour l'obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques

Country Status (2)

Country Link
EP (1) EP4662240A2 (fr)
WO (1) WO2024165823A2 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4721765A1 (fr) * 2024-10-04 2026-04-08 Commissariat à l'Energie Atomique et aux Energies Alternatives Conjugues d'anticorps bifonctionnalises diriges contre le recepteur b de l'endotheline

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
JP4523165B2 (ja) 1998-11-02 2010-08-11 トラスティーズ オブ タフツ カレッジ トランスジェニックおよびクローン哺乳動物
HUP0203537A2 (hu) 1999-10-14 2003-02-28 Genzyme Transgenics Corporation Célmolekula transzgénikus állatban történő előállítására és tisztítására szolgáló eljárások
CA2506629A1 (fr) 2002-11-27 2004-06-17 Gtc Biotherapeutics, Inc. Production stable d'anticorps modifies dans le lait, et procedes de production
US7807862B2 (en) 2003-09-30 2010-10-05 Sterrenbeld Biotechnologie North America, Inc. Transgenic bovine comprising human growth hormone in its serum and methods of making
US7563443B2 (en) * 2004-09-17 2009-07-21 Domantis Limited Monovalent anti-CD40L antibody polypeptides and compositions thereof
KR20140133958A (ko) 2005-10-21 2014-11-20 엘에프비 유에스에이, 인크. 항체 의존성 세포 독성 활성이 증강된 항체, 그 생산 및 사용 방법
US7531632B2 (en) 2006-02-16 2009-05-12 Gtc Biotherapeutics, Inc. Clarification of transgenic milk using depth filtration
BRPI0907046A2 (pt) * 2008-01-18 2015-07-28 Medimmune Llc Anticorpo de cisteína engenheirada, ácido nucleico isolado, vetor, célula hospedeira, conjugado de anticorpo, composição farmacêutica, métodos de detecção de câncer, doenças ou distúrbios autoimunes, inflamatórios ou infecciosos em um indivíduo e de inibição de proliferação de uma célula alvo
ES2427627T3 (es) * 2009-04-06 2013-10-31 Novo Nordisk A/S Entrega dirigida de proteínas de Factor VIII a plaquetas
WO2011003622A1 (fr) * 2009-07-10 2011-01-13 Ablynx N.V. Procédé pour la production de domaines variables
JP2012532619A (ja) * 2009-07-16 2012-12-20 グラクソ グループ リミテッド Tnfr1を部分的に阻害するためのアンタゴニスト、用途および方法
FR3053042B1 (fr) * 2016-06-24 2018-08-10 Commissariat A L'energie Atomique Et Aux Energies Alternatives Anticorps dirige contre le sous-type b des recepteurs aux endothelines et ses utilisations
WO2018106895A1 (fr) * 2016-12-07 2018-06-14 Molecular Templates, Inc. Polypeptides effecteurs de sous-unité a de toxine shiga, échafaudages d'effecteur de toxine shiga et molécules ciblant des cellules pour une conjugaison spécifique à un site
US12059472B2 (en) * 2016-12-21 2024-08-13 Bayer Aktiengesellschaft Prodrugs of cytotoxic active agents having enzymatically cleavable groups
US11242359B2 (en) 2017-03-24 2022-02-08 Centre National De La Recherche Scientifique Biocompatible modular tetrazine platform
FR3077574B1 (fr) * 2018-02-07 2022-04-01 Commissariat Energie Atomique Anticorps dirige contre le sous-type a des recepteurs aux endothelines et ses utilisations.
WO2022133089A1 (fr) * 2020-12-18 2022-06-23 Bioardis, Llc Molécules de liaison à ace6 et leurs utilisations

Also Published As

Publication number Publication date
WO2024165823A3 (fr) 2024-09-26
WO2024165823A2 (fr) 2024-08-15

Similar Documents

Publication Publication Date Title
TWI907489B (zh) 抗ror1抗體及相關雙特異性結合蛋白
TWI711631B (zh) 抗甲狀腺素運送蛋白抗體
JP5028635B2 (ja) Fzd10に対する腫瘍標的化モノクローナル抗体とその使用
ES2744526T3 (es) Anticuerpos anti-MCAM y métodos de uso asociados
JP5903717B2 (ja) ヒト抗ミュラーホルモンii型レセプタ(amhr−ii)に対するモノクローナル抗体とそのフラグメント
CN107847593B (zh) 治疗抗体及其用途
JP7017013B2 (ja) 抗トランスサイレチン抗体
IL313695A (en) Radiolabeled anti-lag3 antibodies for immuno-pet imaging
BR112020006434A2 (pt) anticorpos anti-transtirretina
JP7460063B2 (ja) c-KIT陽性腫瘍特異的抗体断片
RU2767793C2 (ru) НОВЫЙ Fab-ФРАГМЕНТ АНТИТЕЛА ПРОТИВ MUC1 ЧЕЛОВЕКА
JP2018506277A (ja) 抗トランスサイレチン抗体
TW200825105A (en) Antibodies and immunoconjugates and uses therefor
CN109415434A (zh) 识别tau的抗体
EP3310816B1 (fr) Immunoglobulines conjuguées cys80
Wei et al. Selective photokilling of colorectal tumors by near-infrared photoimmunotherapy with a GPA33-targeted single-chain antibody variable fragment conjugate
JP2019530427A (ja) 抗トランスサイレチン抗体
JP2019532617A (ja) 抗トランスサイレチン抗体
JP2018509889A (ja) 抗トランスサイレチン抗体
WO2019012260A1 (fr) Molécules thérapeutiques se liant à psma
JP2021532778A (ja) Psmaに対するヒト化抗体
TW202003584A (zh) 單特異性及多特異性抗tmeff2抗體及其用途
TW202327660A (zh) 抗psma放射接合物及其用途
WO2024165823A2 (fr) Fragment fab mutant pour l&#39;obtention de conjugués mono- ou bi-fonctionnalisés site-spécifiques
EP4721765A1 (fr) Conjugues d&#39;anticorps bifonctionnalises diriges contre le recepteur b de l&#39;endotheline

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20250903

AK Designated contracting states

Kind code of ref document: A2

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC ME MK MT NL NO PL PT RO RS SE SI SK SM TR