EP4359006A1 - Antisense compounds and methods for targeting cug repeats - Google Patents

Antisense compounds and methods for targeting cug repeats

Info

Publication number
EP4359006A1
EP4359006A1 EP22744043.5A EP22744043A EP4359006A1 EP 4359006 A1 EP4359006 A1 EP 4359006A1 EP 22744043 A EP22744043 A EP 22744043A EP 4359006 A1 EP4359006 A1 EP 4359006A1
Authority
EP
European Patent Office
Prior art keywords
compound
side chain
amino acid
amino acids
peg
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
EP22744043.5A
Other languages
German (de)
English (en)
French (fr)
Inventor
Xiulong SHEN
Ziqing QIAN
Patrick Dougherty
Mahboubeh KHEIRABADI
Xiang Li
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Entrada Therapeutics Inc
Original Assignee
Entrada Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Entrada Therapeutics Inc filed Critical Entrada Therapeutics Inc
Publication of EP4359006A1 publication Critical patent/EP4359006A1/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/645Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
    • A61K47/6455Polycationic oligopeptides, polypeptides or polyamino acids, e.g. for complexing nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/712Nucleic acids or oligonucleotides having modified sugars, i.e. other than ribose or 2'-deoxyribose
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K7/00Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/64Cyclic peptides containing only normal peptide links
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/072Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/32Chemical structure of the sugar
    • C12N2310/323Chemical structure of the sugar modified ring structure
    • C12N2310/3233Morpholino-type ring
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/35Nature of the modification
    • C12N2310/351Conjugate
    • C12N2310/3513Protein; Peptide

Definitions

  • the present disclosure relates to compounds, compositions, and methods for modulating the activity and/or levels of genes that include expanded nucleotide repeats, in particular expanded CTG-CUG repeats.
  • the compounds and compositions containing the same may be used to treat diseases associated with genes that include an expanded nucleotide repeat, in particular expanded CTG-CUG repeats.
  • the expanded repeat may cause aggregation and/or nucleation of the expanded repeat containing transcript and/or cause nucleation of proteins that bind to expanded repeat containing transcript.
  • the expanded repeats may result in some proteins, such as pre-mRNA processing proteins, being sequestered on the repeat, thus inhibiting the proteins from performing their normal functions, such as processing pre- mRNA transcripts of other genes that do not contain the expanded repeat.
  • CTG-CUG trinucleotide repeats There are several diseases associated with genes having expanded CTG-CUG trinucleotide repeats (CTG refers to the DNA repeat and CUG refers to the corresponding RNA repeat that occurs upon transcription).
  • CTG-CUG trinucleotide repeats include, but are not limited to, myotonic dystrophy type 1 (DM1), Spinocerebellar Ataxia-8 (SCA8), Huntington s disease like-2 (HDL2), and Fuchs endothelial corneal dystrophy (FECD).
  • DM1 myotonic dystrophy type 1
  • SCA8 Spinocerebellar Ataxia-8
  • HDL2 Huntington s disease like-2
  • FECD Fuchs endothelial corneal dystrophy
  • DM1 Myotonic dystrophy type 1
  • DM1 is a disorder that affects skeletal and smooth muscle, as well as the eye, heart, endocrine system, and central nervous system.
  • DM1 is caused by abnormal expansion of a CTG-trinucleotide repeat in the non-coding region of the gene encoding Dystrophia Myotonica Protein Kinase (DMPK).
  • DMPK Dystrophia Myotonica Protein Kinase
  • the CTG expansion lies within a region corresponding to the 3′ untranslated region (3′-UTR) of the DMPK mRNA.
  • the DMPK gene in healthy individuals contains between 5 and 40 CTG trinucleotide repeats
  • patients with DM1 have from 50 and up to several thousand CTG trinucleotide repeats.
  • CTG-trinucleotide repeat expansion results in global deregulation of gene expression in affected individuals due to nucleation of some regulatory RNA-binding proteins in the CUG-expansion in the 3′ untranslated region (3′-UTR), rendering the RNA-binding proteins, such as muscleblind-like protein (MBNL1- 3) unable to perform their normal cellular function.
  • MBNL1-3 muscleblind-like protein
  • RNA-binding proteins are not available to bind and affect translation of other mRNA transcripts. These CUG-expanded mRNA– protein aggregates form distinct nuclear foci.
  • CUG-expanded mRNA– protein aggregates form distinct nuclear foci.
  • additional splicing factors such as CUGBP Elav-like family member 1 (CELF1), is also disrupted, leading to the mis-splicing of a large number of downstream gene transcripts associated with symptoms of DM1.
  • Disease severity increases and age of onset decreases with an increasing number of repeats (Pettersson et al. (2015) “Molecular mechanisms in DM1 – a focus on foci.” Nucleic Acids Res.43(4):2433-2441).
  • the CUG-trinucleotide repeats in the 3′ untranslated region of DMPK mRNA form imperfect stable hairpin structures that accumulate in the cell nucleus in small ribonuclear complexes or microscopically visible inclusions, and impair the function of proteins implicated in transcription, splicing or RNA export.
  • DMPK genes with CUG repeats are transcribed into mRNA, the mutant transcripts are sequestered in the nucleus as aggregates (foci), which results in a decrease in cytoplasmic DMPK mRNA levels.
  • MBNL1 muscleblind-like 1
  • CUGBP1 CAG-binding protein 1
  • MBNL1 and CUGBP-ETR-3 like factor 1 CELF1 are developmental regulators of splicing events during fetal to adult transition and modification of their activities in DM1 leads to expression of a fetal splicing pattern in adult tissues.
  • the downstream impact of decreased MBNL1 and increased CELF1 levels includes disruption of alternative splicing, mRNA translation and mRNA decay in proteins such as cardiac troponin T (cTNT), insulin receptor (INSR), muscle-specific chloride ion channel (CLCN1) and sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) transcripts, in addition to MBNL1 (Konieczny et al. (2017) “Myotonic dystrophy: candidate small molecule therapeutics.” Drug Discov Today. 22(11):1740- 174).
  • cTNT cardiac troponin T
  • INSR insulin receptor
  • CLCN1 muscle-specific chloride ion channel
  • ATP2A1 sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  • Possible therapeutic approaches to treat DM1, or other diseases associated with expanded CTG ⁇ CUG repeats include the use of therapeutic oligonucleotide containing compounds.
  • a major problem associated with the use of oligonucleotide compounds in therapeutics is their limited ability to gain access to the intracellular compartment when administered systemically.
  • Intracellular delivery of oligonucleotide compounds can be facilitated by use of carrier systems such as polymers, cationic liposomes or by chemical modification of the construct, for example by the covalent attachment of cholesterol molecules.
  • carrier systems such as polymers, cationic liposomes or by chemical modification of the construct, for example by the covalent attachment of cholesterol molecules.
  • intracellular delivery efficiency of oligonucleotide compounds remains low. Improved delivery systems are still required to increase the potency of these compounds.
  • compositions, and methods for treating a disease associated with an expanded CTG ⁇ CUG repeat are described herein.
  • this disclosure relates to compounds that include an antisense compound (AC) and a cyclic peptide, such as a cyclic cell penetrating peptide (cCPP).
  • AC antisense compound
  • cCPP cyclic cell penetrating peptide
  • the AC binds to a gene or gene transcript comprising an expanded CUG repeat.
  • the cyclic peptide facilitates intracellular localization of the AC.
  • the compounds may comprise an endosomal escape vehicle (EEV).
  • EEV may comprise the cyclic peptide and an exocyclic peptide.
  • a compound comprising: (a) at least one cyclic peptide and (b) an antisense compound (AC) that is complementary to a target nucleotide.
  • the target nucleotide comprises at least one expanded CUG or CTG repeat.
  • the target nucleotide is a gene that comprises at least one expanded CTG repeat.
  • the target nucleotide is RNA that comprises at least one expanded CUG repeat.
  • the RNA that comprises at least one expanded CUG repeat is a pre-mRNA sequence.
  • the expanded CUG repeat corresponds to an expanded CTG repeat in a gene from which the pre-mRNA is transcribed.
  • the antisense compound binds to the expanded CTG repeat or the expanded CUG repeat.
  • the AC comprises 5- 40 CAG repeats (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 repeats).
  • the AC comprises a sequence of a nucleotide listed in Table 2, Table 10, or Table 11.
  • the AC comprises a sequence of a nucleotide listed in Table 2.
  • the AC comprises at least one modified nucleotide or nucleic acid selected from a phosphorothioate (PS) nucleotide, a phosphorodiamidate morpholino (PMO) nucleotide, a locked nucleic acid (LNA), a peptide nucleic acid (PNA), a nucleotide comprising a 2’-O-methyl (2’-OMe) modified backbone, a 2’O-methoxy-ethyl (2’-MOE) nucleotide, a 2',4' constrained ethyl (cEt) nucleotide, a 2'-deoxy-2'-fluoro-beta-D-arabinonucleic acid (2'F-ANA), and combinations thereof.
  • PS phosphorothioate
  • PMO phosphorodiamidate morpholino
  • LNA locked nucleic acid
  • PNA peptide nucleic acid
  • cEt constrained ethy
  • the AC comprises a PMO nucleotide.
  • compounds are provided that include a cyclic peptide having 6 to 12 amino acids, wherein at least two amino acids of the cyclic peptide are charged amino acids, at least two amino acids of the cyclic peptide are aromatic hydrophobic amino acids and at least two amino acids of the cyclic peptide are uncharged, non-aromatic amino acids.
  • the antisense compound (AC) is complementary to at least a portion of an expanded CUG repeat in a target mRNA sequence.
  • the AC is a phosphorodiamidate morpholino (PMO) nucleotide.
  • At least two charged amino acids of the cyclic peptide are arginine.
  • at least two aromatic, hydrophobic amino acids of the cyclic peptide are phenylalanine, naphthylalanine (3-Naphth-2-yl-alanine), or a combination thereof.
  • at least two uncharged, non-aromatic amino acids of the cyclic peptide are citrulline, glycine, or a combination thereof.
  • the compound is a cyclic peptide having 6 to 12 amino acids wherein two amino acids of the cyclic peptide are arginine, at least two amino acids are aromatic, hydrophobic amino acids selected from phenylalanine, naphthylalanine, and combinations thereof, and at least two amino acids are uncharged, non- aromatic amino acids selected from citrulline, glycine, and combinations thereof.
  • the compound comprises an endosomal escape vehicle comprising a cyclic peptide and an exocyclic peptide (EP).
  • the EP is conjugated to a linker at an amino group.
  • the linker may be a linker as described herein.
  • the EP is conjugated to the cyclic peptide via the linker. In embodiments, the EP is conjugated to the AC via the linker. In embodiments, the EP is conjugated to the linker that conjugates the AC to the cyclic peptide. [0015] In embodiments, the EP comprises from 2 to 10 amino acids. In embodiments, the EP comprises from 4 to 8 amino acid residues. In embodiments, the EP comprises 1 or 2 amino acids comprising a side chain comprising a guanidine group, or a protonated form thereof. In embodiments, the EP comprises 1, 2, 3, or 4 lysine residues.
  • the amino group on the side chain of each lysine residue is substituted with a trifluoroacetyl (-COCF 3 ) group, allyloxycarbonyl (Alloc), 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)ethyl (Dde), or (4,4- dimethyl-2,6-dioxocyclohex-1-ylidene-3)-methylbutyl (ivDde) group.
  • EP comprises at least 2 amino acid residues with a hydrophobic side chain.
  • the amino acid residue with a hydrophobic side chain is selected from valine, proline, alanine, leucine, isoleucine, and methionine.
  • the exocyclic peptide comprises one of the following sequences: PKKKRKV; KR; RR; KKK; KGK; KBK; KBR; KRK; KRR; RKK; RRR; KKKK; KKRK; KRKK; KRRK; RKKR; RRRR; KGKK; KKGK; KKKKK; KKKRK; KBKBK; KKKRKV; PGKKRKV; PKGKRKV; PKKGRKV; PKKKGKV; PKKKRGV; or PKKKRKG.
  • the exocyclic peptide consists of one of the following sequences: PKKKRKV; KR; RR; KKK; KGK; KBK; KBR; KRK; KRR; RKK; RRR; KKKK; KKRK; KRKK; KRRK; RKKR; RRRR; KGKK; KKGK; KKKKK; KKKRK; KBKBK; KKKRKV; PGKKRKV; PKGKRKV; PKKGRKV; PKKKGKV; PKKKRGV; or PKKKRKG.
  • the exocyclic peptide has the structure: Ac-P-K-K-K-R-K-V-.
  • the cyclic peptide comprises 4 to 12 amino acids. In embodiments, the cyclic peptide comprises 6 to 12 amino acids. In embodiments, at least two amino acids of the cyclic peptide are charged amino acids, at least two amino acids of the cyclic peptide are aromatic hydrophobic amino acids and at least two amino acids of the cyclic peptide are uncharged, non-aromatic amino acids.
  • At least two charged amino acids of the cyclic peptide are arginine
  • at least two aromatic hydrophobic amino acids of the cyclic peptide are phenylalanine, napthylalanine, or combinations thereof
  • at least two uncharged, non- aromatic amino acids are citrulline, glycine, or combinations thereof.
  • the cyclic peptide has 4 to 12 amino acids, wherein at least two amino acids are arginine and at least two amino acids comprise a hydrophobic side chain, provided that the cyclic peptide is not a cyclic peptide having a sequence of SEQ ID NO: 89-117.
  • the cyclic peptide is not a cyclic peptide having a sequence of SEQ ID NO: 89- 117.
  • F is L-phenylalanine
  • f is D-phenylalanine
  • is L-3-(2-naphthyl)-alanine
  • is D-3-(2- naphthyl)-alanine
  • R is L-arginine
  • r is D-arginine
  • Q is L-glutamine
  • q D-glutamine
  • C is L- cysteine
  • U L-selenocysteine
  • W is L-tryptophan
  • K is L-lysine
  • D is L-aspartic acid
  • is L-norleucine.
  • R 1 , R 2 , and R 3 are each independently H or an aromatic or heteroaromatic side chain of an amino acid; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 , R 5 , R 6 , R 7 are independently H or an amino acid side chain; at least one of R 4 , R 5 , R 6 , R 7 is the side chain of 3-guanidino-2-aminopropionic acid, 4- guanidino-2-aminobutanoic acid, arginine, homoarginine, N-methylarginine, N,N- dimethylarginine, 2,3-diaminopropionic acid, 2,4-diaminobutanoic acid, lysine, N- methyllysine, N,N-dimethyllysine, N-ethyllysine, N,N,N-trimethyllysine, 4- guanidinoph
  • R 4 , R 5 , R 6 , R 7 are independently a uncharged, non- aromatic side chain of an amino acid. In embodiments, at least one of R 4 , R 5 , R 6 , R 7 are independently H or a side chain of citrulline.
  • the cyclic peptide has the structure of Formula I:
  • R 1 , R 2 , and R 3 are each independently H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 7 are independently H or an amino acid side chain; AA SC is an amino acid side chain to which the antisense compound is conjugated; q is 1, 2, 3 or 4; and each m is independently an integer of 0, 1, 2, or 3.
  • the cyclic peptide of Formula (I) has one of the following structures:
  • the cyclic peptide of Formula (I) has one of the following structures: (I-1), (I-2),
  • the cyclic peptide of Formula (I) has one of the following structures:
  • the cyclic peptide of Formula (I) has the following structure: a protonated form thereof
  • the compound has a structure of Formula C: (C), or a protonated form or salt thereof, wherein: R 1 , R 2 , and R 3 are each independently H or a side chain comprising an aryl or heteroaryl group, wherein at least one of R 1 , R 2 , and R 3 is a side chain comprising an aryl or heteroaryl group; R 4 and R 7 are independently H or an amino acid side chain; EP is the exocyclic peptide; each m is independently an integer from 0-3; n is an integer from 0-2; x’ is an integer from 1-23; y is an integer from 1-5; q is an integer from 1-4; z’ is an integer from 1-23, and Cargo is the antisense d [0026]
  • the compound has one or the following structures:
  • FIG. 1 is a schematic showing multiple strategies for targeting CUG repeats in mRNA.
  • FIG. 2 shows modified nucleotides used in antisense oligonucleotides described herein.
  • FIGS. 3A-3D illustrate conjugation chemistries for connecting an AC to a cyclic cell penetrating peptide.
  • FIG. 3A shows the amide bond formation between peptides with a carboxylic acid group or with TFP activated ester and primary amine residues at the 5’ end of an AC.
  • FIG. 3B shows the conjugation of secondary amine or primary amine modified AC at 3’ and peptide- TFP ester through amide bond formation.
  • FIG.3C shows the conjugation of a peptide-azide to the 5’ cyclooctyne modified AC via copper-free azide-alkyne cycloaddition.
  • FIG. 3D demonstrates another exemplary conjugation between a 3’ modified cyclooctyne ACs or 3’ modified azide ACs and CPP containing linker-azide or linker-alkyne/cyclooctyne moiety, via a copper-free azide- alkyne cycloaddition or cupper catalyzed azide-alkyne cycloaddition, respectively (click reaction).
  • FIG.4 shows the conjugation chemistry for connecting an AC and CPP with an additional linker modality containing a polyethylene glycol (PEG) moiety.
  • FIGS. 5A-5D provide structures of the adenine (5A), cytosine (5B), guanine (5C), and thymine (5D) morpholino subunit monomers that may be used to synthesize phosphorodiamidate- linked morpholino oligomers (PMOs).
  • FIG. 6A-6F show RT-PCR analysis of alternative RNA splicing events (e.g., exon inclusion or exclusion) of MBNL1 (exon 5; FIG.
  • FIG. 6A, 6B, 6E and CLASP1 (exon 19; FIG. 6B, 6D, 6F) 24 hours (6A-6B) and 48 hours (6C-6D) after HeLa-48 cells were treated with 1 ⁇ M, 3 ⁇ M, or 10 ⁇ M of various PMOs or PMO-EEV compounds using the Endo-Porter transfection agent (6A-6C) or without the Endo-Porter agent (6E-6F).
  • the parental HeLa cell line and the HeLa-480 cell line treated with (6A-6D) or without (6E-6F) the Endo-Porter agent were included as controls. [0035] FIG.
  • FIG. 7A-7B show RT-PCR analysis of alternative RNA splicing events (e.g., exon inclusion or exclusion) of MBNL1 (exon 5; FIG. 7A) and CLASP1 (exon 19; FIG. 7B) 48 hours after DM1 myoblasts were treated with 1 ⁇ M of various PMO or PMO-EEV compounds without the Endo-Porter transfection reagent. Two controls, DM-04 without endo-porter treated and DM- 05 without endo-porter were included as controls.
  • FIG. 8A-8D show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion or exclusion) of Atp2a1 (exon 22; FIG.
  • FIG. 8A Nfix (exon 7; FIG. 8B), Clcn1 (exon 7a; FIG. 8C) and Mbnl1 (exon 5; FIG. 8D) from gastrocnemius muscle tissues one week after HSA- LR (DM1-mouse model) mice were treated with a PMO, 20 mpk PMO-EEV 221-1106, or 40 mpk PMO-EEV 221-1106. FVB/NJ (wild type inbred mouse) and HSA-LR (without treatment) mice were included as control groups.
  • FIG. 9A-9D show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion or exclusion) of Atp2a1 (exon 22; FIG.
  • FIG. 9A Nfix (exon 7; FIG. 9B), Clcn1 (exon 7a; FIG. 9C) and Mbnl1 (exon 5; FIG. 9D) from quadricep muscle tissues one week after HSA-LR (DM1-mouse model) mice were treated with a PMO, 20 mpk PMO-EEV 221-1106, or 40 mpk PMO-EEV 221-1106.
  • FVB/NJ wild type inbred mouse
  • HSA-LR without treatment mice were included as control groups.
  • FIG. 10A-10D show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion or exclusion) of Atp2a1 (exon 22; FIG.10A), Nfix (exon 7; FIG.10B), Clcn1 (exon 7a; FIG. 10C) and Mbnl1 (exon 5; FIG. 10D) from tibialis anterior muscle tissues one week after HSA-LR (DM1-mouse model) mice were treated with a PMO, 20 mpk PMO-EEV 221-1106, or 40 mpk PMO-EEV 221-1106. FVB/NJ (wild type inbred mouse) and HSA-LR (without treatment) mice were included as control groups. [0039] FIG.
  • 11A-11F show RT-PCR analysis of alternative RNA splicing events (e.g., exon inclusion or exclusion) of MBNL1 (exon 5, FIG. 11A), SOS1 (exon 25, FIG. 11B), IR (exon 11, FIG. 11C), DMD (exon 78, FIG. 11D), BIN1 (exon 11, FIG. 11E) and LDB3 (exon 11, FIG. 11F) after DM1 patient derived muscle cells were treated with different concentrations (10 ⁇ m, 3 ⁇ m, 1 ⁇ m, 0.3 ⁇ m) of DMPK CUG-targeting EEV-PMOs (CUG exp 197-777 and CUG exp 221- 1106).
  • DMPK CUG-targeting EEV-PMOs CUG-targeting EEV-PMOs
  • FIG. 12A-12F shows RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion or exclusion) of MBL1 (exon 5, FIG.12A), SOS1 (exon 25, FIG.12B), INSR (exon 11, FIG. 12C), DMD (exon 78, FIG. 12D), BIN1 (exon 11, FIG.
  • FIG. 12E shows the relative levels of mRNA after HSA-LR mice were treated with various concentrations of PMO-EEV 221-1120.
  • FIG. 12F shows the relative levels of mRNA after HSA-LR mice were treated with various concentrations of PMO-EEV 221-1120.
  • FIG. 13A shows the relative mRNA level for the gastrocnemius, triceps, tibialis anterior, and diaphragm.
  • FIG.13B shows the relative mRNA levels in the diaphragm.
  • FIG. 14A-14C show the relative levels of mRNA in the quadricep (14A), gastrocnemius (14B), tricep (14C) and tibialis anterior (14D) tissues after HSA-LR mice were treated with various concentrations of PMO-EEV 221-1120.
  • FIG.15A-15D show the mouse DM1 splicing index (mDSI) for various genes in quadricep (FIG.15A), gastrocnemius (FIG.15B), tricep (FIG.15C), and tibialis anterior (FIG.15D) tissues after HSA-LR mice were treated with various concentrations of PMO-EEV 221-1120.
  • FIGS.16A-16C show the prevalence of RNA foci in the tibialis anterior muscle after HSA- LR mice were either untreated or treated with EEV-PMO 221-1120 (EEV-PMO-DM1-3; DM1- 3).
  • FIG. 16A-16B show images of tibialis anterior muscle tissue stained for RNA CUG foci (red) and nuclei (blue).
  • FIG. 16C is a plot quantifying the percent of nuclei that have a CUG foci from data associated with the images in FIG. 16A-16B.
  • FIG. 17A-17F are plots showing a dose-dependent response for drug levels in the quadricep (17A), tricep (17B), heart (17C), gastrocnemius (17D), tibialis anterior (17E), diaphragm (17F), brain (17H), liver (17I), and kidney (17J) tissues after HSA-LR mice were treated with various concentrations of EEV-PMO-DM1-3.
  • FIG. 17K shows drug exposure of various tissues at a 60 mpk dosage level.
  • FIG. 18 shows a dose dependent myotonia reduction in HSA-LR mice 7 days after treatment with EEV-PMO-DM1-3 at 15, 30, 60 and 90 mpk.
  • FIG. 19A-19D are plots show the results of a principal component analysis comparing gene expression in un-diseased mice (WT), DM1 mice (HSA-LR), and HSA-LR mice treated with PMO-EEV 221-1120.
  • FIG. 19A and 19C are plots showing three principal components and FIG. 19B and 19D are plots showing two principal components.
  • FIG.20A-20B show heatmaps of differentially expressed genes between un-diseased mice (WT), DM1 mice (HSA-LR), and HSA-LR mice treated with 60 mpk PMO-EEV 221-1120.
  • FIG. 20A is a clustered heatmap showing 513 differentially expressed genes.
  • FIG. 20B is a clustered heatmap showing 40 genes that are known to have CTG ⁇ CUG repeats.
  • FIG. 21 is a volcano plot showing the global transcriptional change across the untreated HSA-LR mice and mice treated with PMO-EEV 221-1120.
  • FIG. 20A-20B show heatmaps of differentially expressed genes between un-diseased mice (WT), DM1 mice (HSA-LR), and HSA-LR mice treated with 60 mpk PMO-EEV 221-1120.
  • FIG. 20A is a clustered heatmap showing 513 differentially expressed genes.
  • FIG. 20B is a clustered heatmap showing 40 genes that are known to
  • 22A-22E are plots show the result of a principal component analysis for the Scube2 (22A), Greb1 (22B), Ttc7 (22C), Txlnb(CUG)9 (22D), and Ndrg3 (22E) genes from undiseased mice, HSA-LR mice, and HSA-LR mice treated with PMO-EEV 221-1120.
  • FIG.23A-23D show RNA sequencing (RNAseq) data for Atp2a1 (23A; exon 22 is boxed), Clcn1 (23B; exon 7a is boxed), Nfix (23C; exon 7 is boxed), and Mbn1 (23D; exon 5 is boxed) for un-diseased mice (WT-saline), HSA-LR mice (HSA-LR saline), and HSA-LR mice treated with PMO-EEV 221-1120. Two reads are shown for each treatment group. [0052] FIG.
  • FIG.25A-25D shows the drug levels in HSA-LR mice treated with 80 mpk (60 mpk oligo, 80 mpk whole drug) EEV-PMO-DM1-3 after 1 week to 4 weeks in the tibialis anterior (25A), gastrocnemius (25B), triceps (25C) and quadricep (25D) tissues.
  • FIG.26A-26D show the drug levels in mice after HSA-LR mice were treated with a single 80 mpk dose of EEV-PMO-DM1-3.
  • FIG. 26A-26B show the drug levels in the liver from 1 week to 12 weeks post treatment.
  • FIG. 26C-26D show the drug levels in the kidney from 1 week to 12 weeks post treatment.
  • FIG. 27A-27C are plots showing the level of exon inclusion for MBNL1 (exon 5; 26A), SOS1 (exon 25; 26B), and NFIX (exon 7; 26C) after DM1 patient derived muscle cells were treated with 30 ⁇ M EEV-PMO-DM1-3.
  • FIG. 28A-28C shows that EEV-PMO-DM1-3 reduces CUG nuclear foci (green) in the nucleus (blue) in DM1 patient-derived muscle cells.
  • FIG. 28A-28B are images of DM1 patient derived muscle cells that are either untreated or treated with EEV-PMO-DM1-3 or untreated.
  • FIG. 28C is the quantification of the number of CUG foci per nucleus for data associated with the images in FIG. 28A.
  • FIG.29A-29B show the raw data (29A) and the normalized data (29B) of a CELLTITER- GLO luminescent viability assay where RPTEC cells were treated with various concentrations of PMO-DM1 or EEV-PMO-DM1-3.
  • FIGS. 30A-30C show images depicting RNA CUG repeat foci in DM1 patient-derived cells (30A) and DM1 patient-derived cells treated with an EEV-PMO 221-1113 (30B). Cells were stained for nuclei (blue; Hoechst) and RNA CUG foci (green).
  • FIG. 30C is a plot of the CUG RNA foci per nuclear area for data associated with the images of FIG. 30A-30B.
  • FIG.31A-31B show the prevalence of RNA CUG7 foci in HeLa, untreated HeLa480 cells, and HeLa480 cells treated with EEV-PMO 221-1113.
  • FIG.31A-31B show the prevalence of RNA CUG7 foci in HeLa, untreated HeLa480 cells, and HeLa480 cells treated with EEV-PMO 221-1113.
  • FIG. 31A shows images of cells stained for RNA CUG7 foci (green) and nuclei (blue).
  • FIG. 31B is a plot quantifying the CUG7 foci per nuclear are for data associated with the images in FIG. 31A.
  • FIGS.32A-32C are plots showing the percent inclusion of exon 5 in MBNL1 (32A), exon 25 in SOS1 (32B), and exon 7 in NFIX (32C) after DM1 patient-derived cells were treated with 30 ⁇ M of EEV-PMO 221-1113.
  • FIGS.33A-33E show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion) of MBNL1 (exon 5; 33A), SOS1 (exon 25; 33B), CLASP1 (exon 19, 33C), NFIX (exon 7, 33D), and INSR (exon 11, 33E) after DM1 patient derived muscle cells were treated with various concentrations of PMO-EEV 221-1113. T- test was used to determine significance; * p ⁇ 0.05; ** p ⁇ 0.01; *** p ⁇ 0.001.
  • FIGS.34A-34D show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion) Atp2a1 (exon 22, 34A), Nfix (exon 7, 34B), Clcn1 (exon 7a, 34C), and Mbnl1 (exon 5, 34D) in the gastrocnemius tissue of mice treated with various concentrations of PMO 221 or EEV- PMO 221-1106.
  • Atp2a1 exon 22, 34A
  • Nfix exon 7, 34B
  • Clcn1 exon 7a, 34C
  • Mbnl1 exon 5, 34D
  • FIGS.35A-35C show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion or exclusion) of Mbnl1 (exon 5, 35A), Nfix (exon 7, 35B), and Atp2a1 (exon 22, 35C) in the tibialis anterior tissue of HSA-LR mice treated with either PMO-EEV 0221-1121 (21-mer) or PMO-EEV 0325-1121 (24-mer).
  • alternative RNA splicing events e.g., exon inclusion or exclusion
  • Mbnl1 exon 5, 35A
  • Nfix exon 7, 35B
  • Atp2a1 exon 22, 35C
  • FIGS.36A-36C show RT-PCR analysis of the alternative RNA splicing events (e.g., exon inclusion) of Mbnl1 (exon 5, 36A), Nfix (exon 7, 36B), and Atp2a1 (exon 22, 36C) in the gastrocnemius tissue of HSA-LR mice treated with either PMO-EEV 0221-1121 (21-mer) or PMO-EEV 0325-1121 (24-mer).
  • FIGS. 37 shows PMO-0221a, the major metabolite of PMO-EEV 220-1120 detected in vivo.
  • FIGS. 39A-39B show the percent exon inclusion in the tibialis anterior (38A) and the gastrocnemius (38B) for MBNL1 (exon 5) after Hela480 cells were treated with various concentration of EEV-PMO 221-1120.
  • FIGS. 39A-39B show the percent exon inclusion in the tibialis anterior (39A) and the gastrocnemius (39B) for NFIX (exon 7) after Hela480 cells were treated with various concentration of EEV-PMO 221-1120.
  • FIGS. 39A-39B show the percent exon inclusion in the tibialis anterior (39A) and the gastrocnemius (39B) for NFIX (exon 7) after Hela480 cells were treated with various concentration of EEV-PMO 221-1120.
  • FIGS. 40A-40B show the percent exon inclusion in the tibialis anterior (40A) and the gastrocnemius (40B) for Atp2a1 (exon 22) after Hela480 cells were treated with various concentration of EEV-PMO 221-1120.
  • FIG. 41 show images (41A) depicting RNA CUG repeat foci in Hela480 cells after treatment with various concentrations of EEV-PMO 221-1120.
  • FIG.41B is a plot of the RNA foci per nuclear area for data associated with the images of FIG. 41A.
  • FIG.43 is a bar chart showing examples of genes expressed in muscle tissue that are known to have CTG ⁇ CUG repeats.
  • FIGS. 44A-44D show phenotypic myotonia reduction in HSA-LR mouse model treated with 20 mpk PMO-EEV 221-1106.
  • FIGS. 44A and 44C show plots of relaxation.
  • FIG.44B shows an example raw force trace.
  • FIG.44D shows representative electromyography traces.
  • compounds are provided that modulate the level and/or activity of a gene transcript having an expanded CUG trinucleotide repeat.
  • the compounds of the present disclosure include at least one cyclic cell penetrating peptide (cCPP) and a therapeutic moiety (TM).
  • the cCPP faciliates entry of the TM into the cell.
  • the compound includes an ensomal escape vehicle (EEV) that comprises the cCPP and an exocyclic peptide (EP).
  • EEV ensomal escape vehicle
  • the cCPP or the EEV may permit the TM to enter the cytosol or a cellular compartment to interact with the target transcritpt.
  • the TM is the effector moitey that elicites a response.
  • the TM elicites a response by modulating the expression, activity, and/or level of a target transcript and/or a target protein.
  • the crizt transcript includes an expanded CUG trinucelotide repeat.
  • the TM modulates the levels or a target transcript and/or target protein within a cell.
  • the TM decreases the level of the target transcript and/or target protein within a cell.
  • the TM modulates the activity of the target transcript by reducing the affinity between the target transcript and one or more proteins that bind to the target transcript.
  • the TM may effectively modulate the activity of the one or more proteins that would otherwise be associated with the target transcript. For example, if the one or more proteins are not bound to the target transcript, they are available to carry out their functions on other molecules. For example, if the one or more proteins are involved in pre-mRNA processing, reducing the affinity of the one or more proteins for a transcript comprising an expanded CUG repeat may allow the one or more proteins to process pre-mRNA transcripts that do not comprise expanded CUG repeats.
  • the TM may modulate the activity, expression, and/or levels of the downstream genes (genes that do not contain the expanded CTG repeat) that are regulated by the one or more proteins whose interaction with the target transcript is disrupted by the TM.
  • the TM comprises an oligonucleotide, a peptide, an antibody, and/or a small molecule. The class and identity of the TM depends on the mechanism being used to modulate the level and/or activity of the target transcript that includes an expanded CUG trinucleotide repeat.
  • Antisense compound [0077]
  • the compounds disclosed herein comprise a cell penetrating peptide (CPP) conjugated to an antisense compound (AC).
  • antisense compound refers to an oligonucleotide sequence that is complementary, or at least partially complementary, to a target nucleotide sequence.
  • An AC is an oligonucleotide that includes natural DNA bases, modified DNA bases, natural RNA bases, modified RNA bases, natural RNA sugars, modified RNA sugars, natural DNA sugars, modified DNA sugars, natural internucleoside linkages, modified internucleoside linkages, or any combination thereof.
  • ACs include, but are not limited to, antisense oligonucleotides RNAi, microRNA, antagomirs, aptamers, ribozymes, immunostimulatory oligonucleotides, decoy oligonucleotides, supermir, miRNA mimics, miRNA inhibitors, U1 adapters, and combinations thereof.
  • the AC includes a nucleotide sequence that is at least partially complementary to a target transcript that has an expanded CUG trinucleotide repeat.
  • the AC includes a nucleotide sequence that is at least partially complementary to an expanded CUG trinucleotide repeat in a target mRNA sequence.
  • DM1 myotonic dystrophy type 1
  • FECD Fuchs' Endothelial Corneal Dystrophy
  • SCA8 Spinocerebellar Ataxia-8
  • HDL2 Huntington’s Disease-Like
  • the AC includes a nucleotide sequence that is at least partially complementary to a nucleotide sequence that is within a target mRNA transcript that includes an expanded CTG ⁇ CUG trinucleotide repeat. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to an expanded CTG ⁇ CUG trinucleotide repeat in a target mRNA transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to a nucleotide sequence that is within a DMPK1 target transcript that includes an expanded CTG ⁇ CUG trinucleotide repeat. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to a nucleotide sequence that is within a TCF4 target transcript that includes an expanded CTG ⁇ CUG trinucleotide repeat. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to a nucleotide sequence that is within a ATXN8OS/ATXN8 target transcript that includes an expanded CTG ⁇ CUG trinucleotide repeat.
  • the AC includes a nucleotide sequence that is at least partially complementary to a nucleotide sequence that is within a JPH3 target transcript that includes an expanded CTG ⁇ CUG trinucleotide repeat.
  • the AC includes a nucleotide sequence that is at least partially complementary to a trinucleotide repeat in a 3’UTR of a target mRNA transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to an expanded CTG ⁇ CUG trinucleotide repeat in a 3’UTR of a DMPK1 target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to an expanded CTG ⁇ CUG trinucleotide repeat in a 3’UTR of a ATXN8OS/ATXN8 target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to an expanded CTG ⁇ CUG trinucleotide repeat in a 3’UTR of a JPH3 target transcript. [0083] In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to trinucleotide repeats, such as CTG ⁇ CUG repeats.
  • the target nucleotide sequence comprises at least one expanded trinucleotide repeat (e.g., CTG ⁇ CUG repeats).
  • the target nucleotide sequence comprises at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, or at least 2000 CTG ⁇ CUG trinucleotide repeats.
  • the expanded trinucleotide repeat is in the 3’UTR of the target nucleotide sequence.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present in the target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, and up to 50,up to 100, up to 150, up to 200, up to 300, up to 400, up to 500, up to 600, up to 700, up to 800, up to 900, up to 1000, or up to 2000 trinucleotide repeats in a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 to 10 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 to 9 trinucleotide repeats in a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 to 8 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 to 7 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 to 6 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 5 trinucleotide repeats in a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 6 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 7 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, 8 trinucleotide repeats in a target transcript. In embodiments, the AC includes a nucleotide sequence that is complementary at least partially to, and may hybridize with, 9 trinucleotide repeats in a target transcript.
  • the AC includes a nucleotide sequence that [0085]
  • the AC may include a nucleotide sequence that is at least partially complementary to, and my hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present at any location in a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present in the 3’ UTR of a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present in the 3’ UTR of DMPK1, SCA8, and/or HDL2 target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present an intron of a target transcript.
  • the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present in the intron 3 of a TCF4 target transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present in the CTG18.1 locus of the TCF4 transcript. In embodiments, the AC includes a nucleotide sequence that is at least partially complementary to, and may hybridize with, at least a portion of the contiguous expanded trinucleotide repeats present an exon of a target transcript.
  • the AC is 5 or more, 10 or more, 15 or more, 20 or more, 25 or more, 30 or more, 35 or more, 40 or more, or 45 or more nucleic acids in length. In embodiments, the AC is 50 or less, 45 or less, 40 or less, 35 or less, 30 or less, 25 or less, 20 or less, 15 or less, or 10 or less nucleic acids in length. In embodiments, the AC is 5 to 50, 5 to 45, 5 to 40, 5 to 35, 5 to 30, 5 to 25, 5 to 20, 5 to 15, or 5 to 10 nucleic acids in length.
  • the AC is 10 to 50, 10 to 45, 10 to 40, 10 to 35, 10 to 30, 10 to 25, 10 to 20, or 10 to 15 nucleic acids in length. In embodiments, the AC is 15 to 50, 15 to 45, 15 to 40, 15 to 35, 15 to 30, 15 to 25, or 15 to 20 nucleic acids in length. In embodiments, the AC is 20 to 50, 20 to 45, 20 to 40, 20 to 35, 20 to 30, or 20 to 25 nucleic acids in length. In embodiments, the AC is 25 to 50, 25 to 45, 25 to 40, 25 to 35, or 25 to 30 nucleic acids in length. In embodiments, the AC is 30 to 50, 30 to 45, 30 to 40, or 30 to 35 nucleic acids in length.
  • the AC is 35 to 50, 35 to 45, or 35 to 40 nucleic acids in length. In embodiments, the AC is 40 to 50 or 40 to 45 nucleic acids in length. In embodiments, the AC is 45 to 50 nucleic acids in length. In embodiments, the AC is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleic acids in length. [0087] In embodiments, the AC has 100% complementarity to a target nucleotide sequence.
  • the AC does not have 100% complementarity to a target nucleotide sequence.
  • percent complementarity refers to the number of nucleobases (e.g., natural nucleobase or modified nucleobase) of an AC that have nucleobase complementarity with a corresponding nucleobase of an oligomeric compound or nucleic acid (e.g., a target nucleotide sequence) divided by the total length (number of nucleobases) of the AC.
  • nucleobases e.g., natural nucleobase or modified nucleobase
  • nucleic acid e.g., a target nucleotide sequence
  • the AC includes 20% or less, 15% or less, 10% or less, 5% or less, or zero mismatches to the target nucleotide sequence. In some embodiments, the AC includes 5% or more, 10% or more, or 15% or more mismatched. In embodiments, the AC includes zero to 5%, zero to 10%, zero to 15%, or zero to 20% mismatches to the target nucleotide sequence. In embodiments, the AC includes 5% to 10%, 5% to 15%, or 5% to 20% mismatches to the target nucleotide sequence. In embodiments, the AC includes 10% to 15% or 10% to 20% mismatches to the target nucleotide sequence.
  • the AC includes 10% to 20% mismatches to the target nucleotide sequence.
  • the AC has 80% or greater, 85% or greater, 90% or greater, 95% or greater, 96% or greater, 97% or greater, 98% or greater, or 99% or greater complementarity to a target nucleotide sequence.
  • the AC has 100% or less, 99% or less, 98% or less, 97% or less 96% or less 95% or less, 90% or less, 85% or less complementarity to a target nucleotide sequence.
  • the AC has 80% to 100%, 80% to 99%, 80% to 98%, 80% to 97% 80% to 96%, 80% to 95%, 80% to 90% or 80% to 85% complementarity to a target nucleotide sequence. In embodiments, the AC has 85% to 100%, 85% to 99%, 85% to 98%, 85% to 97% 85% to 96%, 85% to 95%, or 85% to 90% complementarity to a target nucleotide sequence. In embodiments, the AC has 90% to 100%, 90% to 99%, 90% to 98%, 90% to 97%, 90% to 96%, or 90% to 95% complementarity to a target nucleotide sequence.
  • the AC has 95% to 100%, 95% to 99%, 95% to 98%, 95% to 97%, or 95% to 96% complementarity to a target nucleotide sequence. In embodiments, the AC has 96% to 100%, 96% to 99%, 96% to 98%, or 96% to 97% complementarity to a target nucleotide sequence. In embodiments, the AC has 97% to 100%, 97% to 99%, or 97% to 98% complementarity to a target nucleotide sequence. In embodiments, the AC has 98% to 100% or 98% to 99% complementarity to a target nucleotide sequence. In embodiments, the AC has 99% to 100% complementarity to a target nucleotide sequence.
  • incorporation of nucleotide affinity modifications allows for a greater number of mismatches compared to an unmodified compound.
  • certain oligonucleotide sequences may be more tolerant to mismatches than other oligonucleotide sequences.
  • One of ordinary skill in the art is capable of determining an appropriate number of mismatches between an AC and a target nucleotide sequence, such as by determining the thermal melting temperature (Tm). Tm or ⁇ Tm can be calculated by techniques that are familiar to one of ordinary skill in the art. For example, techniques described in Freier et al.
  • the AC includes a nucleotide sequence that in itself is a trinucleotide repeat, that is, a CAG trinucleotide repeat.
  • the reverse complement of a 5’-CAG-3’ has 100% complementarity and may hybridize with a 5’-CUG-3’ trinucleotide repeat.
  • the AC includes one to 50 CAG repeats.
  • the CAG repeats are contiguous. In embodiments, the CAG repeats are not contiguous.
  • the AC includes a nucleotide sequence that includes incomplete CAG repeats on either the 5’ or 3’ end.
  • the AC includes a sequence such as AG(CAG) n , G(CAG) n , (CAG) n AG, or (CAG) n A where n is an integer from 1 to 50.
  • the AC includes a nucleotide sequence that includes one or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 20 or more, 30 or more, or 50 or more CAG repeats.
  • the AC includes a nucleotide sequence that includes 50 or less, 40 or less, 30 or less, 20 or less, 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less CAG repeats.
  • the AC includes a nucleotide sequence that includes 2 to 50, 2 to 20, 2 to 10, 4 to 10, 5 to 10, 6 to 10, 6 to 9, 6 to 8, or 6 to 7 CAG repeats.
  • the AC includes any one of the nucleotide sequences in Table 2 (SEQ ID NO: 151-291). Table 2: CAG repeat AC nucleotide sequences
  • an AC that has a nucleotide that includes CAG repeats may include additional nucleotide sequences on the 5’ end, 3’ end, or both, of the CAG repeat.
  • the additional nucleotide sequences may have 80% to 100% or 95% to 100% complementarity to portions of the target transcript to which they hybridize.
  • the additional nucleotide sequences may be added to a CAG repeat nucleotide sequence in order to increase the selectivity of the AC for hybridizing to a specific target transcript.
  • the AC includes a nucleotide sequence that includes 1 to 50 CAG repeats and that is a gapmer.
  • Gapmers are oligonucleotides that are a DNA/RNA hybrid and that induce RNase decay mechanism.
  • gapmers may have a central DNA or DNA mimic segment that is flanked by an RNA or RNA mimic segment on both the 5’ and 3’ ends of the DNA or DNA mimetic segment.
  • the AC includes a gapmer that includes a nucleotide sequence that hybridizes with a target nucleic acid sequence of the target transcript that is separate from the expanded CUG repeat of the target transcript.
  • an AC of the disclosure is a gapmer oligonucleotide as disclosed in U.S. Patent No. 9,550,988, the disclosure of which is incorporated by reference herein.
  • an AC of the disclosure comprises the sequence and/or structure of any one of the ACs targeting DMPK disclosed in U.S. Patent Publication No. 2017/0260524, the disclosure of which is incorporated by reference herein. [0096] In embodiments, an AC of the disclosure comprises the sequence and/or structure of any one of the ACs or oligonucleotides disclosed in U.S.
  • the expression level can be quantified using RPM (reads per million) mRNA expression is FPKM (Fragments per kilo base of transcript per million mapped fragments) and protein expression is pTPM (transcripts per million protein coding genes), using greater than 10 RPM as the cutoff for non-insignificant expression.
  • FIG.43 shows the results of such an in-silico analysis. Thirty-six genes show an expression level of > 10 RPM. Of the 36 genes, only three genes (besides DMPK) had > 10 CTG ⁇ CUG repeats. Genes with d 10 CTG ⁇ CUG repeats represent the lowest risk for off-target binding and toxicity.
  • CTG ⁇ CUG repeats (11-24) in these 3 genes is nonetheless significantly lower than that seen in classic and congenital DM1 patients.
  • late-onset DM1 patients have 100- 600 CTG ⁇ CUG repeats on DMPK
  • classical DM1 patients have 250-750 CTG ⁇ CUG repeats on DMPK
  • congenital DM1 patients have 750-1,400 CTG ⁇ CUG repeats on DMPK.
  • the same in-silico analysis may be performed for the liver and kidney.
  • CASK is the only significant gene with > 10 CTG ⁇ CUG repeats in the kidney. No genes with > 10 CTG ⁇ CUG repeats were significant in the liver.
  • the ACs described herein may contain one or more asymmetric centers and thus give rise to enantiomers, diastereomers, and other stereoisomeric configurations that may be defined, in terms of absolute stereochemistry, as (R) or (S); D or E; or as (D) or (L). Included in the antisense compounds provided herein are all such possible isomers, as well as their racemic and optically pure forms. [0099] The efficacy of the ACs may be assessed by evaluating the antisense activity effected by their administration. As used herein, the term "antisense activity" refers to any detectable and/or measurable activity attributable to the hybridization of an antisense compound to its target nucleotide sequence.
  • antisense activity is assessed by detecting and or measuring the amount of the protein expressed from the transcript of interest. In embodiments, antisense activity is assessed by detecting and/or measuring the amount of the transcript of interest. In embodiments, antisense activity is assessed by detecting and/or measuring the amount of alternatively spliced RNA and/or the amount of protein isoforms translated from the target transcript.
  • AC mechanisms of modulation [0100] In embodiments, the AC may modulate the activity and/or level of the target transcript within the cell.
  • FIG. 1 shows exemplary mechanisms of how an AC can modulate level and/or activity of a target transcript.
  • the AC may modulate the level of the target transcript within a cell.
  • the AC is a gamper
  • binding of the AC to the target transcript induces the degradation of the target transcript via RNase H pathways (FIG. 1, arrows A and B).
  • the gapmer hybridizes to a portion of the target transcript that is distinct from the expanded CUG trinucleotide repeat and thereby induces degradation of the target transcript via RNase H pathways (FIG.1, Arrow A).
  • the gapmer hybridizes to at least a portion of the expanded CUG repeat withing the target transcript and thereby induces degradation of the target transcript via RNase H pathways (FIG. 1, Arrow B).
  • the AC may modulate the activity of the target transcript.
  • Modulation of activity may include increasing or decreasing the ability of the target transcript to bind with a binding partner.
  • the AC may modulate the activity of the target transcript by decreasing the ability of the target transcript to bind with one or more proteins that may associate with the transcript, particularly proteins that associate with at least a portion of the expanded CUG repeat of a target transcript (FIG.1, arrow C).
  • decreasing the ability of the target transcript to bind with one or more proteins includes decreasing the affinity of the target transcript for the one or more proteins.
  • decreasing the ability of the target transcript to bind with one or more proteins includes partial or full steric blocking of the target transcript from binding the one or more proteins.
  • the AC may occupy at least a portion of the binding site that may be occupied by the one or more proteins if not sterically blocked.
  • the binding site of the one or more proteins to the target transcript includes at least a portion of the expanded trinucleotide repeat of the target transcript.
  • the AC may occupy at least a portion of the expanded trinucleotide repeat (e.g., expanded CUG repeat) that may be occupied by the one or more proteins if not sterically blocked. Partial steric blocking of the target transcript may result in decreased affinity between the target transcript and the one or more proteins.
  • the AC binds to at least a portion of the expanded CUG repeat of the target transcript thereby sterically blocking and/or decreasing the affinity of target transcript for a protein that may bind to the expanded CUG repeat (FIG. 1, arrow C).
  • the following review article describes additional applications for steric blocking antisense oligonucleotides and is incorporated by reference herein in its entirety: Roberts et al. Nature Reviews Drug Discovery (2020) 19: 673-694.
  • the CUG repeats of an expanded CUG repeat may form a double stranded hairpin structure. In the disease state, proteins bind to the double stranded hairpin structure and become sequestered and unable to perform other functions.
  • the AC binds to at least a portion of the double stranded hairpin structure thereby sterically blocking and/or decreasing the affinity of the double stranded hairpin structure for a protein binding partner. In embodiments, the AC binds to at least a portion of a single stranded expanded CUG repeat thereby inhibiting the formation of the double stranded hairpin structure, and thus, inhibiting one or more protein from binding to the double stranded hairpin structure. In embodiments, hybridization of the AC to the double hairpin structure sterically blocks and/or decreases the affinity for one or more proteins for binding to the double hairpin structure.
  • hybridization of the AC to at least a portion of a single stranded region of the expanded trinucleotide repeat inhibits the formation of a double stranded hairpin structure.
  • Decreasing the ability of the target transcript to bind with the one or more proteins may allow the one or more proteins to carry out other functions such as, for example, regulating splicing of downstream transcripts (transcripts that do not contain an expanded CUG repeat).
  • decreasing the ability of the target transcript to bind with the one or more proteins may increase the level of the one or more proteins within the cell that are available to provide other functions or function on other transcripts.
  • decreasing the ability of the target transcript to bind with the one or more proteins may increase the cytosolic level of the one or more proteins within the cell that are available to provide other functions or function on other transcripts. Therefore, in embodiments, binding of the AC to the target transcript may result in the modulation of the level and/or activity of the one or more proteins that interact with the target transcript.
  • hybridization of the AC to at least a portion of the expanded CUG repeat decreases the affinity and or sterically blocks the binding of MNBL1 to the target transcript.
  • MNBL1 is a splicing factor that regulates the splicing of downstream gene transcripts.
  • MNBL1 In a DM1 disease phenotype, MNBL1 binds to the expanded CUG repeat of a target transcript. While bound to target transcript, MNBL1 is sequestered in the nucleus and is not able to regulate the splicing of downstream gene transcripts (transcripts that do not contain an expanded CUG repeat). In embodiments, hybridization of the AC to at least a portion of the expanded CUG repeat in target transcript, sterically blocks and/or decreases the affinity of MNBL1 for the target transcript, thereby allowing it to regulate splicing of downstream gene transcripts.
  • hybridization of the AC to at least a portion of the expanded CUG repeat in the target transcript sterically blocks and/or decreases the affinity of MNBL1 for the target transcript, thereby increasing the amount of free (e.g., not bound to a transcript having a CUG repeat) MNBL1.
  • hybridization of the AC to at least a portion of the expanded CUG repeat in the target transcript sterically blocks and/or decreases the affinity of MNBL1 for the target transcript, thereby decreasing the amount of MBNL1 bound to and sequestered by the target transcript.
  • MNBL1 is a splicing factor that regulates the splicing of downstream gene transcripts.
  • MNBL1 binds to the expanded CUG repeat of DMPK1. While bound to DMPK1, MNBL1 is sequestered in the nucleus and is not able to regulate the splicing of downstream gene transcripts (transcripts that do not contain an expanded CUG repeat).
  • hybridization of the AC to at least a portion of the expanded CUG repeat in DMPK sterically blocks and/or decreases the affinity of MNBL1 for the DMPK transcript, thereby allowing it to regulate splicing of downstream gene transcripts.
  • hybridization of the AC to at least a portion of the expanded CUG repeat in DMPK sterically blocks and/or decreases the affinity of MNBL1 for the DMPK transcript, thereby increasing the amount of free (e.g., not bound to a transcript having a CUG repeat) MNBL1.
  • hybridization of the AC to at least a portion of the expanded CUG repeat in DMPK sterically blocks and/or decreases the affinity of MNBL1 for the DMPK transcript, thereby decreasing the amount of MBNL1 bound to and sequestered by the DMPK1 transcript.
  • hybridization of the AC to at least a portion of the expanded CUG repeat results in the decrease of CUGBP1 levels.
  • the level of free MBNL1 (able to function) decreases while the level of free (able to function) of CUGBP1 increases.
  • An increase in CUGBP1 levels is associated with the disease state.
  • hybridization of the AC to at least a portion of the expanded CUG repeat results in increased levels of free (able to function) MBNL1 and/or a decrease in free (able to function) CUGBP1 levels.
  • Decreasing the ability of the target transcript to bind with the one or more proteins, may reduce, or inhibit the formation of CUG repeat foci.
  • Transcripts that include expanded nucleotide repeats e.g., expanded CUG repeats
  • Proteins that bind to the transcript may then being to nucleate on sequestered transcript and/or sequester transcript aggregate thereby forming expanded nucleotide repeat (e.g., CUG repeat) foci.
  • the CUG repeat foci may be visible using microscopy.
  • decreasing the ability of the target transcript to bind with the one or more proteins may reduce, or inhibit the formation of aggregates that include the target transcript.
  • decreasing the ability of the target transcript to bind with the one or more proteins may reduce, or inhibit the nucleation of the one or more proteins on the target transcript, on a double stranded hairpin region of a transcript, or on an aggregate of target transcripts.
  • decreasing the ability of the DMPK1 target transcript to bind with MNBL1 may reduce, or inhibit the nucleation MNBL1 on a DMPK1 target transcript or DMPK1 target transcript aggregate.
  • hybridization of the AC to the target transcript may result in inhibition or reduction in formation of CUG repeat nuclear foci.
  • hybridization of the AC to the target transcript may result in inhibition or reduction in formation of CUG repeat nuclear foci formed from a DMPK, TCF4, JPH3, and/or ATXN8OS/ATXN8 target transcript.
  • hybridization of the AC to the target transcript may result in the modulation of the level, expression, and/or activity of one or more downstream genes.
  • hybridization of the AC to the target transcript may be used to induce target transcript degradation or sterically block or decreases the affinity of the target transcript for one or more proteins, thereby allowing the one or more proteins that were sequestered by the target transcript to regulate the expression, level, and/or activity of downstream genes.
  • the one or more proteins may include a protein that is involved in regulating the splicing of one or more downstream transcripts (transcripts that do not contain an expanded CUG repeat).
  • the splicing of downstream transcripts is altered when the protein involved in splicing is bound and sequestered on the target transcript.
  • alteration of splicing may include the exclusion of one or more exons or the inclusion of one or more introns in a transcript thereby leading to the expression of various protein isoforms.
  • the alteration of splicing may result in the inclusion of an exon and/or intron that includes a premature stop codon thereby resulting in a truncated isoform that may have no or deleterious activity.
  • Alteration of downstream gene transcript splicing may lead to a change in level, folding, and/or activity of the downstream gene product which may be associated with a disease phenotype.
  • the protein involved in splicing is free to regulate splicing which may results in a correction (or rescue) of the splicing of the downstream gene transcript, thereby at least partially restoring the protein level, folding, and/or activity of the downstream gene product associated with a healthy phenotype.
  • AC hybridization to the target transcript may result in the modulation of the splicing of downstream gene transcripts that are regulated by proteins that are sequestered by the target transcript in a disease state associated with expanded nucleotide repeats (e.g., expanded trinucleotide repeats).
  • downstream gene transcripts are often mis-processed, for example, mis-spliced.
  • the mis-splicing leads of the downstream gene transcripts may lead to gene products that are destroyed before translation or translated into proteins that have aberrant structure and/or function.
  • sequestration of proteins that regulate the processing of downstream gene transcripts may lead to the inclusion of exons and/or introns with premature stop codons, the inclusion of introns, the exclusion of exons, and/or the inclusion of alternative exons, which may lead to a transcript and or gene product that is destroyed prior to translation or that is translated into an gene product with aberrant function.
  • AC hybridization to the target transcript may result in the modulation of exon inclusion, exon exclusion, intron inclusion, and/or intron exclusion in downstream transcripts whose splicing is regulated by proteins that are sequestered to the target transcript during a disease state.
  • hybridization of the AC to the target transcript may result in the upregulation of downstream protein isomers and/or transcripts associated with a healthy phenotype.
  • hybridization of the AC to the target transcript may result in the downregulation (e.g., suppression) of downstream transcripts and/or protein isomers associated with a disease phenotype.
  • AC hybridization to the target transcript may result in the modulation of the splicing of downstream gene transcripts that are regulated by proteins that are sequestered by the DMPK target transcript during a disease state.
  • DM1 several downstream gene transcripts are mis-spliced leading. The mis-spliced genes are associated with the disease phenotype.
  • modulation of gene splicing may include correcting (e.g., rescuing) the splicing of genes to result in gene products of downstream genes that are associated with a healthy phenotype.
  • the target transcript is DMPK
  • AC hybridization to the target transcript may result in the modulation of the splicing of downstream gene transcripts that are regulated by MNBL1, a splicing regulator that is sequestered by the DMPK target transcript during a disease state.
  • AC hybridization to the target transcript may result in the modulation of the splicing of downstream gene transcripts that are regulated by CUGBP1, a protein whose activity is affected by expanded CUG repeats.
  • AC hybridization to the target transcript may result in the correct processing (e.g., splicing) of downstream genes that are regulated by MNBL1 and/or CUGBP1.
  • AC hybridization to the target transcript may result in the modulation of splicing of downstream genes including, but not limited to, 4833439L19Rik, Abcc9, Atp2a1, Arhgef10, Arhgap28, Armcx6, Angel1, Best3, Bin1, Brd2, Cacna1s, Cacna2d1, Cpd, Cpeb3, Ccpg1, Clasp1, ClC-1, Clcn1, Clk4, Cpeb2, Camk2g, Capzb, Copz2, Coch, cTNT, Ctu2, Cyp2s1, Dctn4, Dnm1l, Eya4, Efna3, Efna2, Fbxo31, Fbxo21,
  • MNBL1 is a splicing factor with loss of function in DM1 due to exon 5 inclusion. MNBL1 is sequestered by DMPK CUG expansion and forms RNA nuclear foci. Additionally, SOS1 promotes Ras activation to positively regulate RAS/MAPK signaling pathway. In DM1, exon 25 of SOS1 is excluded leading to inhibition of muscle hypertrophy pathways. In DM1, IR/INSR has exon 11 exclusion, which results in higher levels of low-signaling non-muscle isoform and decreased metabolic response to insulin in DM1 (insulin resistance).
  • exon 78 exclusion of DMD is observed in DM.
  • Exon 78 exclusion results in out-of-frame transcript at C-terminal domain.
  • This mutated protein is expressed in DM1 patients and associated with a mechanism responsible for muscle wasting in patients.
  • BIN1 is required for proper muscle T-tubule formation (EC coupling).
  • Exon 11 exclusion produces inactive isoform and is found in DM1 patients.
  • LDB3 interacts with ⁇ -actinin at the Z-disc in striated muscle and maintains muscle structure.
  • Exon 11 inclusion of LDB3 detected in DM1 results in reduction of affinity for Protein kinase C (PKC). Consequently, PKC becomes hyperactive in DM1.
  • PKC Protein kinase C
  • modulation of one or more downstream genes results in the correction, or rescue, of transcript splicing that is associated with a healthy phenotype.
  • hybridization of the AC to the DMPK target transcript results in the rescue of mis-splicing of downstream genes/transcripts, thereby, reducing the level of downstream genes/transcripts associated with a disease phenotype.
  • hybridization of the AC to the DMPK target transcript results in the rescue of mis-splicing of downstream genes/transcripts, thereby, increasing the level of downstream genes/transcripts associated with a healthy phenotype.
  • the AC inhibits expression of the target transcript.
  • the AC inhibits expression of the target transcript by blocking the pre-mRNA processing machinery and/or translation machinery from accessing and/or completing translation and/or pre-mRNA processing. In embodiments, the AC inhibits expression of the target transcript by inducing degradation of the target transcript, for example, through RNase H pathways.
  • AC structure [0114] The AC includes an oligonucleotide and/or an oligonucleoside. Oligonucleotides and/or oligonucleotides are nucleotides or nucleosides linked through internucleoside linkages. Nucleosides include a pentose sugar (e.g., ribose or deoxyribose) and a nitrogenous base covalently attached to sugar.
  • the naturally occurring (or traditional basses) bases found in DNA and/or RNA are adenine (A), guanine (G), thymine (T), cytosine (C), and uracil (U).
  • the naturally occurring nucleoside linkage (or traditional internucleoside linkage) is a phosphodiester bond.
  • the ACs of the present disclosure may have all natural sugars, bases, and internucleoside linkages.
  • nucleosides are routinely used for incorporation into antisense compounds to enhance one or more properties, such as nuclease resistance, pharmacokinetics, or affinity for a target RNA.
  • the ACs of the present disclosure may have one or more modified nucleosides.
  • the ACs of the present disclosure may have one or more modified sugars.
  • the ACs of the present disclosure may have one or more modified bases.
  • the ACs of the present disclosure may have one or more modified internucleoside linkages.
  • a nucleobase is any group that contains one or more atom or groups of atoms capable of hydrogen bonding to a base of another nucleic acid.
  • modified nucleobase refers to a nucleobase that is fairly similar in structure to the parent nucleobase, such as for example a 7-deaza purine, a 5-methyl cytosine, 2-thio-dT (FIG.2) or a G- clamp.
  • a nucleobase mimetic is a nucleobase that includes a structure that is more complicated than a modified nucleobase, such as for example a tricyclic phenoxazine nucleobase mimetic. Methods for preparation of the above noted modified nucleobases are well known to those skilled in the art.
  • the AC may include one or more nucleosides having a modified sugar moiety.
  • the furanosyl sugar of a natural nucleoside may have a 2’ modification, modifications to make a constrained nucleoside, and others (see FIG. 2).
  • the furanosyl sugar ring of a natural nucleoside can be modified in a number of ways including, but not limited to, addition of a substituent group, bridging of two non-geminal ring atoms to form a bicyclic nucleic acid (BNA) or a locked nucleic acid; exchanging the oxygen of the furanosyl ring with C or N; and/or substitution of an atom or group such (see FIG. 2).
  • BNA bicyclic nucleic acid
  • Modified sugars are well known and can be used to increase or decrease the affinity of the AC for its target nucleotide sequence. Modified sugars may also be used increase AC resistance to nucleases. Sugars can also be replaced with sugar mimetic groups among others.
  • one or more sugars of the nucleosides of the AC is replaced with a methylenemorpholine ring as shown as 19 in FIG. 2.
  • the AC includes one or more nucleosides that include a bicyclic modified sugar (BNA; sometimes called bridged nucleic acids).
  • BNA bicyclic modified sugar
  • BNAs include, but are not limited to LNA (4'-(CH 2 )-O-2' bridge), 2'-thio-LNA (4'-(CH 2 )-S-2' bridge), 2'-amino-LNA (4'- (CH 2 )-NR-2' bridge), ENA (4'-(CH 2 ) 2 -O-2' bridge), 4'-(CH 2 ) 3 -2' bridged BNA, 4'-(CH 2 CH(CH 3 ))- 2' bridged BNA" cEt (4'-(CH(CH 3 )-O-2' bridge), and cMOE BNAs (4'-(CH(CH 2 OCH 3 )-O-2' bridge).
  • BNA's have been prepared and disclosed in the patent literature as well as in scientific literature (Srivastava, et al. J. Am. Chem. Soc. (2007), ACS Advanced online publication, 10.1021/ja071106y; Albaek et al. J. Org. Chem. (2006), 71, 7731 -7740; Fluiter, et al. Chembiochem (2005), 6, 1104-1109; Singh et al., Chem. Commun. (1998), 4, 455-456; Koshkin et al., Tetrahedron (1998), 54, 3607-3630; Wahlestedt et al., Proc. Natl. Acad. Sci. U.S.A.
  • the AC includes one or more nucleosides that include a locked nucleic acid (LNA).
  • LNAs the 2'-hydroxyl group of the ribosyl sugar ring is linked to the 4' carbon atom of the sugar ring thereby forming a 2'-C,4'-C-oxymethylene linkage to form the bicyclic sugar moiety (reviewed in Elayadi et al., Curr. Opinion Invens. Drugs (2001), 2, 558-561; Braasch et al., Chem. Biol. (2001), 81-7; and Orum et al., Curr. Opinion Mol. Ther. (2001), 3, 239-243; see also U.S.
  • the linkage can be a methylene (-CH 2 -) group bridging the 2' oxygen atom and the 4' carbon atom, for which the term LNA is used for the bicyclic moiety; in the case of an ethylene group in this position, the term ENATM is used (Singh et al., Chem. Commun. (1998), 4, 455-456; ENATM; Morita et al., Bioorganic Medicinal Chemistry (2003), 11, 2211-2226).
  • Tm +3 to +10 °C
  • Potent and nontoxic antisense oligonucleotides containing LNAs have been described (Wahlestedt et al., Proc. Natl. Acad. Sci. U.S.A. (2000), 97, 5633-5638).
  • An isomer of LNA that has also been studied is alpha-L-LNA which has been shown to have superior stability against a 3'-exonuclease.
  • the alpha-L-LNA's were incorporated into antisense gapmers and chimeras that showed potent antisense activity (Frieden et al., Nucleic Acids Research (2003), 21, 6365-6372).
  • the synthesis and preparation of the LNA monomers adenine, cytosine, guanine, 5-methyl- cytosine, thymine and uracil, along with their oligomerization, and nucleic acid recognition properties have been described (Koshkin et al., Tetrahedron, 1998, 54, 3607-3630). LNAs and preparation thereof are also described in WO 98/39352 and WO 99/14226.
  • Patents 4,981,957; 5,118,800; 5,319,080; 5,359,044; 5,393,878; 5,446,137; 5,466,786; 5,514,785; 5,519,134; 5,567,811; 5,576,427; 5,591,722; 5,597,909; 5,610,300; 5,627,053; 5,639,873; 5,646,265; 5,658,873; 5,670,633; 5,792,747; 5,700,920; and 6,600,032; and WO 2005/121371.
  • internucleoside linking groups that link the nucleosides or otherwise modified nucleoside monomer units together thereby forming an oligonucleotide and/or an oligonucleotide containing AC.
  • the ACs may include naturally occurring internucleoside linkages, unnatural internucleoside linkages, or both.
  • the internucleoside linking group is a phosphodiester that covalently links adjacent nucleosides to one another to form a linear polymeric compound.
  • phosphodiester is linked to the 2', 3' or 5' hydroxyl moiety of the sugar.
  • the phosphate groups are commonly referred to as forming the internucleoside backbone of the oligonucleotide.
  • the linkage or backbone of RNA and DNA is a 3' to 5' phosphodiester linkage.
  • the internucleoside linking groups of the ACs are phosphodiesters.
  • the internucleoside linking groups of the ACs are 3' to 5' phosphodiester linkages.
  • the two main classes of unnatural internucleoside linking groups are defined by the presence or absence of a phosphorus atom.
  • Representative phosphorus containing internucleoside linkages include, but are not limited to, phosphotriesters, methylphosphonates, phosphoramidate, and phosphorothioates.
  • Representative non-phosphorus containing internucleoside linking groups include, but are not limited to, methylenemethylimino (-CH 2 -N(CH 3 )-O-CH 2 -), thiodiester (-O- C(O)-S-), thionocarbamate (-O-C(O)(NH)-S-); siloxane (-O-Si(H 2 -O-); and N,N'- dimethylhydrazine (-CH 2 -N(CH 3 )-N(CH 3 )-).
  • ACs having phosphorus internucleoside linking groups are referred to as oligonucleotides.
  • Antisense compounds having non-phosphorus internucleoside linking groups are referred to as oligonucleosides.
  • Modified internucleoside linkages compared to natural phosphodiester linkages, can be used to alter, typically increase, nuclease resistance of the antisense compound.
  • Internucleoside linkages having a chiral atom can be prepared as racemic, chiral, or as a mixture. Representative chiral internucleoside linkages include, but are not limited to, alkylphosphonates and phosphorothioates.
  • two or more nucleosides having modified sugars and/or modified nucleobases may be joined using a phosphoramidate.
  • two or more nucleosides having a methylenemorpholine ring may be connected through a phosphoramidate internucleoside linkage.
  • Antisense compounds that include nucleobases with a methylenemorpholine ring that are linked through phosphoramidate internucleoside linkage may be referred to as phosphoramidate morpholino oligomers (PMOs).
  • ACs are modified by covalent attachment of one or more conjugate groups.
  • conjugate groups modify one or more properties of the attached AC including but not limited to pharmacodynamic, pharmacokinetic, binding, absorption, cellular distribution, cellular uptake, charge and clearance.
  • Conjugate groups are routinely used in the chemical arts and are linked directly or via an optional linking moiety or linking group to a parent compound such as an AC.
  • Conjugate groups include without limitation, intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, thioethers, polyethers, cholesterols, thiocholesterols, cholic acid moieties, folate, lipids, phospholipids, biotin, phenazine, phenanthridine, anthraquinone, adamantane, acridine, fluoresceins, rhodamines, coumarins and dyes.
  • the conjugate group is a polyethylene glycol (PEG), and the PEG is conjugated to either the AC or the CPP (CPP discussed elsewhere herein).
  • conjugate groups include lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acad. Sci. USA (1989), 86, 6553); cholic acid (Manoharan et al., Bioorg. Med. Chem. Lett. (1994), 4, 1053); a thioether, e.g., hexyl-S-tritylthiol (Manoharan et al., Ann. N.Y. Acad. Sci. (1992), 660, 306; Manoharan et al., Bioorg. Med. Chem. Let.
  • lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acad. Sci. USA (1989), 86, 6553); cholic acid (Manoharan et al., Bioorg. Med. Chem. Lett. (1994), 4, 1053); a thioether, e.g.
  • a phospholipid e.g., di-hexadecyl-rac-glycerol or triethylammonium-1,2-di-O-hexadecyl-rac- glycero-3-H-phosphonate (Manoharan et al., Tetrahedron Lett. (1995), 36, 3651; Shea et al., Nucl. Acids Res.
  • AC Antisense Oligonucleotide
  • ASO antisense oligonucleotide
  • ASO antisense oligonucleotide
  • ASOs that may not be fully complementary to the desired target nucleotide sequence.
  • ASOs include single strands of DNA and/or RNA that are complementary to a chosen target nucleotide sequence or a target gene.
  • ASOs may include one or more modified DNA and/or RNA bases, modified sugars, and/or unnatural internucleoside linkages.
  • the ASOs may include one or more phosphoramidate internucleoside linkages.
  • the ASO is phosphoramidate morpholino oligomers (PMOs).
  • ASOs may have any characteristic, be any length, bind to any target nucleotide sequence and/or sequence element, and effect any mechanism as described relative to an AC.
  • Antisense oligonucleotides have been demonstrated to be effective as targeted inhibitors of protein synthesis, and, consequently, can be used to specifically inhibit protein synthesis by a targeted gene.
  • the efficacy of ASO for inhibiting protein synthesis is well established. To date, these compounds have shown promise in several in vitro and in vivo models, including models of inflammatory disease, cancer, and HIV (Agrawal, Trends in Biotech. (1996), 14:376-387). Antisense can also affect cellular activity by hybridizing specifically with chromosomal DNA.
  • antisense oligonucleotides are known in the art and can be readily adapted to produce an antisense oligonucleotide that targets any polynucleotide sequence. Selection of antisense oligonucleotide sequences specific for a given target sequence is based upon analysis of the chosen target sequence and determination of secondary structure, Tm, binding energy, and relative stability. Antisense oligonucleotides may be selected based upon their relative inability to form dimers, hairpins, or other secondary structures that would reduce or prohibit specific binding to the target mRNA in a host cell.
  • Target regions of the mRNA include those regions at or near the AUG translation initiation codon and those sequences that are substantially complementary to 5' regions of the mRNA. These secondary structure analyses and target site selection considerations can be performed, for example, using v.4 of the OLIGO primer analysis software (Molecular Biology Insights) and/or the BLASTN 2.0.5 algorithm software (Altschul et ai, Nucleic Acids Res. 1997, 25(17):3389-402).
  • RNA Interference [0135]
  • the AC includes a molecule that mediates RNA interference (RNAi).
  • RNAi mediates RNA interference
  • RNAi machinery or process uses the RNAi machinery or process and a guide RNA, e.g., an siRNA compound of from about 21 to about 23 nucleotides.
  • the AC targets the target transcript for degradation.
  • RNAi molecule may be used to disrupt the expression of a gene or polynucleotide of interest.
  • RNAi molecule is used to induce degradation of the target transcript, such as a pre-mRNA or a mature mRNA.
  • the AC includes a small interfering RNA (siRNA) that elicits an RNAi response.
  • siRNAs Small interfering RNAs
  • RISC RNAi-induced silencing complex
  • siRNAs function through a natural mechanism evolved to control gene expression through non-coding RNA.
  • RNAi reagents including siRNAs targeting clinically relevant targets, are currently under pharmaceutical development, as described, e.g., in de Fougerolles, A.
  • RNAi molecules are RNA:RNA hybrids that include both an RNA sense and an RNA antisense strand
  • DNA sense:RNA antisense hybrids RNA sense:DNA antisense hybrids
  • DNA:DNA hybrids are capable of mediating RNAi (Lamberton, J.S. and Christian, A.T., Molecular Biotechnology (2003), 24:111- 119).
  • RNAi molecules are used that include any of these different types of double-stranded molecules.
  • RNAi molecules may be used and introduced to cells in a variety of forms.
  • RNAi molecules encompasses any and all molecules capable of mediating an RNAi in cells, including, but not limited to, double-stranded oligonucleotides that include two separate strands, i.e. a sense strand and an antisense strand, e.g., small interfering RNA (siRNA); double-stranded oligonucleotide that includes two separate strands that are linked together by non-nucleotidyl linker; oligonucleotides that include a hairpin loop of complementary sequences, which forms a double-stranded region, e.g., shRNAi molecules, and expression vectors that express one or more polynucleotides capable of forming a double-stranded polynucleotide alone or in combination with another polynucleotide.
  • siRNA small interfering RNA
  • shRNAi molecules expression vectors that express one or more polynucleotides capable of forming a double-strand
  • a "single strand siRNA compound” as used herein, is an siRNA compound which is made up of a single molecule. It may include a duplexed region, formed by intra-strand pairing, e.g., it may be, or include, a hairpin or pan-handle structure. Single strand siRNA compounds may be antisense with regard to the target molecule. [0140] A single strand siRNA compound may be sufficiently long that it can enter the RISC and participate in RISC mediated cleavage of a target mRNA. A single strand siRNA compound is at least about 14, at least about 15, at least about 20, at least about 25, at least about 30, at least about 35, at least about 40, or up to about 50 nucleotides in length.
  • the single strand siRNA is less than about 200, about 100, or about 60 nucleotides in length.
  • Hairpin siRNA compounds may have a duplex region equal to or at least about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, or about 25 nucleotide pairs.
  • the duplex region may be equal to or less than about 200, about 100, or about 50 nucleotide pairs in length.
  • ranges for the duplex region are from about 15 to about 30, from about 17 to about 23, from about 19 to about 23, and from about 19 to about 21 nucleotides pairs in length.
  • the hairpin may have a single strand overhang or terminal unpaired region.
  • the overhangs are from about 2 to about 3 nucleotides in length. In embodiments, the overhang is at the same side of the hairpin and in embodiments on the antisense side of the hairpin.
  • a "double stranded siRNA compound" as used herein, is an siRNA compound which includes more than one, and in some cases two, strands in which interchain hybridization can form a region of duplex structure.
  • the antisense strand of a double stranded siRNA compound may be equal to or at least about 14, about 15, about 16 about 17, about 18, about 19, about 20, about 25, about 30, about 40, or about 60 nucleotides in length.
  • antisense strand means the strand of an siRNA compound that is sufficiently complementary to a target molecule, e.g., the target nucleotide sequence of a target transcript.
  • the sense strand of a double stranded siRNA compound may be equal to or at least about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 25, about 30, about 40, or about 60 nucleotides in length.
  • the double strand portion of a double stranded siRNA compound may be equal to or at least about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 30, about 40, or about 60 nucleotide pairs in length. It may be equal to or less than about 200, about 100, or about 50, nucleotides pairs in length. Ranges may be from about 15 to about 30, from about 17 to about 23, from about 19 to about 23, and from about 19 to about 21 nucleotides pairs in length.
  • the siRNA compound is sufficiently large that it can be cleaved by an endogenous molecule, e.g., by Dicer, to produce smaller siRNA compounds, e.g., siRNAs agents.
  • the sense and antisense strands may be chosen such that the double-stranded siRNA compound includes a single strand or unpaired region at one or both ends of the molecule.
  • a double-stranded siRNA compound may contain sense and antisense strands, paired to contain an overhang, e.g., one or two 5' or 3' overhangs, or a 3' overhang of 1 to 3 nucleotides.
  • the overhangs can be the result of one strand being longer than the other, or the result of two strands of the same length being staggered. Some embodiments will have at least one 3' overhang. In embodiments, both ends of an siRNA molecule will have a 3' overhang. In embodiments, the overhang is 2 nucleotides. [0148] In embodiments, the length for the duplexed region is from about 15 to about 30, or about 18, about 19, about 20, about 21, about 22, or about 23 nucleotides in length, e.g., in the ssiRNA (siRNA with sticky overhangs) compound range discussed above. ssiRNA compounds can resemble in length and structure the natural Dicer processed products from long dsiRNAs.
  • Embodiments in which the two strands of the ssiRNA compound are linked, e.g., covalently linked are also included.
  • hairpin, or other single strand structures which provide a double stranded region, and a 3' over hangs are included.
  • the siRNA compounds described herein, including double-stranded siRNA compounds and single- stranded siRNA compounds can mediate silencing of a target RNA, e.g., mRNA, e.g., a transcript of a gene that encodes a protein.
  • mRNA e.g., a transcript of a gene that encodes a protein.
  • mRNA e.g., a transcript of a gene that encodes a protein.
  • mRNA e.g., a transcript of a gene that encodes a protein.
  • mRNA e.g., a transcript of a gene that encodes a protein.
  • mRNA e.g.,
  • the RNA to be silenced is an endogenous gene.
  • an siRNA compound is "sufficiently complementary" to a target transcript, such that the siRNA compound silences production of protein encoded by the target mRNA.
  • the siRNA compound is "sufficiently complementary” to at least a portion of a target transcript, such that the siRNA compound silences production of the gene product encoded by the target transcript.
  • the siRNA compound is "exactly complementary" to a target nucleotide sequence (e.g., a portion of a target transcript) such that the target nucleotide sequence and the siRNA compound anneal, for example to form a hybrid made exclusively of Watson-Crick base pairs in the region of exact complementarity.
  • a "sufficiently complementary" to a target nucleotide sequence can include an internal region (e.g., of at least about 10 nucleotides) that is exactly complementary to a target nucleotide sequence.
  • the siRNA compound specifically discriminates a single-nucleotide difference.
  • the siRNA compound only mediates RNAi if exact complementary is found in the region (e.g., within 7 nucleotides of) the single-nucleotide difference.
  • the AC includes a microRNA molecule.
  • MicroRNAs are a highly conserved class of small RNA molecules that are transcribed from DNA in the genomes of plants and animals but are not translated into protein.
  • Processed miRNAs are single stranded 17- 25 nucleotide RNA molecules that become incorporated into the RNA-induced silencing complex (RISC) and have been identified as key regulators of development, cell proliferation, apoptosis and differentiation.
  • RISC RNA-induced silencing complex
  • antagomirs [0153]
  • the AC is an antagomir.
  • Antagomirs are RNA-like oligonucleotides that harbor various modifications for RNAse protection and pharmacologic properties, such as enhanced tissue and cellular uptake.
  • Antagomirs may be used to efficiently silence endogenous miRNAs by forming duplexes that include the antagomir and endogenous miRNA, thereby preventing miRNA-induced gene silencing.
  • An example of antagomir-mediated miRNA silencing is the silencing of miR-122, described in Krutzfeldt et al., Nature (2005), 438: 685-689, which is expressly incorporated by reference herein in its entirety.
  • Antagomir RNAs may be synthesized using standard solid phase oligonucleotide synthesis protocols (U.S. Patent Application Ser. Nos. 11/502,158 and 11/657,341; the disclosure of each of which are incorporated herein by reference).
  • An antagomir can include ligand-conjugated monomer subunits and monomers for oligonucleotide synthesis. Monomers are described in U.S. Application No. 10/916,185.
  • An antagomir can have a ZXY structure, such as is described in PCT Application No. PCT/US2004/07070.
  • An antagomir can be complexed with an amphipathic moiety.
  • the AC includes an aptamer.
  • Aptamers are nucleic acid or peptide molecules that bind to a particular molecule of interest with high affinity and specificity (Tuerk and Gold, Science 249:505 (1990); Ellington and Szostak, Nature 346:818 (1990)).
  • DNA or RNA aptamers have been successfully produced which bind many different entities from large proteins to small organic molecules (Eaton, Curr. Opin. Chem. Biol. (1997), 1: 10-16; Famulok, Curr. Opin. Struct. Biol.
  • Aptamers may be RNA or DNA based and may include a riboswitch.
  • a riboswitch is a part of an mRNA molecule that can directly bind a small target molecule, and whose binding of the target affects the gene's activity.
  • an mRNA that contains a riboswitch is directly involved in regulating its own activity, depending on the presence or absence of its target molecule.
  • aptamers are engineered through repeated rounds of in vitro selection or equivalently, SELEX (systematic evolution of ligands by exponential enrichment) to bind to various molecular targets such as small molecules, proteins, nucleic acids, and even cells, tissues and organisms.
  • the aptamer may be prepared by any known method, including synthetic, recombinant, and purification methods, and may be used alone or in combination with other aptamers specific for the same target.
  • the term "aptamer” also includes "secondary aptamers” containing a consensus sequence derived from comparing two or more known aptamers to a given target.
  • the aptamer is an “intracellular aptamer”, or “intramer”, which specifically recognize intracellular targets (Famulok et al., Chem Biol. (2001),8(10):931-939; Yoon and Rossi, Adv. Drug Deliv. Rev. (2016), 134:22- 35; each incorporated by reference herein).
  • Ribozymes [0156]
  • the AC is a ribozyme. Ribozymes are RNA molecules complexes having specific catalytic domains that possess endonuclease activity (Kim and Cech, Proc. Natl. Acad. Sci.
  • enzymatic nucleic acids act by first binding to a target RNA. Such binding occurs through the target binding portion of an enzymatic nucleic acid which is held in close proximity to an enzymatic portion of the molecule that acts to cleave the target RNA.
  • the enzymatic nucleic acid first recognizes and then binds a target RNA through complementary base-pairing, and once bound to the correct site, acts enzymatically to cut the target RNA. Strategic cleavage of such a target RNA will destroy its ability to direct synthesis of an encoded protein. After an enzymatic nucleic acid has bound and cleaved its RNA target, it is released from that RNA to search for another target and can repeatedly bind and cleave new targets.
  • the enzymatic nucleic acid molecule may be formed in a hammerhead, hairpin, a hepatitis ⁇ virus, group I intron or RNaseP RNA (in association with an RNA guide sequence) or Neurospora VS RNA motif, for example.
  • hammerhead motifs are described by Rossi et al. Nucleic Acids Res. (1992), 20(17):4559-65.
  • hairpin motifs are described by Hampel et al. (Eur. Pat. Appl. Publ. No. EP 0360257), Hampel and Tritz, Biochemistry (1989), 28(12):4929- 33; Hampel et al, Nucleic Acids Res.
  • hepatitis virus motif is described by Perrotta and Been, Biochemistry (1992), 31(47): 11843-52; an example of the RNaseP motif is described by Guerrier-Takada et al., Cell (1983), 35(3 Pt 2):849-57; Neurospora VS RNA ribozyme motif is described by Collins (Saville and Collins, Cell (1990), 61(4):685-96; Saville and Collins, Proc. Natl. Acad. Sci.
  • enzymatic nucleic acid molecules have a specific substrate binding site which is complementary to one or more of the target gene DNA or RNA regions, and that they have nucleotide sequences within or surrounding that substrate binding site which impart an RNA cleaving activity to the molecule.
  • the ribozyme constructs need not be limited to specific motifs mentioned herein.
  • Ribozymes may be designed as described in Int. Pat. Appl. Publ. No. WO 93/23569 and Int. Pat. Appl.
  • Ribozyme activity can be increased by altering the length of the ribozyme binding arms or chemically synthesizing ribozymes with modifications that prevent their degradation by serum ribonucleases (see e.g. , Int. Pat. Appl. Publ. No. WO 92/07065; Int. Pat. Appl. Publ. No. WO 93/15187; Int. Pat. Appl. Publ. No.
  • WO 91/03162 Eur. Pat. Appl. Publ. No. 92110298.4; U. S. Patent 5,334,711 ; and Int. Pat. Appl. Publ. No. WO 94/13688, which describe various chemical modifications that can be made to the sugar moieties of enzymatic RNA molecules), modifications which enhance their efficacy in cells, and removal of stem ⁇ bases to shorten RNA synthesis times and reduce chemical requirements.
  • Supermir [0161]
  • the AC is a supermir.
  • a supermir refers to a single stranded, double stranded, or partially double stranded oligomer or polymer of RNA, polymer of DNA, or both , or modifications thereof, which has a nucleotide sequence that is substantially identical to an miRNA and that is antisense with respect to its target,
  • This term includes oligonucleotides composed of naturally-occurring nucleobases, sugars and covalent internucleoside (backbone) linkages and which contain at least one non-naturally- occurring portion which functions similarly.
  • Such modified or substituted oligonucleotides have desirable properties such as, for example, enhanced cellular uptake, enhanced affinity for nucleic acid target and increased stability in the presence of nucleases.
  • the supermir does not include a sense strand, and in another embodiment, the supermir does not self-hybridize to a significant extent.
  • a supermir can have secondary structure, but it is substantially single-stranded under physiological conditions.
  • a supermir that is substantially single-stranded is single-stranded to the extent that less than about 50% (e.g., less than about 40%, about 30%, about 20%, about 10%, or about 5%) of the supermir is duplexed with itself.
  • the supermir can include a hairpin segment, e.g., sequence, for example, at the 3' end can self-hybridize and form a duplex region, e.g., a duplex region of at least about 1, about 2, about 3, or about 4 or less than about 8, about 7, about 6, or about 5 nucleotides, or about 5 nucleotides.
  • the duplexed region can be connected by a linker, e.g., a nucleotide linker, e.g., about 3, about 4, about 5, or about 6 dTs, e.g., modified dTs.
  • the supermir is duplexed with a shorter oligo, e.g., of about 5, about 6, about 7, about 8, about 9, or about 10 nucleotides in length, e.g., at one or both of the 3' and 5' end or at one end and in the non-terminal or middle of the supermir.
  • miRNA mimics [0162]
  • the AC is a miRNA mimic. miRNA mimics represent a class of molecules that can be used to imitate the gene silencing ability of one or more miRNAs.
  • miRNA mimic refers to synthetic non-coding RNAs (i.e., the miRNA is not obtained by purification from a source of the endogenous miRNA) that are capable of entering the RNAi pathway and regulating gene expression. miRNA mimics can be designed as mature molecules (e.g., single stranded) or mimic precursors (e.g., pri- or pre-miRNAs).
  • miRNA mimics can include nucleic acid (modified or modified nucleic acids) including oligonucleotides that include, without limitation, RNA, modified RNA, DNA, modified DNA, locked nucleic acids, or 2'-0,4'-C- ethylene-bridged nucleic acids (ENA), or any combination of the above (including DNA-RNA hybrids).
  • miRNA mimics can include conjugates that can affect delivery, intracellular compartmentalization, stability, specificity, functionality, strand usage, and/or potency.
  • miRNA mimics are double stranded molecules (e.g., with a duplex region of between about 16 and about 31 nucleotides in length) and contain one or more sequences that have identity with the mature strand of a given miRNA.
  • Modifications can include 2' modifications (including 2'-0 methyl modifications and 2' F modifications) on one or both strands of the molecule and internucleoside modifications (e.g., phosphorothioate modifications) that enhance nucleic acid stability and/or specificity.
  • miRNA mimics can include overhangs. The overhangs can include from about 1 to about 6 nucleotides on either the 3’ or 5' end of either strand and can be modified to enhance stability or functionality.
  • a miRNA mimic includes a duplex region of from about 16 to about 31 nucleotides and one or more of the following chemical modification patterns: the sense strand contains 2'-0-methyl modifications of nucleotides 1 and 2 (counting from the 5' end of the sense oligonucleotide), and all of the Cs and Us; the antisense strand modifications can include 2' F modification of all of the Cs and Us, phosphorylation of the 5' end of the oligonucleotide, and stabilized internucleoside linkages associated with a 2 nucleotide 3 ' overhang.
  • miRNA inhibitor [0163]
  • the AC is a miRNA inhibitor.
  • antimir microRNA inhibitor
  • miR inhibitor miRNA inhibitor
  • miRNA inhibitor refers to oligonucleotides or modified oligonucleotides that interfere with the ability of specific miRNAs.
  • the inhibitors are nucleic acid or modified nucleic acids in nature including oligonucleotides that include RNA, modified RNA, DNA, modified DNA, locked nucleic acids (LNAs), or any combination of the above.
  • Modifications include 2' modifications (including 2'-0 alkyl modifications and 2' F modifications) and internucleoside modifications (e.g., phosphorothioate modifications) that can affect delivery, stability, specificity, intracellular compartmentalization, or potency.
  • miRNA inhibitors can include conjugates that can affect delivery, intracellular compartmentalization, stability, and/or potency.
  • Inhibitors can adopt a variety of configurations including single stranded, double stranded (RNA/RNA or RNA/DNA duplexes), and hairpin designs, in general, microRNA inhibitors include contain one or more sequences or portions of sequences that are complementary or partially complementary with the mature strand (or strands) of the miRNA to be targeted.
  • the miRNA inhibitor may also include additional sequences located 5' and 3' to the sequence that is the reverse complement of the mature miRNA.
  • the additional sequences may be the reverse complements of the sequences that are adjacent to the mature miRNA in the pri-miRNA from which the mature miRNA is derived, or the additional sequences may be arbitrary sequences (having a mixture of A, G, C, or U). In embodiments, one or both of the additional sequences are arbitrary sequences capable of forming hairpins. Thus, in embodiments, the sequence that is the reverse complement of the miRNA is flanked on the 5' side and on the 3' side by hairpin structures.
  • Micro-RNA inhibitors when double stranded, may include mismatches between nucleotides on opposite strands. Furthermore, micro-RNA inhibitors may be linked to conjugate moieties in order to facilitate uptake of the inhibitor into a cell.
  • a micro-RNA inhibitor may be linked to cholesteryl 5-(bis(4- methoxyphenyl)(phenyl)methoxy)- 3 hydroxypentylcarbamate) which allows passive uptake of a micro-RNA inhibitor into a cell.
  • Micro-RNA inhibitors including hairpin miRNA inhibitors, are described in detail in Vermeulen et al., RNA 13: 723- 730 (2007) and in WO2007/095387 and WO 2008/036825 each of which is incorporated herein by reference in its entirety.
  • a person of ordinary skill in the art can select a sequence from the database for a desired miRNA and design an inhibitor useful for the methods disclosed herein.
  • Linking groups or bifunctional linking moieties such as those known in the art are amenable to the compounds provided herein. Linking groups are useful for attachment of chemical functional groups, conjugate groups, reporter groups and other groups to selective sites in a parent compound such as for example an AC.
  • a bifunctional linking moiety includes a hydrocarbyl moiety having two functional groups. One of the functional groups is selected to bind to a parent molecule or compound of interest and the other is selected to bind essentially any selected group such as chemical functional group or a conjugate group. Any of the linkers described here may be used. In embodiments, the linker includes a chain structure or an oligomer of repeating units such as ethylene glycol or amino acid units.
  • bifunctional linking moieties include amino, hydroxyl, carboxylic acid, thiol, unsaturations (e.g., double or triple bonds), and the like.
  • bifunctional linking moieties include 8-amino-3,6-dioxaoctanoic acid (ADO), succinimidyl 4-(N- maleimidomethyl) cyclohexane-1-carboxylate (SMCC) and 6-aminohexanoic acid (AHEX or AHA).
  • linking groups include, but are not limited to, substituted C1-C10 alkyl, substituted or unsubstituted C2-C10 alkenyl or substituted or unsubstituted C2-C10 alkynyl, wherein a nonlimiting list of substituent groups includes hydroxyl, amino, alkoxy, carboxy, benzyl, phenyl, nitro, thiol, thioalkoxy, halogen, alkyl, aryl, alkenyl and alkynyl.
  • AC includes nucleotide modification designed to not support RNase H activity.
  • Nucleotide modifications of antisense compounds that do not support RNase H activity include, but are not limited to, 2’-O-methoxy ethyl/phosphorothioate (MOE) modifications.
  • MOE 2’-O-methoxy ethyl/phosphorothioate
  • AC with MOE modifications have increased affinity for target RNA and increase nuclease stability.
  • Immunostimulatory Oligonucleotides [0167]
  • the therapeutic moiety is an immunostimulatory oligonucleotide.
  • Immunostimulatory oligonucleotides ISS; single-or double- stranded
  • ISS single-or double- stranded
  • the immune response may be an innate or an adaptive immune response.
  • the immune system is divided into a more innate immune system, and acquired adaptive immune system of vertebrates, the latter of which is further divided into humoral cellular components.
  • the immune response may be mucosal.
  • Immunostimulatory nucleic acids are considered to be non-sequence specific when it is not required that they specifically bind to and reduce the expression of a target polynucleotide in order to provoke an immune response.
  • certain immunostimulatory nucleic acids may include a sequence corresponding to a region of a naturally occurring gene or mRNA, but they may still be considered non-sequence specific immunostimulatory nucleic acids.
  • the immunostimulatory nucleic acid or oligonucleotide includes at least one CpG dinucleotide. The oligonucleotide or CpG dinucleotide may be unmethylated or methylated.
  • the immunostimulatory nucleic acid includes at least one CpG dinucleotide having a methylated cytosine.
  • the nucleic acid includes a single CpG dinucleotide, wherein the cytosine in said CpG dinucleotide is methylated.
  • the nucleic acid includes the sequence 5' TAACGTTGAGGG’CAT 3' (SEQ ID NO: 369).
  • the nucleic acid includes at least two CpG dinucleotides, wherein at least one cytosine in the CpG dinucleotides is methylated.
  • each cytosine in the CpG dinucleotides present in the sequence is methylated.
  • the nucleic acid includes a plurality of CpG dinucleotides, wherein at least one of said CpG dinucleotides includes a methylated cytosine.
  • ODNs used in the compositions and methods have a phosphodiester("PO") backbone or a phosphorothioate (“PS”) backbone, and/or at least one methylated cytosine residue in a CpG motif.
  • Decoy Oligonucleotides [0172]
  • the therapeutic moiety is a decoy oligonucleotide. Because transcription factors recognize their relatively short binding sequences, even in the absence of surrounding genomic DNA, short oligonucleotides bearing the consensus binding sequence of a specific transcription factor can be used as tools for manipulating gene expression in living cells. This strategy involves the intracellular delivery of such "decoy oligonucleotides", which are then recognized and bound by the target factor.
  • Decoys can be used as therapeutic agents, either to inhibit the expression of genes that are activated by a transcription factor, or to upregulate genes that are suppressed by the binding of a transcription factor. Examples of the utilization of decoy oligonucleotides may be found in Mann et al., J. Clin. Invest, 2000, 106: 1071-1075, which is expressly incorporated by reference herein, in its entirety.
  • U1 adaptor [0173] In some embodiments, the therapeutic moiety is a U1 adaptor.
  • U1 adaptors inhibit polyA sites and are bifunctional oligonucleotides with a target domain complementary to a site in the target gene's terminal exon and a 'U1 domain' that binds to the U1 smaller nuclear RNA component of the U1 snRNP (Goraczniak, et al., 2008, Nature Biotechnology, 27(3), 257-263, which is expressly incorporated by reference herein, in its entirety).
  • U1 snRNP is a ribonucleoprotein complex that functions primarily to direct early steps in spliceosome formation by binding to the pre-mRNA exon- intron boundary (Brown and Simpson, 1998, Annu Rev Plant Physiol Plant Mol Biol 49:77-95).
  • oligonucleotides are U1 adaptors.
  • the Ul adaptor can be administered in combination with at least one other iRNA agent.
  • CRISPR Gene-Editing Machinery
  • the compounds disclosed herein include one or more CPP (or cCPP) conjugated to CRISPR gene editing machinery
  • CRISPR gene-editing machinery refers to protein, nucleic acids, or combinations thereof, which may be used to edit a genome.
  • Non-limiting examples of gene-editing machinery include gRNAs, nucleases, nuclease inhibitors, and combinations and complexes thereof.
  • CRISPR gene-editing machinery U.S. Pat. No. 8,697,359, U.S. Pat. No. 8,771,945, U.S. Pat. No. 8,795,965, U.S. Pat. No. 8,865,406, U.S. Pat. No. 8,871,445, U.S. Pat. No. 8,889,356, U.S. Pat. No. 8,895,308, U.S. Pat. No. 8,906,616, U.S. Pat. No. 8,932,814, U.S. Pat. No. 8,945,839, U.S. Pat.
  • a linker conjugates the cCPP to the CRISPR gene-editing machinery. Any linker described in this disclosure or that is known to a person of skill in the art may be utilized.
  • the compounds include the CPP (or cCPP) is conjugated to a gRNA.
  • a gRNA targets a genomic loci in a prokaryotic or eukaryotic cell.
  • the gRNA is a single-molecule guide RNA (sgRNA).
  • a sgRNA includes a spacer sequence and a scaffold sequence.
  • a spacer sequence is a short nucleic acid sequence used to target a nuclease (e.g., a Cas9 nuclease) to a specific nucleotide region of interest (e.g., a genomic DNA sequence to be cleaved).
  • the spacer may be about 17-24 bases in length, such as about 20 bases in length.
  • the spacer may be about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, or about 30 bases in length.
  • the spacer may be at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 bases in length. In embodiments, the spacer may be about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, or about 30 bases in length. In embodiments, the spacer sequence has between about 40% to about 80% GC content. [0178] In embodiments, the spacer targets a site that immediately precedes a 5’ protospacer adjacent motif (PAM). The PAM sequence may be selected based on the desired nuclease.
  • PAM protospacer adjacent motif
  • the PAM sequence may be any one of the PAM sequences shown in Table 3 below, wherein N refers to any nucleic acid, R refers to A or G, Y refers to C or T, W refers to A or T, and V refers to A or C or G.
  • Table 3 Exemplary Nucleases and PAM sequences
  • a spacer may target a sequence of a mammalian gene, such as a human gene.
  • the spacer may target a mutant gene.
  • the spacer may target a coding sequence.
  • the spacer may target an exonic sequence.
  • the spacer may target a polyadenylation site (PS).
  • PS polyadenylation site
  • the spacer may target a sequence element of a PS.
  • the spacer may target a polyadenylation signal (PAS), an intervening sequence (IS), a cleavage site (CS), a downstream element (DES), or a portion or combination thereof.
  • a spacer may target a splicing element (SE) or a cis-splicing regulatory element (SRE).
  • the scaffold sequence is the sequence within the sgRNA that is responsible for nuclease (e.g., Cas9) binding. The scaffold sequence does not include the spacer/targeting sequence.
  • the scaffold may be about 1 to about 10, about 10 to about 20, about 20 to about 30, about 30 to about 40, about 40 to about 50, about 50 to about 60, about 60 to about 70, about 70 to about 80, about 80 to about 90, about 90 to about 100, about 100 to about 110, about 110 to about 120, or about 120 to about 130 nucleotides in length.
  • the scaffold may be about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 51, about 52, about 53, about 54, about 55, about 56, about 57, about 58, about 59, about 60,about 60, about 61, about 62, about 63, about 64, about 65, about 66, about 67, about 68, about 69, about 70, about 71, about 72, about 73, about 74, about 75, about 76, about 77, about 78, about 79, about 80, about 81, about 82, about 83, about 84, about 85
  • the scaffold may be at least 10, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, or at least 125 nucleotides in length.
  • the gRNA is a dual-molecule guide RNA, e.g, crRNA and tracrRNA.
  • the gRNA may further include a poly(A) tail.
  • a compound that includes a CPP is conjugated to a nucleic acid that includes a gRNA.
  • the nucleic acid includes about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, or about 20 gRNAs.
  • the gRNAs recognize the same target.
  • the gRNAs recognize different targets.
  • the nucleic acid that includes a gRNA includes a sequence encoding a promoter, wherein the promoter drives expression of the gRNA.
  • Nuclease [0183]
  • the compounds include a cell penetrating peptide conjugated to a nuclease.
  • the nuclease is a Type II, Type V-A, Type V-B, Type VC, Type V-U, Type VI-B nuclease.
  • the nuclease is a transcription, activator-like effector nuclease (TALEN), a meganuclease, or a zinc-finger nuclease.
  • the nuclease is a Cas9, Cas12a (Cpf1), Cas12b, Cas12c, Tnp-B like, Cas13a (C2c2), Cas13b, or Cas14 nuclease.
  • the nuclease is a Cas9 nuclease or a Cpf1 nuclease.
  • the nuclease is a modified form or variant of a Cas9, Cas12a (Cpf1), Cas12b, Cas12c, Tnp-B like, Cas13a (C2c2), Cas13b, or Cas14 nuclease.
  • the nuclease is a modified form or variant of a TAL nuclease, a meganuclease, or a zinc-finger nuclease.
  • a “modified” or “variant” nuclease is one that is, for example, truncated, fused to another protein (such as another nuclease), catalytically inactivated, etc.
  • the nuclease may have at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99%, or about 100% sequence identity to a naturally occurring Cas9, Cas12a (Cpf1), Cas12b, Cas12c, Tnp-B like, Cas13a (C2c2), Cas13b, Cas14 nuclease, or a TALEN, meganuclease, or zinc-finger nuclease.
  • the nuclease is a Cas9 nuclease derived from S. pyogenes (SpCas9).
  • a nuclease has at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Cas9 nuclease derived from S. pyogenes (SpCas9).
  • the nuclease is a Cas9 derived from S. aureus (SaCas9).
  • the nuclease has at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Cas9 derived from S. aureus (SaCas9).
  • the Cpf1 is a Cpf1 enzyme from Acidaminococcus (species BV3L6, UniProt Accession No. U2UMQ6).
  • the nuclease has at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Cpf1 enzyme from Acidaminococcus (species BV3L6, UniProt Accession No.
  • the Cpf1 is a Cpf1 enzyme from Lachnospiraceae (species ND2006, UniProt Accession No. A0A182DWE3).
  • the nuclease has at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to a Cpf1 enzyme from Lachnospiraceae.
  • a sequence encoding the nuclease is codon optimized for expression in mammalian cells.
  • the sequence encoding the nuclease is codon optimized for expression in human cells or mouse cells.
  • a compound that includes a CPP is conjugated to a nuclease.
  • the nuclease is a soluble protein.
  • a compound that includes a CPP is conjugated to a nucleic acid encoding a nuclease.
  • the nucleic acid encoding a nuclease includes a sequence encoding a promoter, wherein the promoter drives expression of the nuclease.
  • the compounds include one or more CPP (or cCPP) conjugated to a gRNA and a nuclease.
  • the one or more CPP are conjugated to a nucleic acid encoding a gRNA and/or a nuclease.
  • the nucleic acid encoding a nuclease and a gRNA includes a sequence encoding a promoter, wherein the promoter drives expression of the nuclease and the gRNA.
  • the nucleic acid encoding a nuclease and a gRNA includes two promoters, wherein a first promoter controls expression of the nuclease and a second promoter controls expression of the gRNA.
  • the nucleic acid encoding a gRNA and a nuclease encodes from about 1 to about 20 gRNAs, or from about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, or about 19, and up to about 20 gRNAs.
  • the gRNAs recognize different targets.
  • the gRNAs recognize the same target.
  • the compounds include a cell penetrating peptide (or cCPP) conjugated to a ribonucleoprotein (RNP) that includes a gRNA and a nuclease.
  • RNP ribonucleoprotein
  • a composition that includes: (a) a CPP conjugated to a gRNA and (b) a nuclease is delivered to a cell.
  • a composition that includes: (a) a CPP conjugated to a nuclease and (b) an gRNA is delivered to a cell.
  • a composition that includes: (a) a first CPP conjugated to a gRNA and (b) a second CPP conjugated to a nuclease is delivered to a cell.
  • the first CPP and second CPP are the same.
  • the first CPP and second CPP are different.
  • the compounds disclosed herein include a cell penetrating peptide conjugated to a genetic element of interest.
  • a genetic element of interest replaces a genomic DNA sequence cleaved by a nuclease.
  • Non-limiting examples of genetic elements of interest include genes, a single nucleotide polymorphism, promoter, or terminators.
  • Nuclease Inhibitors [0193]
  • the compounds disclosed herein include a cell penetrating peptide conjugated to an inhibitor of a nuclease (e.g., Cas9).
  • a limitation of gene editing is potential off- target editing. The delivery of a nuclease inhibitor will limit off-target editing.
  • the nuclease inhibitor is a polypeptide, polynucleotide, or small molecule.
  • Exemplary nuclease inhibitors are described in U.S. Publication No. 2020/087354, International Publication No. 2018/085288, U.S. Publication No. 2018/0382741, International Publication No. 2019/089761, International Publication No. 2020/068304, International Publication No. 2020/041384, and International Publication No. 2019/076651, each of which is incorporated by reference herein in its entirety.
  • Therapeutic polypeptides [0194]
  • the therapeutic moiety includes a polypeptide.
  • the therapeutic moiety includes a protein or a fragment thereof.
  • the therapeutic moiety includes an RNA binding protein or an RNA binding fragment thereof.
  • the therapeutic moiety includes an enzyme.
  • the therapeutic moiety includes an RNA-cleaving enzyme or an active fragment thereof.
  • Conjugate Groups [0195]
  • ACs are modified by covalent attachment of one or more conjugate groups.
  • conjugate groups modify one or more properties of the attached AC including but not limited to pharmacodynamic, pharmacokinetic, binding, absorption, cellular distribution, cellular uptake, charge and clearance.
  • Conjugate groups are routinely used in the chemical arts and are linked directly or via an optional linking moiety or linking group to a parent compound such as an AC.
  • Conjugate groups include without limitation, intercalators, reporter molecules, polyamines, polyamides, polyethylene glycols, thioethers, polyethers, cholesterols, thiocholesterols, cholic acid moieties, folate, lipids, phospholipids, biotin, phenazine, phenanthridine, anthraquinone, adamantane, acridine, fluoresceins, rhodamines, coumarins and dyes.
  • the conjugate group is a polyethylene glycol (PEG), and the PEG is conjugated to either the AC or the CPP.
  • Conjugate groups include lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acad. Sci. USA, 1989, 86, 6553); cholic acid (Manoharan et al., Bioorg. Med. Chem. Lett., 1994, 4, 1053); a thioether, e.g., hexyl-S-tritylthiol (Manoharan et al., Ann. N.Y. Acad. Sci., 1992, 660, 306; Manoharan et al., Bioorg. Med. Chem.
  • lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acad. Sci. USA, 1989, 86, 6553); cholic acid (Manoharan et al., Bioorg. Med. Chem. Lett., 1994, 4, 1053); a thioether, e.g.,
  • Linking groups or bifunctional linking moieties such as those known in the art are amenable to the compounds provided herein.
  • Linking groups are useful for attachment of chemical functional groups, conjugate groups, reporter groups and other groups to selective sites in a parent compound such as for example an AC.
  • a bifunctional linking moiety comprises a hydrocarbyl moiety having two functional groups. One of the functional groups is selected to bind to a parent molecule or compound of interest and the other is selected to bind essentially any selected group such as chemical functional group or a conjugate group.
  • Any of the linkers described here may be used.
  • the linker comprises a chain structure or an oligomer of repeating units such as ethylene glycol or amino acid units.
  • bifunctional linking moieties include amino, hydroxyl, carboxylic acid, thiol, unsaturations (e.g., double or triple bonds), and the like.
  • bifunctional linking moieties include 8-amino-3,6-dioxaoctanoic acid (ADO), succinimidyl 4-(N- maleimidomethyl) cyclohexane-1-carboxylate (SMCC) and 6-aminohexanoic acid (AHEX or AHA).
  • linking groups include, but are not limited to, substituted C1-C10 alkyl, substituted or unsubstituted C2-C10 alkenyl or substituted or unsubstituted C2-C10 alkynyl, wherein a nonlimiting list of substituent groups includes hydroxyl, amino, alkoxy, carboxy, benzyl, phenyl, nitro, thiol, thioalkoxy, halogen, alkyl, aryl, alkenyl and alkynyl.
  • the AC may be linked to a 10 arginine-serine dipeptide repeat.
  • Endosomal Escape Vehicles [0199] An endosomal escape vehicle (EEV) can be used to transport a cargo across a cellular membrane, for example, to deliver the cargo to the cytosol or nucleus of a cell. Cargo can include a therapeutic moiety (TM).
  • TM therapeutic moiety
  • the EEV can comprise a cell penetrating peptide (CPP), for example, a cyclic cell penetrating peptide (cCPP).
  • CCP cell penetrating peptide
  • cCPP cyclic cell penetrating peptide
  • the EEV comprises a cCPP, which is conjugated to an exocyclic peptide (EP).
  • the EP can be referred to interchangeably as a modulatory peptide (MP).
  • MP modulatory peptide
  • the EP can comprise a sequence of a nuclear localization signal (NLS).
  • the EP can be coupled to the cargo.
  • the EP can be coupled to the cCPP.
  • the EP can be coupled to the cargo and the cCPP. Coupling between the EP, cargo, cCPP, or combinations thereof, may be non-covalent or covalent.
  • the EP can be attached through a peptide bond to the N-terminus of the cCPP.
  • the EP can be attached through a peptide bond to the C-terminus of the cCPP.
  • the EP can be attached to the cCPP through a side chain of an amino acid in the cCPP.
  • the EP can be attached to the cCPP through a side chain of a lysine which can be conjugated to the side chain of a glutamine in the cCPP.
  • the EP can be conjugated to the 5’ or 3’ end of an oligonucleotide cargo.
  • the EP can be coupled to a linker.
  • the exocyclic peptide can be conjugated to an amino group of the linker.
  • the EP can be coupled to a linker via the C-terminus of an EP and a cCPP through a side chain on the cCPP and/or EP.
  • an EP may comprise a terminal lysine which can then be coupled to a cCPP containing a glutamine through an amide bond.
  • the EP contains a terminal lysine, and the side chain of the lysine can be used to attach the cCPP, the C- or N-terminus may be attached to a linker on the cargo.
  • exocyclic Peptides [0200]
  • the exocyclic peptide (EP) can comprise from 2 to 10 amino acid residues e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid residues, inclusive of all ranges and values therebetween.
  • the EP can comprise 6 to 9 amino acid residues.
  • the EP can comprise from 4 to 8 amino acid residues.
  • Each amino acid in the exocyclic peptide may be a natural or non-natural amino acid.
  • non-natural amino acid refers to an organic compound that is a congener of a natural amino acid in that it has a structure similar to a natural amino acid so that it mimics the structure and reactivity of a natural amino acid.
  • the non-natural amino acid can be a modified amino acid, and/or amino acid analog, that is not one of the 20 common naturally occurring amino acids or the rare natural amino acids selenocysteine or pyrrolysine.
  • Non-natural amino acids can also be the D-isomer of the natural amino acids.
  • suitable amino acids include, but are not limited to, alanine, allosoleucine, arginine, citrulline, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, napthylalanine, phenylalanine, proline, pyroglutamic acid, serine, threonine, tryptophan, tyrosine, valine, a derivative thereof, or combinations thereof.
  • amino acids include, but are not limited to, alanine, allosoleucine, arginine, citrulline, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, napthylalanine, phenylalanine, proline, pyroglutamic acid, serine, threon
  • the amino acids can be A, G, P, K, R, V, F, H, Nal, or citrulline.
  • the EP can comprise at least one positively charged amino acid residue, e.g., at least one lysine residue and/or at least one amine acid residue comprising a side chain comprising a guanidine group, or a protonated form thereof.
  • the EP can comprise 1 or 2 amino acid residues comprising a side chain comprising a guanidine group, or a protonated form thereof.
  • the amino acid residue comprising a side chain comprising a guanidine group can be an arginine residue.
  • Protonated forms can mean salt thereof throughout the disclosure.
  • the EP can comprise at least two, at least three or at least four or more lysine residues.
  • the EP can comprise 2, 3, or 4 lysine residues.
  • the amino group on the side chain of each lysine residue can be substituted with a protecting group, including, for example, trifluoroacetyl (- COCF 3 ), allyloxycarbonyl (Alloc), 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)ethyl (Dde), or (4,4-dimethyl-2,6-dioxocyclohex-1-ylidene-3)-methylbutyl (ivDde) group.
  • a protecting group including, for example, trifluoroacetyl (- COCF 3 ), allyloxycarbonyl (Alloc), 1-(4,4-dimethyl-2,6-dioxocyclohexylidene)ethyl (Dde), or (4,4-di
  • the amino group on the side chain of each lysine residue can be substituted with a trifluoroacetyl (-COCF 3 ) group.
  • the protecting group can be included to enable amide conjugation.
  • the protecting group can be removed after the EP is conjugated to a cCPP.
  • the EP can comprise at least 2 amino acid residues with a hydrophobic side chain.
  • the amino acid residue with a hydrophobic side chain can be selected from valine, proline, alanine, leucine, isoleucine, and methionine.
  • the amino acid residue with a hydrophobic side chain can be valine or proline.
  • the EP can comprise at least one positively charged amino acid residue, e.g., at least one lysine residue and/or at least one arginine residue.
  • the EP can comprise at least two, at least three or at least four or more lysine residues and/or arginine residues.
  • the EP can comprise KK, KR, RR, HH, HK, HR, RH, KKK, KGK, KBK, KBR, KRK, KRR, RKK, RRR, KKH, KHK, HKK, HRR, HRH, HHR, HBH, HHH, HHHH (SEQ ID NO:1), KHKK (SEQ ID NO:2), KKHK (SEQ ID NO:3), KKKH (SEQ ID NO:4), KHKH (SEQ ID NO:5), HKHK (SEQ ID NO:6), KKKK (SEQ ID NO:7), KKRK (SEQ ID NO:8), KRKK (SEQ ID NO:9), KRRK (SEQ ID NO:10), RKKR (SEQ ID NO:11), RRRR (SEQ ID NO:12), KGKK (SEQ ID NO:13), KKGK (SEQ ID NO:14), HBHBH (SEQ ID NO:15), HBKBH (SEQ ID NO:1
  • the amino acids in the EP can have D or L stereochemistry.
  • the EP can comprise KK, KR, RR, KKK, KGK, KBK, KBR, KRK, KRR, RKK, RRR, KKKK (SEQ ID NO:7), KKRK (SEQ ID NO:8), KRKK (SEQ ID NO:9), KRRK (SEQ ID NO:10), RKKR (SEQ ID NO:11), RRRR (SEQ ID NO:12), KGKK (SEQ ID NO:13), KKGK (SEQ ID NO:14), KKKKK (SEQ ID NO:18), KKKRK (SEQ ID NO:19), KBKBK (SEQ ID NO:24), KKKRKV (SEQ ID NO:33), PKKKRKV (SEQ ID NO:42), PGKKRKV (SEQ ID NO:43), PKGKRKV (SEQ ID NO:44), PKKGRKV (SEQ ID NO:45), PKKKGKV
  • the EP can comprise PKKKRKV (SEQ ID NO:42), RR, RRR, RHR, RBR, RBRBR (SEQ ID NO:49), RBHBR (SEQ ID NO:50), or HBRBH (SEQ ID NO:51), wherein B is beta-alanine.
  • the amino acids in the EP can have D or L stereochemistry.
  • the EP can consist of KK, KR, RR, KKK, KGK, KBK, KBR, KRK, KRR, RKK, RRR, KKKK (SEQ ID NO:7), KKRK (SEQ ID NO:8), KRKK (SEQ ID NO:9), KRRK (SEQ ID NO:10), RKKR (SEQ ID NO:11), RRRR (SEQ ID NO:12), KGKK (SEQ ID NO:13), KKGK (SEQ ID NO:14), KKKKK (SEQ ID NO:18), KKKRK (SEQ ID NO:19), KBKBK (SEQ ID NO:24), KKKRKV (SEQ ID NO:33), PKKKRKV (SEQ ID NO:42), PGKKRKV (SEQ ID NO:Z43), PKGKRKV (SEQ ID NO:Z44), PKKGRKV (SEQ ID NO:Z45), PKKKGKV (SEQ ID NO:46), PK
  • the EP can consist of PKKKRKV (SEQ ID NO:42), RR, RRR, RHR, RBR, RBRBR (SEQ ID NO:49), RBHBR (SEQ ID NO:50), or HBRBH (SEQ ID NO:51), wherein B is beta-alanine.
  • the amino acids in the EP can have D or L stereochemistry.
  • the EP can comprise an amino acid sequence identified in the art as a nuclear localization sequence (NLS).
  • the EP can consist of an amino acid sequence identified in the art as a nuclear localization sequence (NLS).
  • the EP can comprise an NLS comprising the amino acid sequence PKKKRKV (SEQ ID NO:42).
  • the EP can consist of an NLS comprising the amino acid sequence PKKKRKV (SEQ ID NO:42).
  • the EP can comprise an NLS comprising an amino acid sequence selected from NLSKRPAAIKKAGQAKKKK (SEQ ID NO:52), PAAKRVKLD (SEQ ID NO:53), RQRRNELKRSF (SEQ ID NO:54), RMRKFKNKGKDTAELRRRRVEVSVELR (SEQ ID NO:Z55), KAKKDEQILKRRNV (SEQ ID NO:56), VSRKRPRP (SEQ ID NO:57), PPKKARED (SEQ ID NO:58), PQPKKKPL (SEQ ID NO:59), SALIKKKKKMAP (SEQ ID NO:60), DRLRR (SEQ ID NO:61), PKQKKRK (SEQ ID NO:62), RKLKKKIKKL (SEQ ID NO:63), REKKKFLKRR (SEQ ID NO:64), KRKGDEVDGVDEVAKKKSKK
  • the EP can consist of an NLS comprising an amino acid sequence selected from NLSKRPAAIKKAGQAKKKK (SEQ ID NO:52), PAAKRVKLD (SEQ ID NO:53), RQRRNELKRSF (SEQ ID NO:54), RMRKFKNKGKDTAELRRRRVEVSVELR (SEQ ID NO:55), KAKKDEQILKRRNV (SEQ ID NO:56), VSRKRPRP (SEQ ID NO:57), PPKKARED (SEQ ID NO:58), PQPKKKPL (SEQ ID NO:59), SALIKKKKKMAP (SEQ ID NO:60), DRLRR (SEQ ID NO:61), PKQKKRK (SEQ ID NO:62), RKLKKKIKKL (SEQ ID NO:63), REKKKFLKRR (SEQ ID NO:64), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO:65), and RKCLQAGMNLEARKTKK (SEQ ID NO:66).
  • NLS
  • All exocyclic sequences can also contain an N-terminal acetyl group.
  • the EP can have the structure: Ac-PKKKRKV (SEQ ID NO:42).
  • Cell Penetrating Peptides (CPP) [0211] The cell penetrating peptide (CPP) can comprise 6 to 20 amino acid residues.
  • the cell penetrating peptide can be a cyclic cell penetrating peptide (cCPP).
  • the cCPP is capable of penetrating a cell membrane.
  • An exocyclic peptide (EP) can be conjugated to the cCPP, and the resulting construct can be referred to as an endosomal escape vehicle (EEV).
  • the cCPP can direct a cargo (e.g., a therapeutic moiety (TM) such as an oligonucleotide, peptide or small molecule) to penetrate the membrane of a cell.
  • a cargo e.g., a therapeutic moiety (TM) such as an oligonucleotide, peptide or small molecule
  • the cCPP can deliver the cargo to the cytosol of the cell.
  • the cCPP can deliver the cargo to a cellular location where a target (e.g., pre-mRNA) is located.
  • a target e.g., pre-mRNA
  • the total number of amino acid residues in the cCPP is in the range of from 6 to 20 amino acid residues, e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acid residues, inclusive of all ranges and subranges therebetween.
  • the cCPP can comprise 6 to 13 amino acid residues.
  • the cCPP disclosed herein can comprise 6 to 10 amino acids.
  • cCPP comprising 6-10 amino acid residues can have a structure according to any of Formula I-A to I-E:
  • the cCPP can comprise 6 to 8 amino acids.
  • the cCPP can comprise 8 amino acids.
  • Each amino acid in the cCPP may be a natural or non-natural amino acid.
  • non- natural amino acid refers to an organic compound that is a congener of a natural amino acid in that it has a structure similar to a natural amino acid so that it mimics the structure and reactivity of a natural amino acid.
  • the non-natural amino acid can be a modified amino acid, and/or amino acid analog, that is not one of the 20 common naturally occurring amino acids or the rare natural amino acids selenocysteine or pyrrolysine.
  • Non-natural amino acids can also be a D-isomer of a natural amino acid.
  • suitable amino acids include, but are not limited to, alanine, allosoleucine, arginine, citrulline, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, napthylalanine, phenylalanine, proline, pyroglutamic acid, serine, threonine, tryptophan, tyrosine, valine, a derivative thereof, or combinations thereof.
  • amino acids include, but are not limited to, alanine, allosoleucine, arginine, citrulline, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, napthylalanine, phenylalanine, proline, pyroglutamic acid, serine, threon
  • PEGm polyethylene glycol
  • PEG m polyethylene glycol
  • PEGm polyethylene glycol
  • PEG m polyethylene glycol
  • n any integer from 1 to 5
  • m any integer from 1 to 23.
  • n is 1 or 2.
  • n is 1.
  • n is 2.
  • n is 1 and m is 2.
  • n is 2 and m is 2.
  • n is 1 and m is 4.
  • n is 2 and m is 4.
  • n is 1 and m is 12. In embodiments, n is 2 and m is 12. [0216] As used herein, “miniPEGm” or “miniPEG m ” are, or are derived from, a molecule of the formula HO(CO)-(CH 2 ) n -(OCH 2 CH 2 ) m -NH 2 where n is 1 and m is any integer from 1 to 23.
  • miniPEG2 or “miniPEG 2 ” is, or is derived from, (2-[2-[2-aminoethoxy]ethoxy]acetic acid), and “miniPEG4” or “miniPEG 4 ” is, or is derived from, HO(CO)-(CH 2 ) n -(OCH 2 CH 2 ) m - NH 2 where n is 1 and m is 4.
  • the cCPP can comprise 4 to 20 amino acids, wherein: (i) at least one amino acid has a side chain comprising a guanidine group, or a protonated form thereof; (ii) at least one amino acid has no side chain or a side chain comprising , , , , , or a protonated form thereof; and (iii) at least two amino acids independently have a side chain comprising an aromatic or heteroaromatic group. [0218] At least two amino acids can have no side chain or a side chain comprising , , , , , , or a protonated form thereof.
  • the amino acid when no side chain is present, the amino acid has two hydrogen atoms on the carbon atom(s) (e.g., -CH 2 -) linking the amine and carboxylic acid.
  • the amino acid having no side chain can be glycine or E-alanine.
  • the cCPP can comprise from 6 to 20 amino acid residues which form the cCPP, wherein: (i) at least one amino acid can be glycine, E-alanine, or 4-aminobutyric acid residues; (ii) at least one amino acid can have a side chain comprising an aryl or heteroaryl group; and (iii) at least one amino acid has a side chain comprising a guanidine group, , , , , , or a protonated form thereof.
  • the cCPP can comprise from 6 to 20 amino acid residues which form the cCPP, wherein: (i) at least two amino acid can independently be glycine, E-alanine, or 4-aminobutyric acid residues; (ii) at least one amino acid can have a side chain comprising an aryl or heteroaryl group; and (iii) at least one amino acid has a side chain comprising a guanidine group, protonated form thereof.
  • the cCPP can comprise from 6 to 20 amino acid residues which form the cCPP, wherein: (i) at least three amino acids can independently be glycine, E-alanine, or 4-aminobutyric acid residues; (ii) at least one amino acid can have a side chain comprising an aromatic or heteroaromatic group; and (iii) at least one amino acid can have a side chain comprising a guanidine group, or a protonated form thereof.
  • Glycine and Related Amino Acid Residues [0223]
  • the cCPP can comprise (i) 1, 2, 3, 4, 5, or 6 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 2 glycine, E-alanine, 4- aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3 glycine, E- alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 4 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 5 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 6 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3 4 or 5 glycine E alanine 4 aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3 or 4 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 1, 2, 3, 4, 5, or 6 glycine residues.
  • the cCPP can comprise (i) 2 glycine residues.
  • the cCPP can comprise (i) 3 glycine residues.
  • the cCPP can comprise (i) 4 glycine residues.
  • the cCPP can comprise (i) 5 glycine residues.
  • the cCPP can comprise (i) 6 glycine residues.
  • the cCPP can comprise (i) 3, 4, or 5 glycine residues.
  • the cCPP can comprise (i) 3 or 4 glycine residues.
  • the cCPP can comprise (i) 2 or 3 glycine residues.
  • the cCPP can comprise (i) 1 or 2 glycine residues.
  • the cCPP can comprise (i) 3, 4, 5, or 6 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 4 glycine, E-alanine, 4- aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 5 glycine, E- alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 6 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3, 4, or 5 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise (i) 3 or 4 glycine, E-alanine, 4-aminobutyric acid residues, or combinations thereof.
  • the cCPP can comprise at least three glycine residues.
  • the cCPP can comprise (i) 3, 4, 5, or 6 glycine residues.
  • the cCPP can comprise (i) 3 glycine residues.
  • the cCPP can comprise (i) 4 glycine residues.
  • the cCPP can comprise (i) 5 glycine residues.
  • the cCPP can comprise (i) 6 glycine residues.
  • the cCPP can comprise (i) 3, 4, or 5 glycine residues.
  • the cCPP can comprise (i) 3 or 4 glycine residues [0227] In embodiments, none of the glycine, E-alanine, or 4-aminobutyric acid residues in the cCPP are contiguous. Two or three glycine, E-alanine, 4-or aminobutyric acid residues can be contiguous. Two glycine, E-alanine, or 4-aminobutyric acid residues can be contiguous. [0228] In embodiments, none of the glycine residues in the cCPP are contiguous. Each glycine residues in the cCPP can be separated by an amino acid residue that cannot be glycine.
  • the cCPP can comprise (ii) 2, 3, 4, 5 or 6 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 2 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 3 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 4 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 5 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 6 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 2, 3, or 4 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 2 or 3 amino acid residues independently having a side chain comprising an aromatic or heteroaromatic group.
  • the cCPP can comprise (ii) 2, 3, 4, 5 or 6 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 2 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 3 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 4 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 5 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 6 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 2, 3, or 4 amino acid residues independently having a side chain comprising an aromatic group.
  • the cCPP can comprise (ii) 2 or 3 amino acid residues independently having a side chain comprising an aromatic group.
  • the aromatic group can be a 6- to 14-membered aryl.
  • Aryl can be phenyl, naphthyl or anthracenyl, each of which is optionally substituted.
  • Aryl can be phenyl or naphthyl, each of which is optionally substituted.
  • the heteroaromatic group can be a 6- to 14-membered heteroaryl having 1, 2, or 3 heteroatoms selected from N, O, and S.
  • Heteroaryl can be pyridyl, quinolyl, or isoquinolyl.
  • the amino acid residue having a side chain comprising an aromatic or heteroaromatic group can each independently be bis(homonaphthylalanine), homonaphthylalanine, naphthylalanine, phenylglycine, bis(homophenylalanine), homophenylalanine, phenylalanine, tryptophan, 3-(3-benzothienyl)-alanine, 3-(2-quinolyl)-alanine, O-benzylserine, 3-(4- (benzyloxy)phenyl)-alanine, S-(4-methylbenzyl)cysteine, N-(naphthalen-2-yl)glutamine, 3-(1,1'- biphenyl-4-yl)-alanine, 3-(3-benzothienyl)-alanine or tyrosine, each of which is optionally substituted with one or more substituents.
  • the amino acid having a side chain comprising an aromatic or heteroaromatic group can each independently be selected from: , , , , a , wherein the H on the N-terminus and/or the H on the C- terminus are replaced by a peptide bond.
  • the amino acid residue having a side chain comprising an aromatic or heteroaromatic group can each be independently a residue of phenylalanine, naphthylalanine, phenylglycine, homophenylalanine, homonaphthylalanine, bis(homophenylalanine), bis-(homonaphthylalanine), tryptophan, or tyrosine, each of which is optionally substituted with one or more substituents.
  • the amino acid residue having a side chain comprising an aromatic group can each independently be a residue of tyrosine, phenylalanine, 1-naphthylalanine, 2-naphthylalanine, tryptophan, 3-benzothienylalanine, 4-phenylphenylalanine, 3,4-difluorophenylalanine, 4- trifluoromethylphenylalanine, 2,3,4,5,6-pentafluorophenylalanine, homophenylalanine, ⁇ - homophenylalanine, 4-tert-butyl-phenylalanine, 4-pyridinylalanine, 3-pyridinylalanine, 4- methylphenylalanine, 4-fluorophenylalanine, 4-chlorophenylalanine, 3-(9-anthryl)-alanine.
  • the amino acid residue having a side chain comprising an aromatic group can each independently be a residue of phenylalanine, naphthylalanine, phenylglycine, homophenylalanine, or homonaphthylalanine, each of which is optionally substituted with one or more substituents.
  • the amino acid residue having a side chain comprising an aromatic group can each be independently a residue of phenylalanine, naphthylalanine, homophenylalanine, homonaphthylalanine, bis(homonaphthylalanine), or bis(homonaphthylalanine), each of which is optionally substituted with one or more substituents.
  • the amino acid residue having a side chain comprising an aromatic group can each be independently a residue of phenylalanine or naphthylalanine, each of which is optionally substituted with one or more substituents. At least one amino acid residue having a side chain comprising an aromatic group can be a residue of phenylalanine. At least two amino acid residues having a side chain comprising an aromatic group can be residues of phenylalanine. Each amino acid residue having a side chain comprising an aromatic group can be a residue of phenylalanine. [0234] In embodiments, none of the amino acids having the side chain comprising the aromatic or heteroaromatic group are contiguous.
  • Two amino acids having the side chain comprising the aromatic or heteroaromatic group can be contiguous. Two contiguous amino acids can have opposite stereochemistry. The two contiguous amino acids can have the same stereochemistry. Three amino acids having the side chain comprising the aromatic or heteroaromatic group can be contiguous. Three contiguous amino acids can have the same stereochemistry. Three contiguous amino acids can have alternating stereochemistry. [0235]
  • the amino acid residues comprising aromatic or heteroaromatic groups can be L-amino acids.
  • the amino acid residues comprising aromatic or heteroaromatic groups can be D-amino acids.
  • the amino acid residues comprising aromatic or heteroaromatic groups can be a mixture of D- and L-amino acids.
  • the optional substituent can be any atom or group which does not significantly reduce (e.g., by more than 50%) the cytosolic delivery efficiency of the cCPP, e.g., compared to an otherwise identical sequence which does not have the substituent.
  • the optional substituent can be a hydrophobic substituent or a hydrophilic substituent.
  • the optional substituent can be a hydrophobic substituent.
  • the substituent can increase the solvent-accessible surface area (as defined herein) of the hydrophobic amino acid.
  • the substituent can be halogen, alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, cycloalkynyl, heterocyclyl, aryl, heteroaryl, alkoxy, aryloxy, acyl, alkylcarbamoyl, alkylcarboxamidyl, alkoxycarbonyl, alkylthio, or arylthio.
  • the substituent can be halogen.
  • amino acids having an aromatic or heteroaromatic group having higher hydrophobicity values can improve cytosolic delivery efficiency of a cCPP relative to amino acids having a lower hydrophobicity value.
  • Each hydrophobic amino acid can independently have a hydrophobicity value greater than that of glycine.
  • Each hydrophobic amino acid can independently be a hydrophobic amino acid having a hydrophobicity value greater than that of alanine.
  • Each hydrophobic amino acid can independently have a hydrophobicity value greater or equal to phenylalanine. Hydrophobicity may be measured using hydrophobicity scales known in the art.
  • Table 5 lists hydrophobicity values for various amino acids as reported by Eisenberg and Weiss (Proc. Natl. Acad. Sci. U. S. A. 1984;81(1):140–144), Engleman, et al. (Ann. Rev. of Biophys. Biophys. Chem. 1986;1986(15):321–53), Kyte and Doolittle (J. Mol. Biol. 1982;157(1):105–132), Hoop and Woods (Proc. Natl. Acad. Sci. U. S. A. 1981;78(6):3824–3828), and Janin (Nature. 1979;277(5696):491–492), the entirety of each of which is herein incorporated by reference. Hydrophobicity can be measured using the hydrophobicity scale reported in Engleman, et al. Table 5. Amino Acid Hydrophobicity
  • the size of the aromatic or heteroaromatic groups may be selected to improve cytosolic delivery efficiency of the cCPP. While not wishing to be bound by theory, it is believed that a larger aromatic or heteroaromatic group on the side chain of amino acid may improve cytosolic delivery efficiency compared to an otherwise identical sequence having a smaller hydrophobic amino acid.
  • the size of the hydrophobic amino acid can be measured in terms of molecular weight of the hydrophobic amino acid, the steric effects of the hydrophobic amino acid, the solvent-accessible surface area (SASA) of the side chain, or combinations thereof.
  • the size of the hydrophobic amino acid can be measured in terms of the molecular weight of the hydrophobic amino acid, and the larger hydrophobic amino acid has a side chain with a molecular weight of at least about 90 g/mol, or at least about 130 g/mol, or at least about 141 g/mol.
  • the size of the amino acid can be measured in terms of the SASA of the hydrophobic side chain.
  • the hydrophobic amino acid can have a side chain with a SASA of greater than or equal to alanine, or greater than or equal to glycine. Larger hydrophobic amino acids can have a side chain with a SASA greater than alanine, or greater than glycine.
  • the hydrophobic amino acid can have an aromatic or heteroaromatic group with a SASA greater than or equal to about piperidine-2-carboxylic acid, greater than or equal to about tryptophan, greater than or equal to about phenylalanine, or greater than or equal to about naphthylalanine.
  • a first hydrophobic amino acid (AA H1 ) can have a side chain with a SASA of at least about 200 ⁇ 2 , at least about 210 ⁇ 2 , at least about 220 ⁇ 2 , at least about 240 ⁇ 2 , at least about 250 ⁇ 2 , at least about 260 ⁇ 2 , at least about 270 ⁇ 2 , at least about 280 ⁇ 2 , at least about 290 ⁇ 2 , at least about 300 ⁇ 2 , at least about 310 ⁇ 2 , at least about 320 ⁇ 2 , or at least about 330 ⁇ 2 .
  • a second hydrophobic amino acid (AA H2 ) can have a side chain with a SASA of at least about 200 ⁇ 2 , at least about 210 ⁇ 2 , at least about 220 ⁇ 2 , at least about 240 ⁇ 2 , at least about 250 ⁇ 2 , at least about 260 ⁇ 2 , at least about 270 ⁇ 2 , at least about 280 ⁇ 2 , at least about 290 ⁇ 2 , at least about 300 ⁇ 2 , at least about 310 ⁇ 2 , at least about 320 ⁇ 2 , or at least about 330 ⁇ 2 .
  • the side chains of AA H1 and AA H2 can have a combined SASA of at least about 350 ⁇ 2 , at least about 360 ⁇ 2 , at least about 370 ⁇ 2 , at least about 380 ⁇ 2 , at least about 390 ⁇ 2 , at least about 400 ⁇ 2 , at least about 410 ⁇ 2 , at least about 420 ⁇ 2 , at least about 430 ⁇ 2 , at least about 440 ⁇ 2 , at least about 450 ⁇ 2 , at least about 460 ⁇ 2 , at least about 470 ⁇ 2 , at least about 480 ⁇ 2 , at least about 490 ⁇ 2 , greater than about 500 ⁇ 2 , at least about 510 ⁇ 2 , at least about 520 ⁇ 2 , at least about 530 ⁇ 2 , at least about 540 ⁇ 2 , at least about 550 ⁇ 2 , at least about 560 ⁇ 2 , at least about 570 ⁇ 2 , at least about 580 ⁇
  • AA H2 can be a hydrophobic amino acid residue with a side chain having a SASA that is less than or equal to the SASA of the hydrophobic side chain of AA H1 .
  • a cCPP having a Nal-Arg motif may exhibit improved cytosolic delivery efficiency compared to an otherwise identical cCPP having a Phe-Arg motif;
  • a cCPP having a Phe-Nal-Arg motif may exhibit improved cytosolic delivery efficiency compared to an otherwise identical cCPP having a Nal- Phe-Arg motif;
  • a phe-Nal-Arg motif may exhibit improved cytosolic delivery efficiency compared to an otherwise identical cCPP having a nal-Phe-Arg motif.
  • hydrophobic surface area refers to the surface area (reported as square ⁇ ngstroms; ⁇ 2 ) of an amino acid side chain that is accessible to a solvent.
  • SASA can be calculated using the 'rolling ball' algorithm developed by Shrake & Rupley (J Mol Biol. 79 (2): 351–71), which is herein incorporated by reference in its entirety for all purposes. This algorithm uses a “sphere” of solvent of a particular radius to probe the surface of the molecule. A typical value of the sphere is 1.4 ⁇ , which approximates to the radius of a water molecule.
  • SASA values for certain side chains are shown below in Table 6.
  • guanidine refers to the structure: .
  • a protonated form of guanidine refers to the structure: .
  • Guanidine replacement groups refer to functional groups on the side chain of amino acids that will be positively charged at or above physiological pH or those that can recapitulate the hydrogen bond donating and accepting activity of guanidinium groups.
  • the guanidine replacement groups facilitate cell penetration and delivery of therapeutic agents while reducing toxicity associated with guanidine groups or protonated forms thereof.
  • the cCPP can comprise at least one amino acid having a side chain comprising a guanidine or guanidinium replacement group.
  • the cCPP can comprise at least two amino acids having a side chain comprising a guanidine or guanidinium replacement group.
  • the cCPP can comprise at least three amino acids having a side chain comprising a guanidine or guanidinium replacement group
  • the guanidine or guanidinium group can be an isostere of guanidine or guanidinium.
  • the guanidine or guanidinium replacement group can be less basic than guanidine.
  • a guanidine replacement group refers to , , , , , or a protonated form thereof.
  • the disclosure relates to a cCPP comprising from 4 to 20 amino acids residues, wherein: (i) at least one amino acid has a side chain comprising a guanidine group, or a protonated form thereof; (ii) at least one amino acid residue has no side chain or a side chain comprising protonated form thereof; and (iii) at least two amino acids residues independently have a side chain comprising an aromatic or heteroaromatic group. [0248] At least two amino acids residues can have no side chain or a side chain comprising protonated form thereof.
  • the cCPP can comprise at least one amino acid having a side chain comprising one of the following moieties: , or a protonated form thereof.
  • the cCPP can comprise at least two amino acids each independently having one of the following moieti , or a protonated form thereof. At least two amino acids can have a side chain comprising the same moiety selected from: , or a protonated form thereof. At least one amino acid can have a side chain comprising ated form thereof.
  • At least two amino acids can have a side chain c p g , or a protonated form thereof.
  • One, two, three, or four amino acids can have a side chain comprising , or a protonated form thereof.
  • One amino acid can have a side chain comprising , or a protonated form thereof.
  • Two amino acids can have a side chain comprising , or a protonated form thereof.
  • , , , , , or a protonated form thereof can be attached to the terminus of the amino acid side chain. can be attached to the terminus of the amino acid side chain.
  • the cCPP can comprise (iii) 2, 3, 4, 5 or 6 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 2 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 3 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 4 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 5 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 6 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 2, 3, 4, or 5 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 2, 3, or 4 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) 2 or 3 amino acid residues independently having a side chain comprising a guanidine group, guanidine replacement group, or a protonated form thereof.
  • the cCPP can comprise (iii) at least one amino acid residue having a side chain comprising a guanidine group or protonated form thereof.
  • the cCPP can comprise (iii) two amino acid residues having a side chain comprising a guanidine group or protonated form thereof.
  • the cCPP can comprise (iii) three amino acid residues having a side chain comprising a guanidine group or protonated form thereof.
  • the amino acid residues can independently have the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof that are not contiguous.
  • Two amino acid residues can independently have the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be contiguous.
  • Three amino acid residues can independently have the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be contiguous.
  • Four amino acid residues can independently have the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be contiguous.
  • the contiguous amino acid residues can have the same stereochemistry.
  • the contiguous amino acids can have alternating stereochemistry.
  • the amino acid residues independently having the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be L-amino acids.
  • the amino acid residues independently having the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be D-amino acids.
  • the amino acid residues independently having the side chain comprising the guanidine group, guanidine replacement group, or the protonated form thereof can be a mixture of L- or D-amino acids.
  • Each amino acid residue having the side chain comprising the guanidine group, or the protonated form thereof can independently be a residue of arginine, homoarginine, 2-amino-3- propionic acid, 2-amino-4-guanidinobutyric acid or a protonated form thereof.
  • Each amino acid residue having the side chain comprising the guanidine group, or the protonated form thereof can independently be a residue of arginine or a protonated form thereof.
  • Each amino acid having the side chain comprising a guanidine replacement group, or protonated form thereof can independently be , , , , , or a protonated form thereof.
  • guanidine replacement groups have reduced basicity, relative to arginine and in some cases are uncharged at physiological pH (e.g., a -N(H)C(O)), and are capable of maintaining the bidentate hydrogen bonding interactions with phospholipids on the plasma membrane that is believed to facilitate effective membrane association and subsequent internalization. The removal of positive charge is also believed to reduce toxicity of the cCPP.
  • physiological pH e.g., a -N(H)C(O)
  • the cCPP can comprise a first amino acid having a side chain comprising an aromatic or heteroaromatic group and a second amino acid having a side chain comprising an aromatic or heteroaromatic group, wherein an N-terminus of a first glycine forms a peptide bond with the first amino acid having the side chain comprising the aromatic or heteroaromatic group, and a C- terminus of the first glycine forms a peptide bond with the second amino acid having the side chain comprising the aromatic or heteroaromatic group.
  • first amino acid often refers to the N-terminal amino acid of a peptide sequence
  • first amino acid is used to distinguish the referent amino acid from another amino acid (e.g., a “second amino acid”) in the cCPP such that the term “first amino acid” may or may refer to an amino acid located at the N-terminus of the peptide sequence.
  • the cCPP can comprise an N-terminus of a second glycine forms a peptide bond with an amino acid having a side chain comprising an aromatic or heteroaromatic group, and a C- terminus of the second glycine forms a peptide bond with an amino acid having a side chain comprising a guanidine group, or a protonated form thereof.
  • the cCPP can comprise a first amino acid having a side chain comprising a guanidine group, or a protonated form thereof, and a second amino acid having a side chain comprising a guanidine group, or a protonated form thereof, wherein an N-terminus of a third glycine forms a peptide bond with a first amino acid having a side chain comprising a guanidine group, or a protonated form thereof, and a C-terminus of the third glycine forms a peptide bond with a second amino acid having a side chain comprising a guanidine group, or a protonated form thereof.
  • the cCPP can comprise a residue of asparagine, aspartic acid, glutamine, glutamic acid, or homoglutamine.
  • the cCPP can comprise a residue of asparagine.
  • the cCPP can comprise a residue of glutamine.
  • the cCPP can comprise a residue of tyrosine, phenylalanine, 1-naphthylalanine, 2- naphthylalanine, tryptophan, 3-benzothienylalanine, 4-phenylphenylalanine, 3,4- difluorophenylalanine, 4-trifluoromethylphenylalanine, 2,3,4,5,6-pentafluorophenylalanine, homophenylalanine, ⁇ -homophenylalanine, 4-tert-butyl-phenylalanine, 4-pyridinylalanine, 3- pyridinylalanine, 4-methylphenylalanine, 4-fluorophenylalanine, 4-chlorophenylalanine, 3-(9- anthryl)-alanine.
  • the cCPP can comprise at least one D amino acid.
  • the cCPP can comprise one to fifteen D amino acids.
  • the cCPP can comprise one to ten D amino acids.
  • the cCPP can comprise 1, 2, 3, or 4 D amino acids.
  • the cCPP can comprise 2, 3, 4, 5, 6, 7, or 8 contiguous amino acids having alternating D and L chirality.
  • the cCPP can comprise three contiguous amino acids having the same chirality.
  • the cCPP can comprise two contiguous amino acids having the same chirality. At least two of the amino acids can have the opposite chirality.
  • the at least two amino acids having the opposite chirality can be adjacent to each other. At least three amino acids can have alternating stereochemistry relative to each other. The at least three amino acids having the alternating chirality relative to each other can be adjacent to each other. At least four amino acids have alternating stereochemistry relative to each other. The at least four amino acids having the alternating chirality relative to each other can be adjacent to each other. At least two of the amino acids can have the same chirality. At least two amino acids having the same chirality can be adjacent to each other. At least two amino acids have the same chirality and at least two amino acids have the opposite chirality. The at least two amino acids having the opposite chirality can be adjacent to the at least two amino acids having the same chirality.
  • adjacent amino acids in the cCPP can have any of the following sequences: D-L; L-D; D-L-L-D; L-D-D-L; L-D-L-L-D; D-L-D-D-L; D-L-L-D-L; or L-D-D-L-D.
  • the amino acid residues that form the cCPP can all be L-amino acids.
  • the amino acid residues that form the cCPP can all be D-amino acids.
  • At least two of the amino acids can have a different chirality. At least two amino acids having a different chirality can be adjacent to each other. At least three amino acids can have different chirality relative to an adjacent amino acid.
  • At least four amino acids can have different chirality relative to an adjacent amino acid. At least two amino acids have the same chirality and at least two amino acids have a different chirality.
  • One or more amino acid residues that form the cCPP can be achiral.
  • the cCPP can comprise a motif of 3, 4, or 5 amino acids, wherein two amino acids having the same chirality can be separated by an achiral amino acid.
  • the cCPPs can comprise the following sequences: D-X-D; D-X-D-X; D-X-D-X-D; L-X-L; L-X-L-X; or L-X-L- X-L, wherein X is an achiral amino acid.
  • the achiral amino acid can be glycine.
  • An amino acid having a side chain comprising: protonated form thereof can be adjacent to an amino acid having a side chain comprising an aromatic or heteroaromatic group.
  • An amino acid having a side chain comprising: , , , , , or a protonated form thereof can be adjacent to at least one amino acid having a side chain comprising a guanidine or protonated form thereof.
  • An amino acid having a side chain comprising a guanidine or protonated form thereof can be adjacent to an amino acid having a side chain comprising an aromatic or heteroaromatic group.
  • Two amino acids having a side chain comprising: r protonated forms thereof can be adjacent to each other.
  • the cCPPs can comprise at least two contiguous amino acids having a side chain can comprise an aromatic or heteroaromatic group and at least two non-adjacent amino acids having a side chain comprising: , , , , , , or a protonated form thereof.
  • the cCPPs can comprise at least two contiguous amino acids having a side chain comprising an aromatic or heteroaromatic group and at least two non-adjacent amino acids having a side chain comprising , or a protonated form thereof.
  • the adjacent amino acids can have the same chirality.
  • the adjacent amino acids can have the opposite chirality.
  • amino acids having a side chain comprising: protonated form thereof are alternating with at least two amino acids having a side chain comprising a guanidine group or protonated form thereof.
  • the cCPP can comprise the structure of Formula (A): or a protonated form thereof, wherein: R 1 , R 2 , and R 3 are each independently H or an aromatic or heteroaromatic side chain of an amino acid; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 , R 5 , R 6 , R 7 are independently H or an amino acid side chain; at least one of R 4 , R 5 , R 6 , R 7 is the side chain of 3-guanidino-2-aminopropionic acid, 4- guanidino-2-aminobutanoic acid, arginine, homoarginine, N-methylarginine, N,N- dimethylarginine, 2,3-diaminopropionic acid, 2,4-diaminobutanoic acid, lysine, N-methyllysine, N,N-dimethyllysine, N-ethyllysine
  • At least one of R 4 , R 5 , R 6 , R 7 are independently an uncharged, non- aromatic side chain of an amino acid. In embodiments, at least one of R 4 , R 5 , R 6 , R 7 are independently H or a side chain of citrulline. [0269] In embodiments, compounds are provided that include a cyclic peptide having 6 to 12 amino acids, wherein at least two amino acids of the cyclic peptide are charged amino acids, at least two amino acids of the cyclic peptide are aromatic hydrophobic amino acids and at least two amino acids of the cyclic peptide are uncharged, non-aromatic amino acids.
  • At least two charged amino acids of the cyclic peptide are arginine.
  • at least two aromatic, hydrophobic amino acids of the cyclic peptide are phenylalanine or naphthylalanine.
  • at least two uncharged, non-aromatic amino acids of the cyclic peptide are citrulline or glycine.
  • the cyclic peptide of Formula (A) is not selected from a cyclic peptide having a sequence of SEQ ID NO: 89-117.
  • the cyclic peptide of Formula (A) is selected from a cyclic peptide having a sequence of SEQ ID NO: 89-117.
  • the cCPP can comprise the structure of Formula (I): or a protonated form thereof, wherein: R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 7 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; and each m is independently an integer of 0, 1, 2, or 3.
  • R 1 , R 2 , and R 3 can each independently be H, -alkylene-aryl, or -alkylene-heteroaryl.
  • R 1 , R 2 , and R 3 can each independently be H, -C 1-3 alkylene-aryl, or -C 1-3 alkylene-heteroaryl.
  • R 1 , R 2 , and R 3 can each independently be H or -alkylene-aryl.
  • R 1 , R 2 , and R 3 can each independently be H or -C 1-3 alkylene-aryl.
  • C 1-3 alkylene can be methylene.
  • Aryl can be a 6- to 14-membered aryl.
  • Heteroaryl can be a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S.
  • Aryl can be selected from phenyl, naphthyl, or anthracenyl.
  • Aryl can be phenyl or naphthyl.
  • Aryl can be phenyl.
  • Heteroaryl can be pyridyl, quinolyl, and isoquinolyl.
  • R 1 , R 2 , and R 3 can each independently be H, -C 1-3 alkylene-Ph or -C 1-3 alkylene-Naphthyl.
  • R 1 , R 2 , and R 3 can each independently be H, -CH 2 Ph, or -CH 2 Naphthyl.
  • R 1 , R 2 , and R 3 can each independently be H or -CH 2 Ph.
  • R 1 , R 2 , and R 3 can each independently be the side chain of tyrosine, phenylalanine, 1- naphthylalanine, 2-naphthylalanine, tryptophan, 3-benzothienylalanine, 4-phenylphenylalanine, 3,4-difluorophenylalanine, 4-trifluoromethylphenylalanine, 2,3,4,5,6-pentafluorophenylalanine, homophenylalanine, ⁇ -homophenylalanine, 4-tert-butyl-phenylalanine, 4-pyridinylalanine, 3- pyridinylalanine, 4-methylphenylalanine, 4-fluorophenylalanine, 4-chlorophenylalanine, 3-(9- anthryl)-alanine.
  • R 1 can be the side chain of tyrosine.
  • R 1 can be the side chain of phenylalanine.
  • R 1 can be the side chain of 1-naphthylalanine.
  • R 1 can be the side chain of 2-naphthylalanine.
  • R 1 can be the side chain of tryptophan.
  • R 1 can be the side chain of 3-benzothienylalanine.
  • R 1 can be the side chain of 4-phenylphenylalanine.
  • R 1 can be the side chain of 3,4-difluorophenylalanine.
  • R 1 can be the side chain of 4-trifluoromethylphenylalanine.
  • R 1 can be the side chain of 2,3,4,5,6- pentafluorophenylalanine.
  • R 1 can be the side chain of homophenylalanine.
  • R 1 can be the side chain of ⁇ -homophenylalanine.
  • R 1 can be the side chain of 4-tert-butyl-phenylalanine.
  • R 1 can be the side chain of 4-pyridinylalanine.
  • R 1 can be the side chain of 3-pyridinylalanine.
  • R 1 can be the side chain of 4-methylphenylalanine.
  • R 1 can be the side chain of 4-fluorophenylalanine.
  • R 1 can be the side chain of 4-chlorophenylalanine.
  • R 1 can be the side chain of 3-(9-anthryl)-alanine.
  • R 2 can be the side chain of tyrosine.
  • R 2 can be the side chain of phenylalanine.
  • R 2 can be the side chain of 1-naphthylalanine.
  • R 1 can be the side chain of 2-naphthylalanine.
  • R 2 can be the side chain of tryptophan.
  • R 2 can be the side chain of 3-benzothienylalanine.
  • R 2 can be the side chain of 4-phenylphenylalanine.
  • R 2 can be the side chain of 3,4-difluorophenylalanine.
  • R 2 can be the side chain of 4-trifluoromethylphenylalanine.
  • R 2 can be the side chain of 2,3,4,5,6- pentafluorophenylalanine.
  • R 2 can be the side chain of homophenylalanine.
  • R 2 can be the side chain of ⁇ -homophenylalanine.
  • R 2 can be the side chain of 4-tert-butyl-phenylalanine.
  • R 2 can be the side chain of 4-pyridinylalanine.
  • R 2 can be the side chain of 3-pyridinylalanine.
  • R 2 can be the side chain of 4-methylphenylalanine.
  • R 2 can be the side chain of 4-fluorophenylalanine.
  • R 2 can be the side chain of 4-chlorophenylalanine.
  • R 2 can be the side chain of 3-(9-anthryl)-alanine.
  • R 3 can be the side chain of tyrosine.
  • R 3 can be the side chain of phenylalanine.
  • R 3 can be the side chain of 1-naphthylalanine.
  • R 3 can be the side chain of 2-naphthylalanine.
  • R 3 can be the side chain of tryptophan.
  • R 3 can be the side chain of 3-benzothienylalanine.
  • R 3 can be the side chain of 4-phenylphenylalanine.
  • R 3 can be the side chain of 3,4-difluorophenylalanine.
  • R 3 can be the side chain of 4-trifluoromethylphenylalanine.
  • R 3 can be the side chain of 2,3,4,5,6- pentafluorophenylalanine.
  • R 3 can be the side chain of homophenylalanine.
  • R 3 can be the side chain of ⁇ -homophenylalanine.
  • R 3 can be the side chain of 4-tert-butyl-phenylalanine.
  • R 3 can be the side chain of 4-pyridinylalanine.
  • R 3 can be the side chain of 3-pyridinylalanine.
  • R 3 can be the side chain of 4-methylphenylalanine.
  • R 3 can be the side chain of 4-fluorophenylalanine.
  • R 3 can be the side chain of 4-chlorophenylalanine.
  • R 3 can be the side chain of 3-(9-anthryl)-alanine.
  • R 4 can be H, -alkylene-aryl, -alkylene-heteroaryl.
  • R 4 can be H, -C 1-3 alkylene-aryl, or -C 1- 3 alkylene-heteroaryl.
  • R 4 can be H or -alkylene-aryl.
  • R 4 can be H or -C 1-3 alkylene-aryl.
  • C 1- 3 alkylene can be a methylene.
  • Aryl can be a 6- to 14-membered aryl.
  • Heteroaryl can be a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S.
  • Aryl can be selected from phenyl, naphthyl, or anthracenyl.
  • Aryl can be phenyl or naphthyl.
  • Aryl can phenyl.
  • Heteroaryl can be pyridyl, quinolyl, and isoquinolyl.
  • R 4 can be H, -C 1-3 alkylene-Ph or - C 1-3 alkylene-Naphthyl.
  • R 4 can be H or the side chain of an amino acid in Table 4 or Table 6.
  • R 4 can be H or an amino acid residue having a side chain comprising an aromatic group.
  • R 4 can be H, -CH 2 Ph, or -CH 2 Naphthyl.
  • R 4 can be H or -CH 2 Ph.
  • R 5 can be H, -alkylene-aryl, -alkylene-heteroaryl.
  • R 5 can be H, -C 1-3 alkylene-aryl, or -C 1- 3 alkylene-heteroaryl.
  • R 5 can be H or -alkylene-aryl.
  • R 5 can be H or -C 1-3 alkylene-aryl.
  • C 1- 3 alkylene can be a methylene.
  • Aryl can be a 6- to 14-membered aryl.
  • Heteroaryl can be a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S.
  • Aryl can be selected from phenyl, naphthyl, or anthracenyl.
  • Aryl can be phenyl or naphthyl.
  • Aryl can phenyl.
  • Heteroaryl can be pyridyl, quinolyl, and isoquinolyl.
  • R 5 can be H, -C 1-3 alkylene-Ph or - C 1-3 alkylene-Naphthyl.
  • R 5 can be H or the side chain of an amino acid in Table 4 or Table 6.
  • R 4 can be H or an amino acid residue having a side chain comprising an aromatic group.
  • R 5 can be H, -CH 2 Ph, or -CH 2 Naphthyl.
  • R 4 can be H or -CH 2 Ph.
  • R 6 can be H, -alkylene-aryl, -alkylene-heteroaryl.
  • R 6 can be H, -C 1-3 alkylene-aryl, or -C 1- 3 alkylene-heteroaryl.
  • R 6 can be H or -alkylene-aryl.
  • R 6 can be H or -C 1-3 alkylene-aryl.
  • C 1- 3 alkylene can be a methylene.
  • Aryl can be a 6- to 14-membered aryl.
  • Heteroaryl can be a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S.
  • Aryl can be selected from phenyl, naphthyl, or anthracenyl.
  • Aryl can be phenyl or naphthyl.
  • Aryl can phenyl.
  • Heteroaryl can be pyridyl, quinolyl, and isoquinolyl.
  • R 6 can be H, -C 1-3 alkylene-Ph or - C 1-3 alkylene-Naphthyl.
  • R 6 can be H or the side chain of an amino acid in Table 4 or Table 6.
  • R 6 can be H or an amino acid residue having a side chain comprising an aromatic group.
  • R 6 can be H, -CH 2 Ph, or -CH 2 Naphthyl.
  • R 6 can be H or -CH 2 Ph.
  • R 7 can be H, -alkylene-aryl, -alkylene-heteroaryl.
  • R 7 can be H, -C 1-3 alkylene-aryl, or -C 1- 3 alkylene-heteroaryl.
  • R 7 can be H or -alkylene-aryl.
  • R 7 can be H or -C 1-3 alkylene-aryl.
  • C 1- 3 alkylene can be a methylene.
  • Aryl can be a 6- to 14-membered aryl.
  • Heteroaryl can be a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, and S.
  • Aryl can be selected from phenyl, naphthyl, or anthracenyl.
  • Aryl can be phenyl or naphthyl.
  • Aryl can phenyl.
  • Heteroaryl can be pyridyl, quinolyl, and isoquinolyl.
  • R 7 can be H, -C 1-3 alkylene-Ph or - C 1-3 alkylene-Naphthyl.
  • R 7 can be H or the side chain of an amino acid in Table 4 or Table 6.
  • R 7 can be H or an amino acid residue having a side chain comprising an aromatic group.
  • R 7 can be H, -CH 2 Ph, or -CH 2 Naphthyl.
  • R 7 can be H or -CH 2 Ph.
  • One, two or three of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • Two of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • Three of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • At least one of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be - CH 2 Ph. No more than four of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • R 1 , R 2 , R 3 , and R 4 are -CH 2 Ph.
  • One of R 1 , R 2 , R 3 , and R 4 is -CH 2 Ph.
  • Two of R 1 , R 2 , R 3 , and R 4 are -CH 2 Ph.
  • Three of R 1 , R 2 , R 3 , and R 4 are -CH 2 Ph.
  • At least one of R 1 , R 2 , R 3 , and R 4 is -CH 2 Ph.
  • One, two or three of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be H.
  • R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be H.
  • Two of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 are H.
  • Three of R 1 , R 2 , R 3 , R 5 , R 6 , and R 7 can be H.
  • At least one of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be H.
  • No more than three of R 1 , R 2 , R 3 , R 4 , R 5 , R 6 , and R 7 can be -CH 2 Ph.
  • R 1 , R 2 , R 3 , and R 4 are H.
  • One of R 1 , R 2 , R 3 , and R 4 is H.
  • Two of R 1 , R 2 , R 3 , and R 4 are H.
  • Three of R 1 , R 2 , R 3 , and R 4 are H.
  • At least one of R 1 , R 2 , R 3 , and R 4 is H.
  • At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-guanidino-2-aminopropionic acid.
  • At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of 4-guanidino-2-aminobutanoic acid. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of arginine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of homoarginine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N- methylarginine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethylarginine.
  • At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,3-diaminopropionic acid. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,4-diaminobutanoic acid, lysine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N-methyllysine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N-ethyllysine.
  • At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N,N-trimethyllysine, 4- guanidinophenylalanine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of citrulline. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine, , ⁇ -homoarginine. At least one of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-(1-piperidinyl)alanine.
  • At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-guanidino-2-aminopropionic acid. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of 4-guanidino-2-aminobutanoic acid. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of arginine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of homoarginine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N- methylarginine.
  • At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethylarginine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,3-diaminopropionic acid. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,4-diaminobutanoic acid, lysine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N-methyllysine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine.
  • At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N-ethyllysine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N,N-trimethyllysine, 4- guanidinophenylalanine. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of citrulline. At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine, , ⁇ -homoarginine.
  • At least two of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-(1-piperidinyl)alanine. [0288] At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-guanidino-2-aminopropionic acid. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of 4-guanidino-2-aminobutanoic acid. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of arginine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of homoarginine.
  • At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N- methylarginine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethylarginine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,3-diaminopropionic acid. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of 2,4-diaminobutanoic acid, lysine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N-methyllysine.
  • At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N- ethyllysine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N,N-trimethyllysine, 4- guanidinophenylalanine. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of citrulline,. At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of N,N-dimethyllysine, , ⁇ -homoarginine.
  • At least three of R 4 , R 5 , R 6 , and R 7 can be side chain of 3-(1-piperidinyl)alanine.
  • AA SC can be a side chain of a residue of asparagine, glutamine, or homoglutamine.
  • AA SC can be a side chain of a residue of glutamine.
  • the cCPP can further comprise a linker conjugated the AA SC , e.g., the residue of asparagine, glutamine, or homoglutamine.
  • the cCPP can further comprise a linker conjugated to the asparagine, glutamine, or homoglutamine residue.
  • the cCPP can further comprise a linker conjugated to the glutamine residue.
  • q can be 1, 2, or 3. q can 1 or 2. q can be 1. q can be 2. q can be 3. q can be 4. [0291] m can be 1-3. m can be 1 or 2. m can be 0. m can be 1. m can be 2. m can be 3.
  • the cCPP of Formula (A) can comprise the structure of Formula (I) (I) or protonated form thereof, wherein AA SC , R 1 , R 2 , R 3 , R 4 , R 7, m, and q are as defined herein.
  • the cCPP of Formula (A) can comprise the structure of Formula (I-a) or Formula (I-b): or protonated form thereof, wherein AA SC , R 1 , R 2 , R 3 , R 4 , and m are as defined herein.
  • the cCPP of Formula (A) can comprise the structure of Formula (I-1), (I-2), (I-3), or (I- 4):
  • the cCPP of Formula (A) can comprise the structure of Formula (I-5) or (I-6):
  • the cCPP of Formula (A) can comprise the structure of Formula (I-1): protonated form thereof, wherein AA SC and m are as defined herein.
  • the cCPP of Formula (A) can comprise the structure of Formula (I-2):
  • the cCPP of Formula (A) can comprise the structure of Formula (I-3): protonated form thereof, wherein AA SC and m are as defined herein. [0299] The cCPP of Formula (A) can comprise the structure of Formula (I-4):
  • the cCPP of Formula (A) can comprise the structure of Formula (I-5): (I-5), or a protonated form thereof, wherein AASC and m are as defined herein. [0301]
  • the cCPP of Formula (A) can comprise the structure of Formula (I-6):
  • the cCPP can comprise one of the following sequences: FGFGRGR (SEQ ID NO:68); GfFGrGr (SEQ ID NO:69), Ff ⁇ GRGR (SEQ ID NO:70); FfFGRGR (SEQ ID NO:71); or Ff ⁇ GrGr (SEQ ID NO:72).
  • the cCPP can have one of the following sequences: FGF ⁇ (SEQ ID NO:73); GfFGrGrQ (SEQ ID NO:74), Ff ⁇ GRGRQ (SEQ ID NO:75); FfFGRGRQ (SEQ ID NO:76); or Ff ⁇ GrGrQ (SEQ ID NO:77).
  • the disclosure also relates to a cCPP having the structure of Formula (II): wherein: AASC is an amino acid side chain; R 1a , R 1b , and R 1c are each independently a 6- to 14-membered aryl or a 6- to 14- membered heteroaryl; R 2a , R 2b , R 2c and R 2d are independently an amino acid side chain; at least one , , , or a protonated form thereof; at least one of R 2a , R 2b , R 2c and R 2d is guanidine or a protonated form thereof; each n” is independently an integer 0, 1, 2, 3, 4, or 5; each n’ is independently an integer from 0, 1, 2, or3; and if n’ is 0 then R 2a , R 2b , R 2b or R 2d is absent.
  • AASC is an amino acid side chain
  • R 1a , R 1b , and R 1c are each independently a 6- to 14-member
  • At least two , , , or a protonated form thereof Two or three of R 2a , R 2b , R 2c and R 2d can NH O protonated form thereof.
  • One of R 2a , R 2b , R 2c and R 2d can be , , , , p , g , R 2b , R 2c and R 2d can be guanidine or a protonated form thereof.
  • At least two of R 2a , R 2b , R 2c and R 2d can be , or a protonated form thereof, and the remaining of R 2a , R 2b , R 2c and R 2d can be guanidine, or a protonated form thereof.
  • R 2a , R 2b , R 2c and R 2d can be guaninide or a protonated form thereof.
  • At least two R 2a , R 2b , R 2c and R 2d groups can be , or a protonated form thereof, and the remaining of R 2a , R 2b , R 2c and R 2d are guanidine, or a protonated form thereof.
  • Each of R 2a , R 2b , R 2c and R 2d can independently be 2,3-diaminopropionic acid, 2,4- diaminobutyric acid, the side chains of ornithine, lysine, methyllysine, dimethyllysine, trimethyllysine, homo-lysine, serine, homo-serine, threonine, allo-threonine, histidine, 1- methylhistidine, 2-aminobutanedioic acid, aspartic acid, glutamic acid, or homo-glutamic acid. [ , wherein t can be an integer from 0 to 5. , wherein t can be an integer from 0 to 5.
  • R 1a , R 1b , and R 1c can each independently be 6- to 14-membered aryl.
  • R 1a , R 1b , and R 1c can be each independently a 6- to 14-membered heteroaryl having one or more heteroatoms selected from N, O, or S.
  • R 1a , R 1b , and R 1c can each be independently selected from phenyl, naphthyl, anthracenyl, pyridyl, quinolyl, or isoquinolyl.
  • R 1a , R 1b , and R 1c can each be independently selected from phenyl, naphthyl, or anthracenyl.
  • R 1a , R 1b , and R 1c can each be independently phenyl or naphthyl.
  • R 1a , R 1b , and R 1c can each be independently selected pyridyl, quinolyl, or isoquinolyl.
  • Each n’ can independently be 1 or 2.
  • Each n’ can be 1.
  • Each n’ can be 2.
  • At least one n’ can be 0.
  • At least one n’ can be 1.
  • At least one n’ can be 2.
  • At least one n’ can be 3.
  • At least one n’ can be 4.
  • At least one n’ can be 5.
  • Each n” can independently be an integer from 1 to 3. Each n” can independently be 2 or 3. Each n” can be 2. Each n” can be 3. At least one n” can be 0. At least one n” can be 1. At least one n” can be 2. At least one n” can be 3. [0311] Each n” can independently be 1 or 2 and each n’ can independently be 2 or 3. Each n” can be 1 and each n’ can independently be 2 or 3. Each n” can be 1 and each n’ can be 2. Each n” is 1 and each n’ is 3. [0312] The cCPP of Formula (II) can have the structure of Formula (II-1): w are as defined herein.
  • the cCPP of Formula (II) can have the structure of Formula (IIa): [0314]
  • the cCPP of formula (II) can have the structure of Formula (IIb): [0315]
  • the cCPP can have the structure of Formula (IIc): wherein: AA SC and n’ are as defined herein.
  • the cCPP of Formula (IIa) has one of the following structures:
  • cCPP of Formula (IIa) has one of the following structures:
  • the cCPP of Formula (IIa) has one of the following structures: , wherein AA SC and n are as defined herein. [0319]
  • the cCPP of Formula (II) can have the structure: .
  • the cCPP of Formula (II) can have the structure: , .
  • the cCPP can have the structure of Formula (III):
  • AA SC is an amino acid side chain
  • R 1a , R 1b , and R 1c are each independently a 6- to 14-membered aryl or a 6- to 14- membered heteroaryl
  • R 2a and R 2c are each independently H
  • , , , R 2b and R 2d are each independently guanidine or a protonated form thereof
  • each n” is independently an integer from 1 to 3
  • each n’ is independently an integer from 1 to 5
  • each p’ is independently an integer from 0 to 5.
  • the cCPP of Formula (III) can have the structure of Formula (III-1): wherein: AA SC , R 1a , R 1b , R 1c , R 2a , R 2c , R 2b , R 2d n’, n”, and p’ are as defined herein.
  • the cCPP of Formula (III) can have the structure of Formula (IIIa): wherein: AA SC , R 2a , R 2c , R 2b , R 2d n’, n”, and p’ are as defined herein.
  • R a and R c can be H.
  • R a and R c can be H and R b and R d can each independently be guanidine or protonated form thereof.
  • R a can be H.
  • R b can be H.
  • p’ can be 0.
  • R a and R c can be H and each p’ can be 0. [0325]
  • R a and R c can be H, R b and R d can each independently be guanidine or protonated form thereof, n” can be 2 or 3, and each p’ can be 0.
  • p’ can 0.
  • p’ can 0.
  • p’ can 1.
  • p’ can 2.
  • p’ can 3.
  • p’ can 4.
  • p’ can be 5.
  • the cCPP can have the structure:
  • the cCPP of Formula (A) can be selected from: [0329]
  • the cCPP of Formula (A) can be selected from: [0330] In embodiments, the cCPP is selected from:
  • the cCPP can comprise the structure of Formula (D) NH H 2 N NH NH H 2 N R6 O HN m NH N O H or a protonated form thereof, wherein: R1, R2, and R3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; each m is independently an integer 0, 1, 2, or 3, and each n is independently an integer 0, 1, 2, or 3.
  • the cCPP of Formula (D) can have the structure of Formula (D-I): or a protonated form thereof, wherein: R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; each m is independently an integer 0, 1, 2, or 3, and [0334]
  • the cCPP of Formula (D) can have the structure of Formula (D-II): or a protonated form thereof, wherein: R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently
  • R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; each m is independently an integer 0, 1, 2, or 3, each n is independently an integer 0, 1, 2, or 3, and [0336]
  • the cCPP of Formula (D) can have the structure of Formula (D-IV):
  • R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; each m is independently an integer 0, 1, 2, or 3, and [0337]
  • the cCPP of Formula (D) can have the structure of Formula (D-V):
  • R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; at least one of R 1 , R 2 , and R 3 is an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 6 are independently H or an amino acid side chain; AA SC is an amino acid side chain; q is 1, 2, 3 or 4; each m is independently an integer 0, 1, 2, or 3, and .
  • the AA SC can be conjugated to a linker.
  • Linker [0339]
  • the cCPP of the disclosure can be conjugated to a linker.
  • the linker can link a cargo to the cCPP.
  • the linker can be attached to the side chain of an amino acid of the cCPP, and the cargo can be attached at a suitable position on linker.
  • the linker can be any appropriate moiety which can conjugate a cCPP to one or more additional moieties, e.g., an exocyclic peptide (EP) and/or a cargo. Prior to conjugation to the cCPP and one or more additional moieties, the linker has two or more functional groups, each of which are independently capable of forming a covalent bond to the cCPP and one or more additional moieties. If the cargo is an oligonucleotide, the linker can be covalently bound to the 5' end of the cargo or the 3' end of the cargo.
  • the linker can be covalently bound to the 5' end of the cargo.
  • the linker can be covalently bound to the 3' end of the cargo. If the cargo is a peptide, the linker can be covalently bound to the N-terminus or the C-terminus of the cargo.
  • the linker can be covalently bound to the backbone of the oligonucleotide or peptide cargo.
  • the linker can be any appropriate moiety which conjugates a cCPP described herein to a cargo such as an oligonucleotide, peptide or small molecule.
  • the linker can comprise hydrocarbon linker.
  • the linker can comprise a cleavage site.
  • the cleavage site can be a disulfide, or caspase- cleavage site (e.g, Val-Cit-PABC).
  • the linker can comprise: (i) one or more D or L amino acids, each of which is optionally substituted; (ii) optionally substituted alkylene; (iii) optionally substituted alkenylene; (iv) optionally substituted alkynylene; (v) optionally substituted carbocyclyl; (vi) optionally substituted heterocyclyl; (vii) one or more -(R 1- J-R 2 )z”- subunits, wherein each of R 1 and R 2 , at each instance, are independently selected from alkylene, alkenylene, alkynylene, carbocyclyl, and heterocyclyl, each J is independently C, NR 3 , -NR 3 C(O)-, S, and O, wherein R 3 is independently selected from H, alkyl, alkenyl, alkynyl,
  • the linker can comprise one or more D or L amino acids and/or -(R 1- J-R 2 )z”-, wherein each of R 1 and R 2 , at each instance, are independently alkylene, each J is independently C, NR 3 , - NR 3 C(O)-, S, and O, wherein R 4 is independently selected from H and alkyl, and z” is an integer from 1 to 50; or combinations thereof.
  • the linker can comprise a -(OCH 2 CH 2 ) z’ - (e.g., as a spacer), wherein z’ is an integer from 1 to 23, e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23. “- (OCH 2 CH 2 ) z’ can also be referred to as polyethylene glycol (PEG).
  • the linker can comprise one or more amino acids.
  • the linker can comprise a peptide.
  • the linker can comprise a -(OCH 2 CH 2 ) z’ -, wherein z’ is an integer from 1 to 23, and a peptide.
  • the peptide can comprise from 2 to 10 amino acids.
  • the linker can further comprise a functional group (FG) capable of reacting through click chemistry.
  • FG can be an azide or alkyne, and a triazole is formed when the cargo is conjugated to the linker.
  • the linker can comprises (i) a ⁇ alanine residue and lysine residue; (ii) -(J-R 1 )z”; or (iii) a combination thereof.
  • Each R 1 can independently be alkylene, alkenylene, alkynylene, carbocyclyl, or heterocyclyl, each J is independently C, NR 3 , -NR 3 C(O)-, S, or O, wherein R 3 is H, alkyl, alkenyl, alkynyl, carbocyclyl, or heterocyclyl, each of which is optionally substituted, and z” can be an integer from 1 to 50.
  • Each R 1 can be alkylene and each J can be O.
  • the linker can comprise (i) residues of ⁇ -alanine, glycine, lysine, 4-aminobutyric acid, 5- aminopentanoic acid, 6-aminohexanoic acid or combinations thereof; and (ii) -(R 1- J)z”- or -(J- R 1 )z”.
  • Each R 1 can independently be alkylene, alkenylene, alkynylene, carbocyclyl, or heterocyclyl, each J is independently C, NR 3 , -NR 3 C(O)-, S, or O, wherein R 3 is H, alkyl, alkenyl, alkynyl, carbocyclyl, or heterocyclyl, each of which is optionally substituted, and z” can be an integer from 1 to 50.
  • Each R 1 can be alkylene and each J can be O.
  • the linker can comprise glycine, beta-alanine, 4-aminobutyric acid, 5-aminopentanoic acid, 6-aminohexanoic acid, or a combination thereof.
  • the linker can be a trivalent linker.
  • the linker can have the structure: , wherein A 1 , B 1 , and C 1 , can independently be a hydrocarbon linker (e.g., NRH-(CH 2 ) n -COOH), a PEG linker (e.g., NRH-(CH 2 O) n -COOH, wherein R is H, methyl or ethyl) or one or more amino acid residue, and Z is independently a protecting group.
  • a 1 , B 1 , and C 1 can independently be a hydrocarbon linker (e.g., NRH-(CH 2 ) n -COOH), a PEG linker (e.g., NRH-(CH 2 O) n -COOH, wherein R is H, methyl or ethyl) or one or more amino acid residue, and Z is independently a protecting group.
  • the linker can also incorporate a cleavage site, including a disulfide [NH 2 - (CH 2 O) n -S-S-(CH 2 O) n -COOH], or caspase-cleavage site (Val-Cit-PABC).
  • the hydrocarbon can be a residue of glycine or beta-alanine.
  • the linker can be bivalent and link the cCPP to a cargo.
  • the linker can be bivalent and link the cCPP to an exocyclic peptide (EP).
  • EP exocyclic peptide
  • the linker can be trivalent and link the cCPP to a cargo and to an EP.
  • the linker can be a bivalent or trivalent C 1 -C 50 alkylene, wherein 1-25 methylene groups are optionally and independently replaced by -N(H)-, -N(C 1 -C 4 alkyl)-, -N(cycloalkyl)-, -O-, - C(O)-, -C(O)O-, -S-, -S(O)-, -S(O) 2 -, -S(O) 2 N(C 1 -C 4 alkyl)-, -S(O) 2 N(cycloalkyl)-, -N(H)C(O)-, -N(C 1 -C 4 alkyl)C(O)-, -N(cycloalkyl)C(O)-, -C(O)N(H)-, -C(O)N(C 1 -C 4 alkyl), - C(O)N(cycloalkyl), aryl
  • the linker can be a bivalent or trivalent C 1 -C 50 alkylene, wherein 1-25 methylene groups are optionally and independently replaced by -N(H)-, -O-, -C(O)N(H)-, or a combination thereof.
  • the linker can have the structure: , wherein: each AA is independently an amino acid residue; * is the point of attachment to the AA SC , and AA SC is side chain of an amino acid residue of the cCPP; x is an integer from 1-10; y is an integer from 1-5; and z is an integer from 1-10.
  • x can be an integer from 1-5.
  • x can be an integer from 1-3.
  • x can be 1.
  • y can be an integer from 2-4.
  • y can be 4.
  • z can be an integer from 1-5.
  • z can be an integer from 1-3.
  • z can be 1.
  • Each AA can independently be selected from glycine, E-alanine, 4-aminobutyric acid, 5-aminopentanoic acid, and 6-aminohexanoic acid.
  • the cCPP can be attached to the cargo through a linker (“L”).
  • the linker can be conjugated to the cargo through a bonding group (“M”).
  • the linker can have the structure: , wherein: x is an integer from 1-10; y is an integer from 1- 5; z is an integer from 1-10; each AA is independently an amino acid residue; * is the point of attachment to the AA SC , and AA SC is side chain of an amino acid residue of the cCPP; and M is a bonding group defined herein.
  • the linker can have the structure: , wherein: x’ is an integer from 1-23; y is an integer from 1-5; z’ is an integer from 1-23; * is the point of attachment to the AA SC , and AA SC is a side chain of an amino acid residue of the cCPP; and M is a bonding group defined herein.
  • the linker can have the structure: wherein: x’ is an integer from 1-23; y is an integer from 1-5; and z’ is an integer from 1- 23; * is the point of attachment to the AA SC , and AA SC is a side chain of an amino acid residue of the cCPP.
  • x can be an integer from 1-10, e.g.,1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, inclusive of all ranges and subranges therebetween.
  • x’ can be an integer from 1-23, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, inclusive of all ranges and subranges therebetween.
  • x’ can be an integer from 5-15.
  • x’ can be an integer from 9-13.
  • x’ can be an integer from 1-5.
  • x’ can be 1.
  • y can be an integer from 1-5, e.g., 1, 2, 3, 4, or 5, inclusive of all ranges and subranges therebetween.
  • y can be an integer from 2-5.
  • y can be an integer from 3-5.
  • y can be 3 or 4.
  • y can be 4 or 5.
  • y can be 3.
  • y can be 4.
  • y can be 5.
  • z can be an integer from 1-10, e.g.,1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, inclusive of all ranges and subranges therebetween.
  • z’ can be an integer from 1-23, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23, inclusive of all ranges and subranges therebetween.
  • z’ can be an integer from 5-15.
  • z’ can be an integer from 9-13.
  • z’ can be 11.
  • the linker or M (wherein M is part of the linker) can be covalently bound to cargo at any suitable location on the cargo.
  • the linker or M (wherein M is part of the linker) can be covalently bound to the 3' end of oligonucleotide cargo or the 5' end of an oligonucleotide cargo.
  • the linker or M (wherein M is part of the linker) can be covalently bound to the N-terminus or the C-terminus of a peptide cargo.
  • the linker or M (wherein M is part of the linker) can be covalently bound to the backbone of an oligonucleotide or a peptide cargo.
  • the linker can be bound to the side chain of aspartic acid, glutamic acid, glutamine, asparagine, or lysine, or a modified side chain of glutamine or asparagine (e.g., a reduced side chain having an amino group), on the cCPP.
  • the linker can be bound to the side chain of lysine on the cCPP.
  • the linker can be bound to the side chain of aspartic acid, glutamic acid, glutamine, asparagine, or lysine, or a modified side chain of glutamine or asparagine (e.g., a reduced side chain having an amino group), on a peptide cargo.
  • the linker can be bound to the side chain of lysine on the peptide cargo.
  • the linker can have a structure: , wherein M is a group that conjugates L to a cargo, for example, an oligonucleotide; AA s is a side chain or terminus of an amino acid on the cCPP; each AA x is independently an amino acid residue; o is an integer from 0 to 10; and p is an integer from 0 to 5.
  • the linker can have a structure: , wherein M is a group that conjugates L to a cargo, for example, an oligonucleotide; AA s is a side chain or terminus of an amino acid on the cCPP; each AA x is independently an amino acid residue; o is an integer from 0 to 10; and p is an integer from 0 to 5.
  • M can comprise an alkylene, alkenylene, alkynylene, carbocyclyl, or heterocyclyl, each of which is optionally substituted. M can be selected from: , wherein R is alkyl, alkenyl, alkynyl, carbocyclyl, or heterocyclyl.
  • M can be selected from: [0371] M can [ disclosed in Williams et al. Curr. Protoc Nucleic Acid Chem. 2010, 42, 4.41.1-4.41.20, incorporated herein by reference its entirety. [0373] M can be -C(O)-. [0374] AA s can be a side chain or terminus of an amino acid on the cCPP. Non-limiting examples of AAs include aspartic acid, glutamic acid, glutamine, asparagine, or lysine, or a modified side chain of glutamine or asparagine (e.g., a reduced side chain having an amino group). AA s can be an AA SC as defined herein.
  • Each AA x is independently a natural or non-natural amino acid.
  • One or more AA x can be a natural amino acid.
  • One or more AA x can be a non-natural amino acid.
  • One or more AA x can be a E-amino acid.
  • the E-amino acid can be E-alanine.
  • o can be an integer from 0 to 10, e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10. o can be 0, 1, 2, or 3.
  • o can be 0.
  • o can be 1.
  • o can be 2.
  • o can be 3.
  • p can be 0 to 5, e.g., 0, 1, 2, 3, 4, or 5.
  • p can be 0.
  • p can be 1. p can be 2.
  • the linker can have the structure: wherein M, AA s , each -(R 1- J-R 2 )z”-, o and z” are defined herein; r can be 0 or 1. [0379] r can be 0. r can be 1. [0380] The linker can have the structure: wherein each of M, AA s , o, p, q, r and z” can be as defined herein.
  • z can be an integer from 1 to 50, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50, inclusive of all ranges and values therebetween.
  • z can be an integer from 5-20.
  • z can be an integer from 10-15.
  • the linker can have the structure: , wherein: M, AA s and o are as defined herein.
  • Other non-limiting examples of suitable linkers include:
  • M and AA s are as defined herein.
  • the linker can have the structure: wherein AA s is as defined herein, and m’ is 0-10. [0388] The linker can be of the formula: . [0389] The linker can be of the formula: , wherein “base” is a nucleobase at the 3’ end of a cargo phosphorodiamidate morpholino oligomer. [0390] The linker can be of the formula:
  • the linker can be of the formula: , wherein “base” is a nucleobase at the 3’ end of a cargo phosphorodiamidate morpholino oligomer.
  • the linker can be of the formula: , wherein “base” is a nucleobase at the 3’ end of a cargo phosphorodiamidate morpholino oligomer.
  • the linker can be of the formula: , wherein “base” is a nucleobase at the 3’ end of a cargo phosphorodiamidate morpholino oligomer.
  • the linker can be of the formula: Base .
  • the linker can be covalently bound to a cargo at any suitable location on the cargo.
  • the linker is covalently bound to the 3' end of cargo or the 5' end of an oligonucleotide cargo
  • the linker can be covalently bound to the backbone of a cargo.
  • the linker can be bound to the side chain of aspartic acid, glutamic acid, glutamine, asparagine, or lysine, or a modified side chain of glutamine or asparagine (e.g., a reduced side chain having an amino group), on the cCPP.
  • the linker can be bound to the side chain of lysine on the cCPP.
  • cCPP-linker conjugates [0396]
  • the cCPP can be conjugated to a linker defined herein.
  • the linker can be conjugated to an AA SC of the cCPP as defined herein.
  • the linker can comprise a -(OCH 2 CH 2 ) z’ - subunit (e.g., as a spacer), wherein z’ is an integer from 1 to 23, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or 23.
  • -(OCH 2 CH 2 ) z’ is also referred to as PEG.
  • the cCPP-linker conjugate can have a structure selected from Table 7: Table 7: cCPP-linker conjugates and SEQ ID NOs [0398]
  • the linker can comprise a -(OCH 2 CH 2 ) z’ - subunit, wherein z’ is an integer from 1 to 23, and a peptide subunit.
  • the peptide subunit can comprise from 2 to 10 amino acids.
  • the cCPP- linker conjugate can have a structure selected from Table 8: Table 8: cCPP-linker conjugate and SEQ ID NOs [0399]
  • EEVs comprising a cyclic cell penetrating peptide (cCPP), linker and exocyclic peptide (EP) are provided.
  • An EEV can comprise the structure of Formula (B):
  • R 1 , R 2 , and R 3 are each independently H or an aromatic or heteroaromatic side chain of an amino acid; R 4 and R 7 are independently H or an amino acid side chain; EP is an exocyclic peptide as defined herein; each m is independently an integer from 0-3; n is an integer from 0-2; x’ is an integer from 1-20; y is an integer from 1-5; q is 1-4; and z’ is an integer from 1-23.
  • R 1 , R 2 , R 3 , R 4 , R 7 , EP, m, q, y, x’, z’ are as described herein.
  • n can be 0.
  • n can be 1.
  • the EEV can comprise the structure of Formula (B-a) or (B-b):
  • the EEV can comprises the structure of Formula (B-c):
  • the EEV can have the structure of Formula (B-1), (B-2), (B-3), or (B-4):
  • the EEV can comprise Formula (B) and can have the structure: Ac-PKKKRKVAEEA- K(cyclo[FGFGRGRQ])-PEG 12 -OH (Ac-SEQ ID NO:132- K(cyclo[SEQ ID NO:82])-PEG 12 -OH) or Ac-PK-KKR-KV-AEEA-K(cyclo[GfFGrGrQ])-PEG 12 -OH (Ac- SEQ ID NO:133- K(cyclo[SEQ ID NO:83])-PEG 12 -OH).
  • the EEV can comprise a cCPP of formula: [0407]
  • the EEV can comprise formula: Ac-PKKKRKV-miniPEG 2 -Lys(cyclo(FfFGRGRQ)- PEG 2 -K(N 3 ) (Ac-SEQ ID NO:42-miniPEG 2 -Lys(cyclo(SEQ ID NO:81)-PEG 2 -K(N 3 )).
  • the EEV can be: [ .
  • the EEV can be Ac-P-K(Tfa)-K(Tfa)-K(Tfa)-R-K(Tfa)-V-miniPEG 2 -K(cyclo(Ff-Nal- GrGrQ)-PEG 12 -OH (Ac-SEQ ID NO:134-miniPEG 2 -K(cyclo(SEQ ID NO:135)-PEG 12 -OH).
  • the EEV can be .
  • the EEV can be Ac-P-K-K-K-R-K-V-miniPEG 2 -K(cyclo(Ff-Nal-GrGrQ)-PEG 12 -OH (Ac- SEQ ID NO:42-miniPEG 2 -K(cyclo(SEQ ID NO:135)-PEG 12 -OH). [0413] The EEV can be
  • the EEV can be any type of the EEV.
  • the EEV can be any type of material. [0416] The EEV can be any type of material.
  • the EEV can be:
  • the EEV can be [0422] The EEV can be . [0423] The EEV can be selected from
  • the EEV can be selected from: Ac-PKKKRKV-Lys(cyclo[Ff ⁇ GrGrQ])-PEG 12 -K(N 3 )-NH 2 (Ac- SEQ ID NO:42-Lys(cyclo[SEQ ID NO:80])-PEG 12 -K(N 3 )-NH 2 ) Ac-PKKKRKV-miniPEG 2 -Lys(cyclo[Ff ⁇ GrGrQ])-miniPEG 2 -K(N 3 )-NH 2 (Ac- SEQ ID NO:42-miniPEG 2 -Lys(cyclo[SEQ ID NO:80])-miniPEG 2 -K(N 3 )-NH 2 ) Ac-PKKKRKV-miniPEG 2 -Lys(cyclo[FGFGRGRQ])-miniPEG 2 -K(N 3 )-NH 2 (Ac- SEQ ID NO:42-miniPEG 2 -Lys(cycl
  • the EEV can be selected from: Ac-PKKKRKV-miniPEG 2 -Lys(cyclo(GfFGrGrQ])-PEG 12 -OH (Ac- SEQ ID NO:42-miniPEG 2 -Lys(cyclo(SEQ ID NO:133])-PEG 12 -OH) Ac-PKKKRKV-miniPEG 2 -Lys(cyclo[FGFKRKRQ])-PEG 12 -OH (Ac- SEQ ID NO:42-miniPEG 2 -Lys(cyclo[SEQ ID NO:144])-PEG 12 -OH) Ac-PKKKRKV-miniPEG 2 -Lys(cyclo[FGFRGRGQ])-PEG 12 -OH (Ac- SEQ ID NO:42-miniPEG 2 -Lys(cyclo[SEQ ID NO:145])-PEG 12 -OH) Ac-PKKKRKV-miniPEG 2 -OH (A
  • the EEV can be selected from: Ac-K-K-K-R-K-G-miniPEG 2 -K(cyclo[FGFGRGRQ])-PEG 12 -OH (Ac-SEQ ID NO:148-miniPEG 2 -K(cyclo[SEQ ID NO:82])-PEG 12 -OH) Ac-K-K-K-R-K-miniPEG 2 -K(cyclo[FGFGRGRQ])-PEG 12 -OH (Ac- SEQ ID NO:19-miniPEG 2 -K(cyclo[SEQ ID NO:82])-PEG 12 -OH) Ac-K-K-R-K-K-PEG 4 -K(cyclo[FGFGRGRQ])-PEG 12 -OH (Ac- SEQ ID NO:22-PEG 4 -K(cyclo[SEQ ID NO:82])-PEG 12 -OH) Ac-K-R-K-K-K-PEG 4 -K(cyclo
  • the EEV can be selected from: Ac-PKKKRKV-PEG 2 -K(cyclo[FGFGRGRQ])-PEG 2 -K(N 3 )-NH 2 (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:82])-PEG 2 -K(N 3 )-NH 2 ) Ac-PKKKRKV-PEG 2 -K(cyclo[FGFGRGRQ])-PEG 12 -OH (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:82])-PEG 12 -OH) Ac-PKKKRKV-PEG 2 -K(cyclo[GfFGrGrQ])-PEG 2 -K(N 3 )-NH 2 (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:133])-PEG 2 -K(N 3 )-NH 2 )
  • the cargo can be an AC and the EEV can be selected from: Ac-PKKKRKV-PEG 2 -K(cyclo[Ff ⁇ GrGrQ])-PEG 12 -OH (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:80])-PEG 12 -OH) Ac-PKKKRKV-PEG 2 -K(cyclo[Ff ⁇ Cit-r-Cit-rQ])-PEG 12 -OH (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:79])-PEG 12 -OH) Ac-PKKKRKV-PEG 2 -K(cyclo[FfFGRGRQ])-PEG 12 -OH (Ac- SEQ ID NO:42-PEG 2 -K(cyclo[SEQ ID NO:81])-PEG 12 -OH) Ac-PKKKRKV-PEG 2 -K(cyclo[SEQ
  • the cell penetrating peptide such as a cyclic cell penetrating peptide (e.g., cCPP), can be conjugated to a cargo.
  • “cargo” is a compound or moiety for which delivery into a cell is desired.
  • the cargo can be conjugated to a terminal carbonyl group of a linker. At least one atom of the cyclic peptide can be replaced by a cargo or at least one lone pair can form a bond to a cargo.
  • the cargo can be conjugated to the cCPP by a linker.
  • the cargo can be conjugated to an AA SC by a linker.
  • At least one atom of the cCPP can be replaced by the cargoty or at least one lone pair of the cCPP forms a bond to the cargo.
  • a hydroxyl group on an amino acid side chain of the cCPP can be replaced by a bond to the cargo.
  • a hydroxyl group on a glutamine side chain of the cCPP can be replaced by a bond to the cargo.
  • the cargo can be conjugated to the cCPP by a linker.
  • the cargo can be conjugated to an AA SC by a linker.
  • the amino acid side chain comprises a chemically reactive group to which the linker or cargo is conjugated.
  • the chemically reactive group can comprise an amine group, a carboxylic acid, an amide, a hydroxyl group, a sulfhydryl group, a guanidinyl group, a phenolic group, a thioether group, an imidazolyl group, or an indolyl group.
  • the amino acid of the cCPP to which the cargo is conjugated comprises lysine, arginine, aspartic acid, glutamic acid, asparagine, glutamine, homoglutamine, serine, threonine, tyrosine, cysteine, arginine, tyrosine, methionine, histidine or tryptophan.
  • the cargo can comprise one or more detectable moieties, one or more therapeutic moieties (TMs), one or more targeting moieties, or any combination thereof.
  • the cargo comprises a TM.
  • the cargo comprises an AC.
  • Cyclic cell penetrating peptides (cCPPs) conjugated to a cargo moiety [0432] The cyclic cell penetrating peptide (cCPP) can be conjugated to a cargo moiety.
  • the cargo moiety can be conjugated to the linker at the terminal carbonyl group to provide the following structure: , wherein: EP is an exocyclic peptide and M, AA SC , Cargo, x’, y, and z’ are as defined above, * is the point of attachment to the AA SC. . x’ can be 1. y can be 4. z’ can be 11.
  • An endosomal escape vehicle can comprise a cyclic cell penetrating peptide (cCPP), an exocyclic peptide (EP) and linker, and can be conjugated to a cargo to form an EEV- conjugate comprising the structure of Formula (C):
  • R 1 , R 2 , and R 3 can each independently be H or an amino acid residue having a side chain comprising an aromatic group; R 4 is H or an amino acid side chain; EP is an exocyclic peptide as defined herein; Cargo is a moiety as defined herein; each m is independently an integer from 0-3; n is an integer from 0-2; x’ is an integer from 2-20; y is an integer from 1-5; q is an integer from 1-4; and z’ is an integer from 2-20. [0435] R 1 , R 2 , R 3, R 4 , EP, cargo, m, n, x’, y, q, and z’ are as defined herein.
  • the EEV can be conjugated to a cargo and the EEV-conjugate can comprise the structure of Formula (C-a) or (C-b): protonated form thereof, wherein EP, m and z are as defined above in Formula (C).
  • the EEV can be conjugated to a cargo and the EEV-conjugate can comprise the structure of Formula (C-c): or a protonated form thereof, wherein EP, R 1 , R 2 , R 3 , R 4 , and m are as defined above in Formula (III); AA can be an amino acid as defined herein; n can be an integer from 0-2; x can be an integer from 1-10; y can be an integer from 1-5; and z can be an integer from 1-10. [0438] The EEV can be conjugated to an oligonucleotide cargo and the EEV-oligonucleotide conjugate can comprises a structure of Formula (C-1), (C-2), (C-3), or (C-4):
  • the EEV can be conjugated to an oligonucleotide cargo and the EEV-conjugate can comprise the structure: O .
  • Cytosolic Delivery Efficiency Modifications to a cyclic cell penetrating peptide (cCPP) may improve cytosolic delivery efficiency. Improved cytosolic uptake efficiency can be measured by comparing the cytosolic delivery efficiency of a cCPP having a modified sequence to a control sequence.
  • the control sequence does not include a particular replacement amino acid residue in the modified sequence (including, but not limited to arginine, phenylalanine, and/or glycine), but is otherwise identical.
  • cytosolic delivery efficiency refers to the ability of a cCPP to traverse a cell membrane and enter the cytosol of a cell. Cytosolic delivery efficiency of the cCPP is not necessarily dependent on a receptor or a cell type. Cytosolic delivery efficiency can refer to absolute cytosolic delivery efficiency or relative cytosolic delivery efficiency. [0442] Absolute cytosolic delivery efficiency is the ratio of cytosolic concentration of a cCPP (or a cCPP-cargo conjugate) over the concentration of the cCPP (or the cCPP-cargo conjugate) in the growth medium.
  • Relative cytosolic delivery efficiency refers to the concentration of a cCPP in the cytosol compared to the concentration of a control cCPP in the cytosol. Quantification can be achieved by fluorescently labeling the cCPP (e.g., with a FITC dye) and measuring the fluorescence intensity using techniques well-known in the art. [0443] Relative cytosolic delivery efficiency is determined by comparing (i) the amount of a cCPP of the invention internalized by a cell type (e.g., HeLa cells) to (ii) the amount of a control cCPP internalized by the same cell type.
  • a cell type e.g., HeLa cells
  • the cell type may be incubated in the presence of a cCPP for a specified period of time (e.g., 30 minutes, 1 hour, 2 hours, etc.) after which the amount of the cCPP internalized by the cell is quantified using methods known in the art, e.g., fluorescence microscopy.
  • a specified period of time e.g. 30 minutes, 1 hour, 2 hours, etc.
  • the same concentration of the control cCPP is incubated in the presence of the cell type over the same period of time, and the amount of the control cCPP internalized by the cell is quantified.
  • Relative cytosolic delivery efficiency can be determined by measuring the IC 50 of a cCPP having a modified sequence for an intracellular target and comparing the IC 50 of the cCPP having the modified sequence to a control sequence (as described herein).
  • the relative cytosolic delivery efficiency of the cCPPs can be in the range of from about 50% to about 450% compared to cyclo(Ff ⁇ RrRrQ, SEQ ID NO:150), e.g., about 60%, about 70%, about 80%, about 90%, about 100%, about 110%, about 120%, about 130%, about 140%, about 150%, about 160%, about 170%, about 180%, about 190%, about 200%, about 210%, about 220%, about 230%, about 240%, about 250%, about 260%, about 270%, about 280%, about 290%, about 300%, about 310%, about 320%, about 330%, about 340%, about 350%, about 360%, about 370%, about 380%, about 390%, about 400%, about 410%, about 420%, about 430%, about 440%, about 450%, about 460%, about 470%, about 480%, about 490%, about 500%, about 510%, about 520%, about 530%, about 540%, about 55
  • the relative cytosolic delivery efficiency of the cCPPs can be improved by greater than about 600% compared to a cyclic peptide comprising cyclo(Ff ⁇ RrRrQ, SEQ ID NO:150).
  • the absolute cytosolic delivery efficacy of from about 40% to about 100%, e.g., about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, inclusive of all values and subranges therebetween.
  • the cCPPs of the present disclosure can improve the cytosolic delivery efficiency by about 1.1 fold to about 30 fold, compared to an otherwise identical sequence, e.g., about 1.2, about 1.3, about 1.4, about 1.5, about 1.6, about 1.7, about 1.8, about 1.9, about 2.0, about 2.5, about 3.0, about 3.5, about 4.0, about 4.5, about 5.0, about 5.5, about 6.0, about 6.5, about 7.0, about 7.5, about 8.0, about 8.5, about 9.0, about 10, about 10.5, about 11.0, about 11.5, about 12.0, about 12.5, about 13.0, about 13.5, about 14.0, about 14.5, about 15.0, about 15.5, about 16.0, about 16.5, about 17.0, about 17.5, about 18.0, about 18.5, about 19.0, about 19.5, about 20, about 20.5, about 21.0, about 21.5, about 22.0, about 22.5, about 23.0, about 23.5, about 24.0, about 24.5, about 25.0, about 25.5, about 26.0
  • the compound disclosed herein includes a detectable moiety.
  • the detectible moiety is attached to the cell penetrating peptide at the amino group, the carboxylate group, or the side chain of any of the amino acids of the cell penetrating peptide moiety (e.g., at the amino group, the carboxylate group, or the side chain of any amino acid in the CPP).
  • the therapeutic moiety includes a detectable moiety.
  • the detectable moiety can include any detectable label.
  • detectable labels include, but are not limited to, a UV-Vis label, a near-infrared label, a luminescent group, a phosphorescent group, a magnetic spin resonance label, a photosensitizer, a photocleavable moiety, a chelating center, a heavy atom, a radioactive isotope, an isotope detectable spin resonance label, a paramagnetic moiety, a chromophore, or any combination thereof.
  • the label is detectable without the addition of further reagents.
  • the detectable moiety is a biocompatible detectable moiety, such that the compounds can be suitable for use in a variety of biological applications.
  • Biocompatible and “biologically compatible”, as used herein, generally refer to compounds that are, along with any metabolites or degradation products thereof, generally non-toxic to cells and tissues, and which do not cause any significant adverse effects to cells and tissues when cells and tissues are incubated (e.g., cultured) in their presence.
  • the detectable moiety can contain a luminophore such as a fluorescent label or near- infrared label.
  • luminophores include, but are not limited to, metal porphyrins; benzoporphyrins; azabenzoporphyrine; napthoporphyrin; phthalocyanine; polycyclic aromatic hydrocarbons such as perylene diimine, pyrenes; azo dyes; xanthene dyes; boron dipyoromethene, aza-boron dipyoromethene, cyanine dyes, metal-ligand complex such as bipyridine, bipyridyls, phenanthroline, coumarin, and acetylacetonates of ruthenium and iridium; acridine, oxazine derivatives such as benzophenoxazine; aza-annulene, squaraine; 8-hydroxyquinoline, polymethines, luminescent producing nanoparticle, such as quantum dots, nanocrystals; carbostyril; terbium complex; inorganic phosphoric acid
  • Suitable luminophores include, but are not limited to, Pd (II) octaethylporphyrin; Pt (II)-octaethylporphyrin; Pd (II) tetraphenylporphyrin; Pt (II) tetraphenylporphyrin; Pd (II) meso-tetraphenylporphyrin tetrabenzoporphine; Pt (II) meso-tetraphenyl metrylbenzoporphyrin; Pd (II) octaethylporphyrin ketone; Pt (II) octaethylporphyrin ketone; Pd (II) meso-tetra(pentafluorophenyl)porphyrin; Pt (II) meso-tetra (pentafluoropheny
  • the detectable moiety can include Rhodamine B (Rho), fluorescein isothiocyanate (FITC), 7-amino-4-methylcourmarin (Amc), green fluorescent protein (GFP), or derivatives or combinations thereof.
  • Rho Rhodamine B
  • FITC fluorescein isothiocyanate
  • Amc 7-amino-4-methylcourmarin
  • GFP green fluorescent protein
  • chirality of the molecule can be changed.
  • compound synthesis can involve the protection and deprotection of various chemical groups. The use of protection and deprotection, and the selection of appropriate protecting groups can be determined by one skilled in the art. The chemistry of protecting groups can be found, for example, in Wuts and Greene, Protective Groups in Organic Synthesis, 4th Ed., Wiley & Sons, 2006, which is incorporated herein by reference in its entirety.
  • the starting materials and reagents used in preparing the disclosed compounds and compositions are either available from commercial suppliers such as Aldrich Chemical Co., (Milwaukee, WI), Acros Organics (Morris Plains, NJ), Fisher Scientific (Pittsburgh, PA), Sigma (St.
  • Reactions to produce the compounds described herein can be carried out in solvents, which can be selected by one of skill in the art of organic synthesis. Solvents can be substantially nonreactive with the starting materials (reactants), the intermediates, or products under the conditions at which the reactions are carried out, i.e., temperature and pressure. Reactions can be carried out in one solvent or a mixture of more than one solvent. Product or intermediate formation can be monitored according to any suitable method known in the art.
  • product formation can be monitored by spectroscopic means, such as nuclear magnetic resonance spectroscopy (e.g., 1 H or 13 C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high-performance liquid chromatography (HPLC) or thin layer chromatography.
  • spectroscopic means such as nuclear magnetic resonance spectroscopy (e.g., 1 H or 13 C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high-performance liquid chromatography (HPLC) or thin layer chromatography.
  • spectroscopic means such as nuclear magnetic resonance spectroscopy (e.g., 1 H or 13 C) infrared spectroscopy, spectrophotometry (e.g., UV-visible), or mass spectrometry, or by chromatography such as high-performance liquid chromatography (HPLC) or
  • Suitable protecting groups are 9- fluorenylmethyloxycarbonyl (Fmoc), t-butyloxycarbonyl (Boc), benzyloxycarbonyl (Cbz), biphenylisopropyloxycarbonyl, t-amyloxycarbonyl, isobornyloxycarbonyl, ⁇ , ⁇ -dimethyl-3,5- dimethoxybenzyloxycarbonyl, o-nitrophenylsulfenyl, 2-cyano-t-butyloxycarbonyl, and the like.
  • the 9-fluorenylmethyloxycarbonyl (Fmoc) protecting group is particularly preferred for the synthesis of the disclosed compounds.
  • side chain protecting groups are, for side chain amino groups like lysine and arginine, 2,2,5,7,8-pentamethylchroman-6-sulfonyl (pmc), nitro, p-toluenesulfonyl, 4-methoxybenzene- sulfonyl, Cbz, Boc, and adamantyloxycarbonyl; for tyrosine, benzyl, o-bromobenzyloxy-carbonyl, 2,6-dichlorobenzyl, isopropyl, t-butyl (t-Bu), cyclohexyl, cyclopenyl and acetyl (Ac); for serine, t-butyl, benzyl and tetrahydropyranyl; for histidine, trityl, benzyl, Cbz, p-toluenesulfonyl and 2,4-dinitrophenyl; for tryptophan
  • the ⁇ -C-terminal amino acid is attached to a suitable solid support or resin.
  • suitable solid supports useful for the above synthesis are those materials which are inert to the reagents and reaction conditions of the stepwise condensation- deprotection reactions, as well as being insoluble in the media used.
  • Solid supports for synthesis of ⁇ -C-terminal carboxy peptides is 4-hydroxymethylphenoxymethyl-copoly(styrene-1% divinylbenzene) or 4-(2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxyacetamidoethyl resin available from Applied Biosystems (Foster City, Calif.).
  • the ⁇ -C-terminal amino acid is coupled to the resin by means of N,N'-dicyclohexylcarbodiimide (DCC), N,N'-diisopropylcarbodiimide (DIC) or O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate (HBTU), with or without 4-dimethylaminopyridine (DMAP), 1-hydroxybenzotriazole (HOBT), benzotriazol-1- yloxy-tris(dimethylamino)phosphoniumhexafluorophosphate (BOP) or bis(2-oxo-3- oxazolidinyl)phosphine chloride (BOPCl), mediated coupling for from about 1 to about 24 hours at a temperature of between 10°C and 50°C in a solvent such as dichloromethane or DMF.
  • DCC N,N'-dicyclohexylcarbodiimi
  • the Fmoc group is cleaved with a secondary amine, preferably piperidine, prior to coupling with the ⁇ -C-terminal amino acid as described above.
  • One method for coupling to the deprotected 4 (2',4'-dimethoxyphenyl-Fmoc-aminomethyl)phenoxy-acetamidoethyl resin is O-benzotriazol-1- yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate (HBTU, 1 equiv.) and 1- hydroxybenzotriazole (HOBT, 1 equiv.) in DMF.
  • the coupling of successive protected amino acids can be carried out in an automatic polypeptide synthesizer.
  • the ⁇ -N- terminus in the amino acids of the growing peptide chain are protected with Fmoc.
  • the removal of the Fmoc protecting group from the ⁇ -N-terminal side of the growing peptide is accomplished by treatment with a secondary amine, preferably piperidine. Each protected amino acid is then introduced in about 3-fold molar excess, and the coupling is preferably carried out in DMF.
  • the coupling agent can be O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate (HBTU, 1 equiv.) and 1-hydroxybenzotriazole (HOBT, 1 equiv.).
  • HBTU O-benzotriazol-1-yl-N,N,N',N'-tetramethyluroniumhexafluorophosphate
  • HOBT 1-hydroxybenzotriazole
  • Removal of the polypeptide and deprotection can be accomplished in a single operation by treating the resin-bound polypeptide with a cleavage reagent comprising thianisole, water, ethanedithiol and trifluoroacetic acid.
  • a cleavage reagent comprising thianisole, water, ethanedithiol and trifluoroacetic acid.
  • the resin is cleaved by aminolysis with an alkylamine.
  • the peptide can be removed by transesterification, e.g. with methanol, followed by aminolysis or by direct transamidation.
  • the protected peptide can be purified at this point or taken to the next step directly.
  • the removal of the side chain protecting groups can be accomplished using the cleavage cocktail described above.
  • the fully deprotected peptide can be purified by a sequence of chromatographic steps employing any or all of the following types: ion exchange on a weakly basic resin (acetate form); hydrophobic adsorption chromatography on underivitized polystyrene-divinylbenzene (for example, Amberlite XAD); silica gel adsorption chromatography; ion exchange chromatography on carboxymethylcellulose; partition chromatography, e.g. on Sephadex G-25, LH-20 or countercurrent distribution; high performance liquid chromatography (HPLC), especially reverse-phase HPLC on octyl- or octadecylsilyl-silica bonded phase column packing.
  • HPLC high performance liquid chromatography
  • the above polymers can be attached to an oligonucleotide, such as an AC, under any suitable conditions.
  • Any means known in the art can be used, including via acylation, reductive alkylation, Michael addition, thiol alkylation or other chemoselective conjugation/ligation methods through a reactive group on the PEG moiety (e.g., an aldehyde, amino, ester, thiol, D-haloacetyl, maleimido or hydrazino group) to a reactive group on the AC (e.g., an aldehyde, amino, ester, thiol, D-haloacetyl, maleimido or hydrazino group).
  • a reactive group on the PEG moiety e.g., an aldehyde, amino, ester, thiol, D-haloacetyl, maleimido or hydrazino group
  • Activating groups which can be used to link the water soluble polymer to one or more proteins include without limitation sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane, 5-pyridyl, and alpha-halogenated acyl group (e.g., D-iodo acetic acid, D-bromoacetic acid, D-chloroacetic acid).
  • the polymer selected should have a single reactive aldehyde so that the degree of polymerization is controlled. See, for example, Kinstler et al., Adv. Drug. Delivery Rev.
  • Suitable amino acid residues of the CPP may be reacted with an organic derivatizing agent that is capable of reacting with a selected side chain or the N- or C-termini of an amino acids.
  • Reactive groups on the peptide or conjugate moiety include, e.g., an aldehyde, amino, ester, thiol, D-haloacetyl, maleimido or hydrazino group.
  • Derivatizing agents include, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride or other agents known in the art.
  • Methods of making AC and conjugating AC to linear CPP are generally described in US Pub. No. 2018/0298383, which is herein incorporated by reference for all purposes. The methods may be applied to the cyclic CPPs disclosed herein.
  • Synthetic schemes are provided in FIG. 3A-3D and FIG. 4.
  • Non-limiting examples of compounds that include a CPPs and a reactive group useful for conjugation to an AC are shown in Table 9.
  • Example linker groups are also shown.
  • Example reactive groups include tetrafluorophenyl ester (TFP), free carboxylic acid (COOH), and azide (N 3 ).
  • the EEVs have free carboxylic acid groups that may be utilized for conjugation to an AC.
  • the structure below is a 3’ cyclooctyne modified PMO used for a click reaction with a compound that includes an azide:
  • An example scheme of conjugation of a CPP and linker to the 3’ end of an AC via an amide bond is shown below.
  • Methods of synthesizing oligomeric antisense compounds are known in the art. The present disclosure is not limited by the method of synthesizing the AC.
  • provided herein are compounds having reactive phosphorus groups useful for forming internucleoside linkages including for example phosphodiester and phosphorothioate internucleoside linkages.
  • Methods of preparation and/or purification of precursors or antisense compounds are not a limitation of the compositions or methods provided herein. Methods for synthesis and purification of DNA, RNA, and the antisense compounds are well known to those skilled in the art.
  • Oligomerization of modified and unmodified nucleosides can be routinely performed according to literature procedures for DNA (Protocols for Oligonucleotides and Analogs, Ed. Agrawal (1993), Humana Press) and/or RNA (Scaringe, Methods (2001), 23, 206-217. Gait et al., Applications of Chemically synthesized RNA in RNA: Protein Interactions, Ed. Smith (1998), 1- 36. Gallo et al., Tetrahedron (2001), 57, 5707-5713).
  • Antisense compounds provided herein can be conveniently and routinely made through the well-known technique of solid phase synthesis.
  • oligonucleotide purification and analysis are known to those skilled in the art. Analysis methods include capillary electrophoresis (CE) and electrospray-mass spectroscopy. Such synthesis and analysis methods can be performed in multi-well plates. The method of the invention is not limited by the method of oligomer purification.
  • the AC is coupled to the CPP (e.g., cyclic peptide).
  • “coupled” can refer to a covalent or non-covalent association between the CPP to the AC, including fusion of the CPP to the AC and chemical conjugation of the CPP (e.g., cyclic peptide) to the AC.
  • a non-limiting example of a means to non-covalently attach the CPP to the AC is through the streptavidin/biotin interaction, e.g., by conjugating biotin to CPP and fusing AC to streptavidin.
  • the CPP is coupled to the AC via non-covalent association between biotin and streptavidin.
  • the CPP (e.g., cyclic peptide) is conjugated, directly or indirectly, to the AC to thereby form a CPP-AC conjugate. Conjugation of the AC to the CPP may occur at any appropriate site on these moieties.
  • the 5' or the 3' end of the AC may be conjugated to the C-terminus, the N-terminus, or a side chain of an amino acid in the CPP.
  • the AC is covalently linked to the CPP (e.g., cyclic peptide).
  • Covalent linkage refers to constructs where a CPP moiety is covalently linked to the 5' and/or 3' end of the AC moiety. Such conjugates may alternatively be described as having a CPP moiety (e.g., cyclic peptide moiety) and an oligonucleotide moiety.
  • a covalently-linked AC-CPP or CPP- AC conjugate in accordance with certain embodiments, includes the AC component and the CPP component associated with one another by a linker described herein.
  • the AC may be conjugated to the CPP (e.g. cyclic peptide) through a side chain of an amino acid on the CPP.
  • any amino acid side chain on the CPP which is capable of forming a covalent bond, or which may be so modified, can be used to link AC to the CPP.
  • the amino acid on the CPP can be a natural or non-natural amino acid.
  • the amino acid on the CPP used to conjugate the AC is aspartic acid, glutamic acid, glutamine, asparagine, lysine, ornithine, 2,3-diaminopropionic acid, or analogs thereof, wherein the side chain is substituted with a bond to the AC or linker.
  • the amino acid is lysine, or an analog thereof.
  • the amino acid is glutamic acid, or an analog thereof.
  • the amino acid is aspartic acid, or an analog thereof.
  • the CPP is cyclic.
  • the compounds of the disclosure include compounds wherein AC is conjugated to the side chain of an amino acid in the cyclic peptide.
  • the compounds disclosed herein have a structure (i.e., exocyclic) according to Formula I-A: CPP L AC ( I-A) , wherein the linker is covalently bound to the side chain of an amino acid on the CPP and to the 5' end of the AC, the backbone of the AC, or the 3' end of the AC.
  • compounds and methods are provided for treating a disease or disorder associated with one or more genes having an expanded nucleotide repeats (e.g., expanded trinucleotide repeats such as expanded trinucleotide repeats).
  • compounds and methods are provided for treating a disease or disorder associated with one or more genes having an expanded CTG ⁇ CUG trinucleotide repeat.
  • compounds and methods are provided for treating a disease or disorder associated with one or more genes having an expanded CTG ⁇ CUG trinucleotide repeat in the 3′-UTR of the gene.
  • compounds and methods are provided for treating a disease or disorder associated with a gene that has an expanded CTG ⁇ CUG in the 3’ UTR such as DMPK, ATXN8OS ATXN8, and/or JPH3.
  • compounds and methods are provided for treating a disease or disorder associated with one or more genes having an expanded CTG ⁇ CUG trinucleotide repeat in the intron of a gene.
  • compounds and methods are provided for treating a disease or disorder associated with an expanded CTG ⁇ CUG trinucleotide repeat in an intron of TCF4.
  • DM1 myotonic dystrophy type 1
  • Fuchs' Endothelial Corneal Dystrophy FECD
  • SCA8 Spinocerebellar Ataxia-8
  • HDL2 Huntington’s Disease-Like
  • DM1 Myotonic dystrophy type 1
  • compounds, compositions, and methods are provided to treat Myotonic dystrophy (DM1 or Steinert's disease).
  • DM1 is a multisystemic disorder often characterized by muscle degeneration and myotonia or delayed muscle relaxation due to repetitive action potentials in myofibers.
  • Myotonic dystrophy type 1 (DM1) is the most common form of muscular dystrophy, affecting about 1 in 8000 people.
  • DM1 is a paradigm for genetic disorders caused by CTG ⁇ CUG expansions.
  • DM1 is a neuromuscular disorder caused by a CTG ⁇ CUG repeat expansion in the 3′- untranslated region (UTR) of the dystrophia myotonia protein kinase (DMPK) gene.
  • UTR 3′- untranslated region
  • DMPK dystrophia myotonia protein kinase
  • the DMPK transcript e.g., the expanded CUG repeat
  • sequesters splicing regulator proteins for example, muscleblind-like (MBNL) protein, which results in incorrect splicing of a number of downstream pre-mRNAs (pre-mRNAs that do not contain an expanded CUG repeat) that are regulated by MBNL1.
  • MBNL muscleblind-like
  • This gain-of-function is the cause of DM1.
  • the excessive number of CUG repeats impart toxic activity, referred to as a toxic gain-of- function.
  • DM1 patients with CTG ⁇ CUG expansions within the 3′-untranslated region of DMPK gene are at increased risk for FECD and form CUGexp-MBNL1 foci in corneal endothelium. (Mootha et al., Investigative ophthalmology &visual science, 2017; 58, 4579-4585).
  • MBNL1 Association of MBNL1 with mutant RNA affects the cellular pool of free MBNL1 and triggers mis-splicing of some MBNL1 target genes (e.g., regulated by MBNL1) in affected brain, muscle, and heart tissues (Jiang et al. Hum Mol Genet. 2004; 13: 3079–3088). Gattey et al. (Cornea. 2014; 33: 96–98) reported FECD in four DM1 subjects including a mother–daughter pair. Thus, the association between DM1 and FECD is likely to be present (FECD is described in more detail elsewhere herein). [0482] Without being bound by theory, there are at least two hypotheses proposed to explain the pathogenesis of DM1.
  • DMPK haploinsufficiency is supported by studies demonstrating decreased expression of DMPK mRNA and protein in DM1 muscle (Fu, Y.H.et al. (1993) Decreased expression of myotonin-protein kinase messenger RNA and protein in adult form of myotonic dystrophy. Science 260, 235–238).
  • the compounds and methods described herein ameliorate DMPK haploinsufficiency.
  • Another RNA gain-of-function hypothesis proposes that the mutant RNA transcribed from the expanded allele is sufficient to induce symptoms of the disease.
  • the compounds and methods described herein reduce transcription of mutant RNA which are associated with the expanded allele.
  • the expanded CTG ⁇ CUG trinucleotide repeats in the 3′ untranslated region of DMPK mRNA form imperfect stable hairpin structures that accumulate in the cell nucleus in small ribonuclear complexes or microscopically visible inclusions, and impair the function of proteins implicated in transcription, splicing or RNA export.
  • DMPK genes with CUG repeats are transcribed into mRNA, the mutant transcripts are sequestered in the nucleus as aggregates (foci), which results in a decrease in cytoplasmic DMPK mRNA levels.
  • Foci cytoplasmic DMPK mRNA levels.
  • aggregations lead to the deregulation of the alternative splicing of many different transcripts due to sequestration of two RNA-binding proteins: MBNL1 (muscleblind-like 1) and CUGBP1 (CUG-binding protein 1), resulting in loss-of-function of MBNL1 and upregulation of CUGBP1 (Lee and Cooper. (2009) “Pathogenic mechanisms of myotonic dystrophy,” Biochem Soc Trans.37(06): 1281-1286).
  • DM1 the RNA-binding protein MBNL1
  • PKC Protein Kinase C
  • the downstream effects include disruption of alternative splicing, mRNA translation and mRNA decay of downstream genes.
  • An important molecular feature of DM1 is the misregulation of alternative splicing due to sequestration of MBNL1 to CUG repeats with double-stranded hairpin structure.
  • the abnormal splicing of the skeletal muscle-specific ClC-1 (chloride channel 1) is known to be one of the causes for myotonia. Increased inclusion of exons containing premature stop codons result in down-regulation of ClC- 1 mRNA and protein, which is sufficient to cause myotonia (Charlet-B et al. (2002) Loss of the muscle-specific chloride channel in type 1 myotonic dystrophy due to misregulated alternative splicing. Mol. Cell 10, 45–53; Mankodi, A.et al.
  • the compounds and methods described herein ameliorate the downstream effects, including disruption of alternative splicing, mRNA translation, and mRNA decay of downstream genes.
  • the compounds and methods described herein reduce the number of splicing events mis-regulated in DM1 compared to a subject with DM1 that is not treated with compounds or methods of the disclosure.
  • the compounds and methods described herein may reduce the number of mis-regulated splicing events in one or more downstream genes such as 4833439L19Rik, Abcc9, Atp2a1, Arhgef10, Arhgap28, Armcx6, Angel1, Best3, Bin1, Brd2, Cacna1s, Cacna2d1, Cpd, Cpeb3, Ccpg1, Clasp1, Clcn1, Clk4, Cpeb2, Camk2g, Capzb, Copz2, Coch, cTNT, Ctu2, Cyp2s1, Dctn4, Dnm1l, Eya4, Efna3, Efna2, Fbxo31, Fbxo21, Frem2, Fgd4, Fuca1, Fn1, Gogla4, Gpr37l1, Greb1, Heg1, Insr, Impdh2, IR, Itgav, Jag2, Klc1, Kcan6, Kif13a, Ldb3, Lrr
  • the compounds and methods described herein reduce the number of exons containing premature stop codons which result in down-regulation of ClC-1 mRNA compared to a subject with DM1 that is not treated with compounds or methods of the disclosure.
  • the levels of MBNL1 and CUGBP1 in the nucleus control a subset of developmentally regulated splicing events that are reversed in DM1. In the embryonic stage, MBNL1 nuclear levels are low and CUGBP1 levels are high.
  • MBNL1 nuclear levels increase while CUGBP1 levels decrease, inducing an embryonic-to-adult transition of downstream splice targets (including IR exon 11, ClC-1 exons containing stop codons and cTNT exon 5).
  • downstream splice targets including IR exon 11, ClC-1 exons containing stop codons and cTNT exon 5.
  • MBNL1 is sequestered to CUG repeats, resulting in a decrease of functional MBNL1, while CUGBP1 levels are increased due to phosphorylation and stabilization. This simulates the embryonic condition and enhances expression of embryonic isoforms in adults, resulting in multiple disease symptoms (Lee and Cooper.; 2009).
  • the compounds and methods described herein reduce amount of MBNL1 sequestered, increase the amount of functional MBNL1, decrease CUGBP1 levels compared to a subject with DM1 that is not treated with compounds or methods of the disclosure.
  • MBNL1 and CELF1 also referred to as “CUGBP1” are developmental regulators of splicing events during fetal to adult transition and modification of their activities in DM1 leads to expression of a fetal splicing pattern in adult tissues.
  • the downstream impact of low MBNL1 and high CELF1 includes disruption of alternative splicing, mRNA translation and mRNA decay in proteins such as cardiac troponin T (cTNT), insulin receptor (INSR), muscle-specific chloride ion channel (CLCN1) and sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) transcripts, in addition to MBNL1.
  • cTNT cardiac troponin T
  • INSR insulin receptor
  • CLCN1 muscle-specific chloride ion channel
  • ATP2A1 sarcoplasmic/endoplasmic reticulum calcium ATPase 1
  • the present disclosure teaches use of diverse cell penetrating peptide (CPP) to deliver the AC (e.g., PMO or ASO) and a degradation sequence described herein e.g., in Tables 2 and 10, to the cytosol of the cell.
  • CPP cell penetrating peptide
  • the CPP or EEV conjugated with the AC delivers the AC of interest to the cellular location where the target sequence on pre-mRNA is located.
  • the disease is a form of myotonic dystrophy (e.g., myotonic dystrophy type 1 or myotonic dystrophy type 2).
  • the target gene is the DMPK gene, which encodes myotonic-protein kinase.
  • the compounds provided herein comprise an AC (e.g., ASO) that targets DMPK (e.g., the 3′-untranslated region/polyadenylation of DMPK gene) to degrade DMPK gene.
  • AC e.g., ASO
  • DMPK e.g., the 3′-untranslated region/polyadenylation of DMPK gene
  • exemplary oligonucleotides that target DMPK for degradation are provided in Table 10.
  • the degradation sequence may be used in combination with an AC sequence comprising from 10-40 CAG repeats, including but not limited to the AC provided in Table 2. Table 10.
  • SCA8 Spinocerebellar Ataxia-8
  • compounds, compositions, and methods are provided to treat Spinocerebellar Ataxia-8 (SCA8).
  • SCA8 is an inherited neurodegenerative condition that is characterized by slowly progressing ataxia. Symptoms normally emerge during the third to fifth decades of life. Symptoms include eye movement abnormalities, sensory neuropathy, dysphagia, cerebellar ataxia, and cognitive impairment. [0491] SCA8 is associated with heterozygous abnormal expanded CTG ⁇ CUG repeat in the 3’ UTR of two overlapping genes ATXN8OS and ATXN8. Healthy individuals generally have between 15 and 50 CTG ⁇ CUG repeats in the ATXN8OS and ATXN8 genes. Patients with SCA8 have greater than 50 CTG ⁇ CUG repeats, sometimes as many as 240 CTG ⁇ CUG repeats in the ATXN8OS and ATXN8 genes.
  • HDL2 Huntington’s disease like-2
  • HDL2 is an autosomal dominant neurodegenerative disorder that is phenotypically related to Huntington’s disease.
  • HDL2 is characterized by symptoms that include chorea, dystonia, rigidity, bradykinesia, and psychiatric symptoms such as dementia. Symptoms of HDL2 typically occur in mid-life and may lead to a premature death by about 10-15 years.
  • HDL2 is associated with an expanded CTG ⁇ CUG in the 3’ UTR of the junctophilin 3 (JPH3) gene (16q24.3).
  • Fuchs' Endothelial Corneal Dystrophy [0494] In embodiments, compounds, compositions, and methods are provided to treat Fuchs' Endothelial Corneal Dystrophy (FECD).
  • FECD (MIM 136800) is an age-related degenerative disorder of the corneal endothelium. FECD is characterized by progressive loss of corneal endothelial cells, thickening of Descement’s membrane, and deposition of extracellular matrix in the form of guttae.
  • FECD can be inherited as an autosomal dominant trait with genetic heterogeneity. Rare heterozygous mutations in collagen, type VIII, alpha 2 gene (COL8A2, MIM 120252) can give rise to an early-onset corneal endothelial dystrophy.
  • genes such as solute carrier family 4, sodium borate transporter, member 11 (SLC4A11, MIM 610206), transcription factor 8 (TCF8, MIM 189909), lipoxygenase homology domains 1 (LOXHD1, MIM 613267), and ATP/GTP binding protein-like 1 (AGBL1, MIM 615523) are collectively associated with a small fraction of adult-onset FECD cases.
  • TCF4 transcription factor 4
  • KN motif– and ankyrin repeat domain–containing protein 4 KN motif– and ankyrin repeat domain–containing protein 4
  • LAMC1, MIM150290 laminin gamma-1
  • ATP1B1, MIM 182330 beta-1 polypeptide
  • Expanded trinucleotide repeats at the CTG18.1 locus in intron 2 of TCF4 are associated with FECD (Wieben et al., PLoS One. 2012; 7(11):e49083).
  • Each copy of the expanded CTG18.1 allele of more than 40 CTG ⁇ CUG trinucleotide repeats leads to significant risk for development of FECD (Mootha et al., Invest Ophthalmol Vis Sci.2014; 55: 33–42).
  • RNA nuclear foci a hallmark of toxic gain of function RNA, has been reported in neurodegenerative disorders caused by simple repeat expansions.
  • Expanded CUG repeat RNA accumulate as nuclear foci in the corneal endothelium of FECD subjects with the CTG18.1 triplet repeat expansion while absent in control samples lacking the triplet expansion (Mootha et al., Invest Ophthalmol Vis Sci.2015;56(3):2003- 2011). Expanded CUG repeat RNA colocalize with mRNA-splicing factor, muscleblind-like 1 (MBNL1), in nuclear foci in endothelium as a molecular hallmark.
  • the triplet repeat expansion at the CTG18.1 locus may mediate endothelial dysfunction via aberrant gene splicing as a result of the mutant CUG RNA transcripts sequestering the MBNL1 (Du et al., J Biol Chem.
  • phosphorodiamidate morpholino oligomers PMOs
  • PPMOs peptide-conjugated PMOs
  • CUG repeats CUG repeats
  • the present disclosure teaches use of diverse cell penetrating peptide (CPP) or endosomal escape vehicle (EEV) to deliver the AC (e.g. PMO or ASO) described herein, e.g., in Table 6 to the cytosol of the cell.
  • CPP cell penetrating peptide
  • EEV endosomal escape vehicle
  • the CPP or EEV conjugated to the AC delivers the AC of interest to the cellular location where the target sequence on pre-mRNA is located.
  • the disease is Fuchs' Endothelial Corneal Dystrophy (FECD).
  • the target gene is TCF4, which encodes transcription factor 4 (TCF-4), which is also known as immunoglobulin transcription factor 2 (ITF-2).
  • TCF-4 transcription factor 4
  • IGF-2 immunoglobulin transcription factor 2
  • the compounds provided herein comprise an antisense oligonucleotide that targets TCF4. Exemplary oligonucleotides that may be used to target TCF4 are provided in Table 2 and Table 11. Table 11.
  • Exemplary Oligonucleotides targeting the expanded triplet repeat of TCF4 PMO Phosphorodiamidate Morpholino Oligomer [0500] Mootha et al. (2017) reported that DM1 and FECD originate from noncoding CTG expansions even though both are not identical diseases.
  • the DMPK expansion in DM1 results in a multiorgan disease that involves various tissues in the eye including lens, retina, and corneal endothelium.
  • the TCF4 repeat expansion appears to affect the corneal endothelium without any clinically apparent sequela to other ocular tissues or bodily organs.
  • Mutant expansions in DMPK and TCF4 share important similarities, such as (i) nuclear foci that contain expanded CUG repeats, (ii) association of foci with MBNL1 protein, and (iii) an ability to cause FECD. It is suggested that the triplet expansions in both DMPK and TCF4 may cause the same corneal endothelial tissue phenotype of FECD through shared molecular mechanisms. [0501] See U.S. Patent No. 10760076B2, International Application Publication No. WO2018165541A1, U.S. Pat. Appl. Publ. No. 2016/0355796 and U.S. Pat. Appl. Publ. No.
  • compositions and Methods of Administration The compounds of the present disclosure may be formulated into compositions suitable for in vivo applications.
  • the compounds and/or compositions may be administered to a patient that has, or is suspected of having, a disease associated with an expanded trinucleotide repeat.
  • In vivo application of the disclosed compounds, and compositions containing them, can be accomplished by any suitable method and technique presently or prospectively known to those skilled in the art.
  • the disclosed compounds can be formulated in a physiologically- or pharmaceutically-acceptable composition and administered by any suitable route known in the art including, for example, oral and parenteral routes of administration.
  • parenteral includes subcutaneous, intradermal, intravenous, intramuscular, intraperitoneal, intrasternal, and intrathecal administration, such as by injection.
  • Administration of the disclosed compounds or compositions can be a single administration, or at continuous or distinct intervals as can be readily determined by a person skilled in the art.
  • the compounds disclosed herein, and compositions comprising them can also be administered utilizing liposome technology, slow-release capsules, implantable pumps, and biodegradable containers.
  • the compounds disclosed herein can be formulated into pharmaceutical compositions according to known methods for preparing pharmaceutically acceptable compositions. Formulations are described in detail in a number of sources which are well known and readily available to those skilled in the art. For example, Remington’s Pharmaceutical Science by E.W. Martin (1995) describes formulations that can be used in connection with the disclosed methods. In general, the compounds disclosed herein can be formulated such that an effective amount of the compound is combined with a suitable carrier in order to facilitate effective administration of the compound. The compositions used can also be in a variety of forms.
  • compositions also include conventional pharmaceutically acceptable carriers and diluents which are known to those skilled in the art.
  • carriers or diluents for use with the compounds include ethanol, dimethyl sulfoxide, glycerol, alumina, starch, saline, and equivalent carriers and diluents.
  • compositions disclosed herein can advantageously comprise between about 0.1% and 100% by weight of the total of one or more of the subject compounds based on the weight of the total composition including carrier or diluent.
  • Formulations suitable for administration include, for example, aqueous sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient; and aqueous and nonaqueous sterile suspensions, which can include suspending agents and thickening agents.
  • compositions disclosed herein can include other agents conventional in the art having regard to the type of formulation in question.
  • Compounds disclosed herein, and compositions comprising them can be delivered to a cell either through direct contact with the cell or via a carrier means.
  • Carrier means for delivering compounds and compositions to cells are known in the art and include, for example, encapsulating the composition in a liposome moiety.
  • Another means for delivery of compounds and compositions disclosed herein to a cell comprises attaching the compounds to a protein or nucleic acid that is targeted for delivery to the target cell.
  • U.S. Patent No.6,960,648 and U.S. Application Publication Nos. 20030032594 and 20020120100 disclose amino acid sequences that can be coupled to another composition and that allows the composition to be translocated across biological membranes.
  • U.S. Application Publication No. 20020035243 also describes compositions for transporting biological moieties across cell membranes for intracellular delivery.
  • Compounds can also be incorporated into polymers, examples of which include poly (D-L lactide- co-glycolide) polymer for intracranial tumors; poly[bis(p-carboxyphenoxy) propane:sebacic acid] in a 20:80 molar ratio (as used in GLIADEL); chondroitin; chitin; and chitosan.
  • poly (D-L lactide- co-glycolide) polymer for intracranial tumors poly[bis(p-carboxyphenoxy) propane:sebacic acid] in a 20:80 molar ratio (as used in GLIADEL); chondroitin; chitin; and chitosan.
  • Compounds and compositions disclosed herein, including pharmaceutically acceptable salts or prodrugs thereof can be administered intravenously, intramuscularly, or intraperitoneally by infusion or injection. Solutions of the active agent or its salts can be prepared in water, optionally mixed with a nontoxic surfactant.
  • Dispersions can also be prepared in glycerol, liquid polyethylene glycols, triacetin, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations can contain a preservative to prevent the growth of microorganisms.
  • the pharmaceutical dosage forms suitable for injection or infusion can include sterile aqueous solutions or dispersions or sterile powders comprising the active ingredient, which are adapted for the extemporaneous preparation of sterile injectable or infusible solutions or dispersions, optionally encapsulated in liposomes.
  • the ultimate dosage form should be sterile, fluid and stable under the conditions of manufacture and storage.
  • the liquid carrier or vehicle can be a solvent or liquid dispersion medium comprising, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like), vegetable oils, nontoxic glyceryl esters, and suitable mixtures thereof.
  • a polyol for example, glycerol, propylene glycol, liquid polyethylene glycols, and the like
  • vegetable oils nontoxic glyceryl esters, and suitable mixtures thereof.
  • suitable mixtures thereof can be maintained, for example, by the formation of liposomes, by the maintenance of the required particle size in the case of dispersions or by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various other antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • isotonic agents may be included, for example, sugars, buffers or sodium chloride. Prolonged absorption of the injectable compositions can be brought about by the inclusion of agents that delay absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating a compound and/or agent disclosed herein in the required amount in the appropriate solvent with various other ingredients enumerated above, as required, followed by filter sterilization.
  • methods of preparation include vacuum drying and the freeze-drying techniques, which yield a powder of the active ingredient plus any additional desired ingredient present in the previously sterile-filtered solutions.
  • Useful dosages of the compounds and agents and pharmaceutical compositions disclosed herein can be determined by comparing their in vitro activity, and in vivo activity in animal models. Methods for the extrapolation of effective dosages in mice, and other animals, to humans are known to the art.
  • the dosage ranges for the administration of the compositions are those large enough to produce the desired effect in which the symptoms or disorder are affected. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. Generally, the dosage will vary with the age, condition, sex and extent of the disease in the patient and can be determined by one of skill in the art. The dosage can be adjusted by the individual physician in the event of any counterindications.
  • Dosage can vary, and can be administered in one or more dose administrations daily, for one or several days.
  • pharmaceutical compositions that comprise a compound disclosed herein in combination with a pharmaceutically acceptable carrier.
  • Pharmaceutical compositions adapted for oral, topical or parenteral administration, comprising an amount of a compound are disclosed herein.
  • the dose administered to a patient, particularly a human should be sufficient to achieve a therapeutic response in the patient over a reasonable time frame, without lethal toxicity, and causing no more than an acceptable level of side effects or morbidity.
  • kits that comprise a compound disclosed herein and/or pharmaceutical compositions containing the same, in one or more containers.
  • the disclosed kits can optionally include pharmaceutically acceptable carriers and/or diluents.
  • a kit includes one or more other components, adjuncts, or adjuvants as described herein.
  • a kit includes instructions or packaging materials that describe how to administer a compound or composition of the kit.
  • Containers of the kit can be of any suitable material, e.g., glass, plastic, metal, etc., and of any suitable size, shape, or configuration.
  • a compound and/or agent disclosed herein is provided in the kit as a solid, such as a tablet, pill, or powder form.
  • a compound and/or agent disclosed herein is provided in the kit as a liquid or solution.
  • the kit comprises an ampoule or syringe containing a compound and/or agent disclosed herein in liquid or solution form.
  • the compound and or composition of the of the disclosure is administered to a patient diagnosed with a disease associated with a nucleotide repeat expansion at a dose of between about 0.1 mg/kg and about 1000 mg/kg, for example, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about 5 mg/kg, about 6 mg/kg, about 7 mg/kg, about 8 mg/kg, about 9 mg/kg, about 10 mg/kg, about 11 mg/kg, about 12 mg/kg, about 13 mg/kg, about 14 mg/kg, about 15 mg/kg, about 16 mg/kg, about 17 mg/kg, about 18 mg/kg, about 19 mg/kg, about 20 mg/kg, about 21 mg/kg, about 22 mg/kg, about 0.5 mg/
  • the present disclosure provides a method of treating disease in a subject in need thereof, comprising administering a compound and/or composition containing the compound disclosed herein.
  • the disease is any of the diseases provided in the present disclosure.
  • the target gene or gene transcript is any of the target genes or gene transcripts provided in the present disclosure.
  • the patient is identified as having, or at risk of having, any disease as described herein.
  • a method is provided for treating a disease associated with a CTG ⁇ CUG repeat in a 3’ untranslated region of a gene/transcript.
  • a method is provided for treating myotonic dystrophy.
  • a method is provided for treating myotonic dystrophy type 1 (DM1). In embodiments, a method is provided for treating SCA8. In embodiments, a method is provided for treating HDL2. In embodiments, a method is provided for treating FECD. [0518] In embodiments, treatment refers to partial or complete alleviation, amelioration, relief, inhibition, delaying onset, reducing severity and/or incidence of one or more symptoms in a subject. [0519] Treatment of the disease and/or symptoms of the disease may occur through a variety of molecular mechanisms such as those described herein.
  • the treatment results in the lowered expression of a target protein from a target transcript.
  • treatment results in the lowered levels of a target transcript.
  • treatment results in the modulation of splicing of downstream gene transcripts that are regulated by the target transcript and/or proteins that bind to the target transcript.
  • modulation of splicing of downstream gene transcripts results in an increase in downstream transcripts and/or downstream proteins isoforms that are associated with healthy phenotypes.
  • the alternative splicing results in a decrease in downstream transcripts and/or downstream proteins isoforms that are associated with disease phenotypes.
  • a method is provided for treating DM1 by reducing sequestration of at least one RNA-binding protein to a pre-mRNA comprising at least one expanded CUG repeat.
  • a method is provided for treating DM1 by reducing accumulation of a pre-mRNA comprising at least one expanded CUG repeat.
  • a method is provided for treating DM1 by correcting splicing defects of downstream gene transcripts.
  • treatment according to the present disclosure results in a decreased level of the target transcript and/or expression of the target transcript (e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8) genes by more than about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • the target transcript e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8
  • treatment according to the present disclosure results in a decreased level of the target transcript (e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8) and/or expression of the target transcript by about 5% to about 100%, about 10% to about 100%, about 20% to about 100%, about 50% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, about 95% to about 100%, about 40% to about 95%, about 50% to about 95%, about 70% to about 95%, or about 90% to about 95% as compared to the average level of the transcript and/or protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • the target transcript e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8
  • treatment according to the present disclosure results in a decreased number of CUG repeat RNA nuclear foci of a target gene (e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8) by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level foci in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • a target gene e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8
  • treatment according to the present disclosure results in a decreased number of CUG repeat RNA nuclear foci of a target gene (e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8) by about 5% to about 100%, about 10% to about 100%, about 20% to about 100%, about 50% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, about 95% to about 100%, about 40% to about 95%, about 50% to about 95%, about 70% to about 95%, or about 90% to about 95% as compared to the average level of foci in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • a target gene e.g., DMPK, TCF4, JPH3, ATXN8OS and/or ATXN8
  • treatment according to the present disclosure results in a decreased level of downstream transcript and/or expression of a downstream gene product that is associated with a disease phenotype by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in a decreased level of downstream transcript and/or expression of a downstream gene product that is associated with a disease phenotype by about 5% to about 100%, about 10% to about 100%, about 20% to about 100%, about 50% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, about 95% to about 100%, about 40% to about 95%, about 50% to about 95%, about 70% to about 95%, or about 90% to about 95% as compared to the average level of the protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in an increased level of downstream transcript and/or expression of a downstream gene product that is associated with a healthy phenotype by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in an increased level of downstream transcript and/or expression of a downstream gene product that is associated with a healthy phenotype by about 5% to about 100%, about 10% to about 100%, about 20% to about 100%, about 50% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, about 95% to about 100%, about 40% to about 95%, about 50% to about 95%, about 70% to about 95%, or about 90% to about 95% as compared to the average level of the protein in the subject before the treatment or of one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in decreased expression of a protein isoform associated with a disease phenotype in a subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, triceps, tibialis anterior, gastrocnemius, or heart by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the protein in the subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, triceps, tibialis anterior, gastrocnemius, or heart before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP
  • treatment according to the present disclosure results in decreased expression of a protein isoform associated with a disease phenotype in a subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, triceps, tibialis anterior, gastrocnemius, or heart by more than about by about 5% to about 100%, about 10% to about 100%, about 20% to about 100%, about 50% to about 100%, about 70% to about 100%, about 80% to about 100%, about 90% to about 100%, about 95% to about 100%, about 40% to about 95%, about 50% to about 95%, about 70% to about 95%, or about 90% to about 95% as compared to the average level of the protein in the subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, triceps, tibialis anterior, gastrocnemius, or heart before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein
  • treatment according to the present disclosure results in increased expression of an alternately spliced downstream protein in a subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, or heart by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, about 150%, about 200%, about 250%, about 300%, about 350%, about 400%, about 450%, about 500%, about 550%, about 600%, about 650%, about 700%, about 750%, about 800, about 850%, about 900%, about 950%, or about 1000% or more, as compared to the average level of the downstream protein in the subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, or heart before the treatment, compared
  • treatment according to the present disclosure results in increased or decreased expression of a wild type protein isomer in a subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, or heart by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the wild type protein isomer in the subject’s corneal tissue, muscle tissue, diaphragm tissue, quadriceps, or heart before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in decreased expression of a protein in a subject’s tissue of interest by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the protein in the subject’s tissue of interest before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in increased expression of an alternately spliced downstream protein in a subject’s tissue of interest by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 100%, about 150%, about 200%, about 250%, about 300%, about 350%, about 400%, about 450%, about 500%, about 550%, about 600%, about 650%, about 700%, about 750%, about 800, about 850%, about 900%, about 950%, or about 1000% or more, as compared to the average level of the downstream protein in the subject’s tissue of interest before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • treatment according to the present disclosure results in increased or decreased expression of a wild type downstream protein isomer in a subject’s tissue of interest by more than about 5%, e.g., about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, and about 100%, as compared to the average level of the downsteam protein in the subject’s tissue of interest before the treatment, compared to one or more control individuals with similar disease without treatment, or compared to treatment with an AC not conjugated to a cyclic CPP disclosed herein.
  • the subject’s tissue of interest is corneal tissue or muscle tissue.
  • tissue of interest is corneal tissue or muscle tissue.
  • a suitable control is a baseline measurement, such as a measurement in the same individual prior to initiation of the treatment described herein, or a measurement in a control individual (or multiple control individuals) in the absence of the treatment described herein.
  • a “control individual” is an individual afflicted with the same disease, who is about the same age and/or gender as the individual being treated (to ensure that the stages of the disease in the treated individual and the control individual(s) are comparable).
  • the individual (also referred to as “patient” or “subject”) being treated is an individual (fetus, infant, child, adolescent, or adult human) having a disease or having the potential to develop a disease.
  • the individual may have a disease mediated by aberrant gene expression or aberrant gene splicing.
  • the individual having the disease may have downstream protein expression or activity levels that are less than about 1-99% of normal wild type protein expression or activity levels in an individual not afflicted with the disease.
  • the range includes, but is not limited to less than about 80-99%, less than about 65-80%, less than about 50-65%, less than about 30-50%, less than about 25-30%, less than about 20-25%, less than about 15-20%, less than about 10-15%, less than about 5-10%, less than about 1-5% of normal wild type protein expression or activity levels.
  • the individual may have downstream protein expression or activity levels that are 1-500% higher than normal wild type target protein expression or activity levels in an individual not afflicted with the disease.
  • the range includes, but is not limited to, greater than about 1-10%, about 10-50%, about 50-100%, about 100-200%, about 200-300%, about 300-400%, about 400-500%, or about 500-1000% of normal wild type target protein expression or activity levels.
  • the individual is an individual who has been recently diagnosed with the disease. Typically, early treatment (treatment commencing as soon as possible after diagnosis) is important to minimize the effects of the disease and to maximize the benefits of treatment.
  • a composition includes mixtures of two or more such compositions
  • an agent includes mixtures of two or more such agents
  • the component includes mixtures of two or more such components, and the like.
  • the term “about” when immediately preceding a numerical value means a range (e.g., plus or minus 20%, 10%, or 5% of that value). For example, “about 50” can mean 45 to 55, “about 25,000” can mean 22,500 to 27,500, etc., unless the context of the disclosure indicates otherwise, or is inconsistent with such an interpretation.
  • “about 50” means a range extending to less than half the interval(s) between the preceding and subsequent values, e.g., more than 49.5 to less than 52.5.
  • the phrases “less than about” a value or “greater than about” a value should be understood in view of the definition of the term “about” provided herein.
  • the term “about” when preceding a series of numerical values or a range of values refers, respectively to all values in the series, or the endpoints of the range.
  • cell penetrating peptide refers to a peptide that facilitates delivery of a cargo, e.g., a therapeutic moiety (TM) into a cell.
  • the CPP is cyclic, and is represented as “cCPP”.
  • the cCPP is capable of directing a therapeutic moiety to penetrate the membrane of a cell.
  • the cCPP delivers the therapeutic moiety to the cytosol of the cell.
  • the cCPP delivers an antisense compound (AC) to a cellular location where a pre-mRNA is located.
  • AC antisense compound
  • EEV endosomal escape vehicle
  • a chemical linkage i.e., a covalent bond or non-covalent interaction
  • EP exocyclic peptide
  • the EEV can be an EEV of Formula (B).
  • EEV-conjugate refers to an endosomal escape vehicle defined herein conjugated by a chemical linkage (i.e., a covalent bond or non-covalent interaction) to a cargo.
  • the cargo can be a therapeutic moiety (e.g., an oligonucleotide, peptide, or small molecule) that can be delivered into a cell by the EEV.
  • the EEV-conjugate can be an EEV-conjugate of Formula (C).
  • E exocyclic peptide
  • MP modulatory peptide
  • the EP when conjugated to a cyclic peptide disclosed herein, may alter the tissue distribution and/or retention of the compound.
  • the EP comprises at least one positively charged amino acid residue, e.g., at least one lysine residue and/or at least one arginine residue.
  • Non-limiting examples of EP are described herein.
  • the EP can be a peptide that has been identified in the art as a “nuclear localization sequence” (NLS).
  • Non-limiting examples of nuclear localization sequences include the nuclear localization sequence of the SV40 virus large T-antigen, the minimal functional unit of which is the seven amino acid sequence PKKKRKV (SEQ ID NO:42), the nucleoplasmin bipartite NLS with the sequence NLSKRPAAIKKAGQAKKKK(SEQ ID NO:52), the c-myc nuclear localization sequence having the amino acid sequence PAAKRVKLD (SEQ ID NO:53) or RQRRNELKRSF(SEQ ID NO:54), the sequence RMRKFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO:50) of the IBB domain from importin-alpha, the sequences VSRKRPRP (SEQ ID NO:57) and PPKKARED (SEQ ID NO:58)of the myoma T protein, the sequence PQPKKKPL (SEQ ID NO:59) of human p53, the sequence SALIKKKKKMAP (SEQ ID NO:60
  • linker refers to a moiety that covalently bonds one or more moieties (e.g., an exocyclic peptide (EP) and a cargo, e.g., an oligonucleotide, peptide or small molecule) to the cyclic cell penetrating peptide (cCPP).
  • the linker can comprise a natural or non- natural amino acid or polypeptide.
  • the linker can be a synthetic compound containing two or more appropriate functional groups suitable to bind the cCPP to a cargo moiety, to thereby form the compounds disclosed herein.
  • the linker can comprise a polyethylene glycol (PEG) moiety.
  • the linker can comprise one or more amino acids.
  • the cCPP may be covalently bound to a cargo via a linker.
  • the terms “peptide,” “protein,” and “polypeptide” are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another. Two or more amino acid residues can be linked by the carboxyl group of one amino acid to the alpha amino group. Two or more amino acids of the polypeptide can be joined by a peptide bond.
  • the polypeptide can include a peptide backbone modification in which two or more amino acids are covalently attached by a bond other than a peptide bond.
  • the polypeptide can include one or more non-natural amino acids, amino acid analogs, or other synthetic molecules that are capable of integrating into a polypeptide.
  • the term polypeptide includes naturally occurring and artificially occurring amino acids.
  • the term polypeptide includes peptides, for example, that include from about 2 to about 100 amino acid residues as well as proteins, that include more than about 100 amino acid residues, or more than about 1000 amino acid residues, including, but not limited to therapeutic proteins such as antibodies, enzymes, receptors, soluble proteins, and the like.
  • the term “contiguous” refers to two amino acids, which are connected by a covalent bond.
  • cCPP representative cyclic cell penetrating peptide
  • a residue of a chemical species refers to a derivative of the chemical species that is present in a particular product. To form the product, at least one atom of the species is replaced by a bond to another moiety, such that the product contains a derivative, or residue, of the chemical species.
  • the cyclic cell penetrating peptides (cCPP) described herein have amino acids (e.g., arginine) incorporated therein through formation of one or more peptide bonds.
  • the amino acids incorporated into the cCPP may be referred to residues, or simply as an amino acid.
  • arginine or an arginine residue refers to .
  • the term “protonated form thereof” refers to a protonated form of an amino acid or side chain.
  • the guanidine group on the side chain of arginine may be protonated to form a guanidinium group.
  • chirality refers to a molecule that has more than one stereoisomer that differs in the three-dimensional spatial arrangement of atoms, in which one stereoisomer is a non-superimposable mirror image of the other.
  • Amino acids, except for glycine, have a chiral carbon atom adjacent to the carboxyl group.
  • enantiomer refers to stereoisomers that are chiral.
  • the chiral molecule can be an amino acid residue having a “D” and “L” enantiomer.
  • achiral Molecules without a chiral center, such as glycine, can be referred to as “achiral.”
  • hydrophobic refers to a moiety that is not soluble in water or has minimal solubility in water. Generally, neutral moieties and/or non-polar moieties, or moieties that are predominately neutral and/or non-polar are hydrophobic. Hydrophobicity can be measured by one of the methods disclosed herein.
  • aromatic refers to an unsaturated cyclic molecule having 4n + 2 ⁇ electrons, wherein n is any integer. “Heteroaromatic,” defined below, is a subset of aromatic.
  • aromatic amino acids include phenylalanine and napthylalinine.
  • non- aromatic refers to any molecule that does not fall within the definition of aromatic.
  • any linear, branched or cyclic molecule which does not fall within the definition of aromatic is non-aromatic.
  • non-aromatic amino acids include, but are not limited to, glycine and citrulline.
  • Alkyl alkyl chain or “alkyl group” refer to a fully saturated, straight or branched hydrocarbon chain radical having from one to forty carbon atoms, and which is attached to the rest of the molecule by a single bond. Alkyls comprising any number of carbon atoms from 1 to 40 are included.
  • An alkyl comprising up to 40 carbon atoms is a C 1 -C 40 alkyl
  • an alkyl comprising up to 10 carbon atoms is a C 1 -C 10 alkyl
  • an alkyl comprising up to 6 carbon atoms is a C 1 -C 6 alkyl
  • an alkyl comprising up to 5 carbon atoms is a C 1 -C 5 alkyl.
  • a C 1 -C 5 alkyl includes C 5 alkyls, C 4 alkyls, C 3 alkyls, C 2 alkyls and C 1 alkyl (i.e., methyl).
  • a C 1 -C 6 alkyl includes all moieties described above for C 1 -C 5 alkyls but also includes C 6 alkyls.
  • a C 1 -C 10 alkyl includes all moieties described above for C 1 -C 5 alkyls and C 1 -C 6 alkyls, but also includes C 7 , C 8 , C 9 and C 10 alkyls.
  • a C 1 -C 12 alkyl includes all the foregoing moieties, but also includes C 11 and C 12 alkyls.
  • Non-limiting examples of C 1 -C 12 alkyl include methyl, ethyl, n-propyl, i-propyl, sec-propyl, n-butyl, i-butyl, sec-butyl, t-butyl, n-pentyl, t-amyl, n-hexyl, n-heptyl, n-octyl, n-nonyl, n-decyl, n-undecyl, and n- dodecyl.
  • an alkyl group can be optionally substituted.
  • Alkylene refers to a fully saturated, straight or branched divalent hydrocarbon chain radical, having from one to forty carbon atoms.
  • C 2 -C 40 alkylene include ethylene, propylene, n-butylene, ethenylene, propenylene, n-butenylene, propynylene, n-butynylene, and the like. Unless stated otherwise specifically in the specification, an alkylene chain can be optionally substituted.
  • alkenyl refers to a straight or branched hydrocarbon chain radical having from two to forty carbon atoms and having one or more carbon-carbon double bonds. Each alkenyl group is attached to the rest of the molecule by a single bond. Alkenyl groups comprising any number of carbon atoms from 2 to 40 are included.
  • An alkenyl group comprising up to 40 carbon atoms is a C 2 -C 40 alkenyl
  • an alkenyl comprising up to 10 carbon atoms is a C 2 - C 10 alkenyl
  • an alkenyl group comprising up to 6 carbon atoms is a C 2 -C 6 alkenyl
  • an alkenyl comprising up to 5 carbon atoms is a C 2 -C 5 alkenyl.
  • a C 2 -C 5 alkenyl includes C 5 alkenyls, C 4 alkenyls, C 3 alkenyls, and C 2 alkenyls.
  • a C 2 -C 6 alkenyl includes all moieties described above for C 2 -C 5 alkenyls but also includes C 6 alkenyls.
  • a C 2 -C 10 alkenyl includes all moieties described above for C 2 -C 5 alkenyls and C 2 -C 6 alkenyls, but also includes C 7 , C 8 , C 9 and C 10 alkenyls.
  • a C 2 -C 12 alkenyl includes all the foregoing moieties, but also includes C 11 and C 12 alkenyls.
  • Non-limiting examples of C 2 -C 12 alkenyl include ethenyl (vinyl), 1-propenyl, 2-propenyl (allyl), iso-propenyl, 2-methyl-1-propenyl, 1-butenyl, 2-butenyl, 3-butenyl, 1-pentenyl, 2- pentenyl, 3-pentenyl, 4-pentenyl, 1-hexenyl, 2-hexenyl, 3-hexenyl, 4-hexenyl, 5-hexenyl, 1- heptenyl, 2-heptenyl, 3-heptenyl, 4-heptenyl, 5-heptenyl, 6-heptenyl, 1-octenyl, 2-octenyl, 3- octenyl, 4-octenyl, 5-octenyl, 6-octenyl, 7-octenyl, 1-nonenyl, 2-nonenyl, 3-nonenyl, 4-non
  • alkyl group can be optionally substituted.
  • alkenylene alkenylene chain or alkenylene group refers to a straight or branched divalent hydrocarbon chain radical, having from two to forty carbon atoms, and having one or more carbon-carbon double bonds.
  • Non-limiting examples of C 2 -C 40 alkenylene include ethene, propene, butene, and the like.
  • an alkenylene chain can be optionally.
  • Alkoxy or “alkoxy group” refers to the group -OR, where R is alkyl, alkenyl, alkynyl, cycloalkyl, or heterocyclyl as defined herein. Unless stated otherwise specifically in the specification, an alkoxy group can be optionally substituted.
  • Acyl or “acyl group” refers to groups -C(O)R, where R is hydrogen, alkyl, alkenyl, alkynyl, carbocyclyl, or heterocyclyl, as defined herein. Unless stated otherwise specifically in the specification, acyl can be optionally substituted.
  • Alkylcarbamoyl or “alkylcarbamoyl group” refers to the group -O-C(O)-NR a R b , where R a and R b are the same or different and are independently an alkyl, alkenyl, alkynyl, aryl, heteroaryl, as defined herein, or R a R b can be taken together to form a cycloalkyl group or heterocyclyl group, as defined herein. Unless stated otherwise specifically in the specification, an alkylcarbamoyl group can be optionally substituted.
  • Alkylcarboxamidyl or “alkylcarboxamidyl group” refers to the group –C(O)-NR a R b , where R a and R b are the same or different and are independently an alkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, cycloalkenyl, cycloalkynyl, or heterocyclyl group, as defined herein, or R a R b can be taken together to form a cycloalkyl group, as defined herein. Unless stated otherwise specifically in the specification, an alkylcarboxamidyl group can be optionally substituted.
  • Aryl refers to a hydrocarbon ring system radical comprising hydrogen, 6 to 18 carbon atoms and at least one aromatic ring.
  • the aryl radical can be a monocyclic, bicyclic, tricyclic or tetracyclic ring system, which can include fused or bridged ring systems.
  • Aryl radicals include, but are not limited to, aryl radicals derived from aceanthrylene, acenaphthylene, acephenanthrylene, anthracene, azulene, benzene, chrysene, fluoranthene, fluorene, as-indacene, s-indacene, indane, indene, naphthalene, phenalene, phenanthrene, pleiadene, pyrene, and triphenylene.
  • aryl is meant to include aryl radicals that are optionally substituted.
  • Heteroaryl refers to a 5- to 20-membered ring system radical comprising hydrogen atoms, one to thirteen carbon atoms, one to six heteroatoms selected from nitrogen, oxygen and sulfur, and at least one aromatic ring.
  • the heteroaryl radical can be a monocyclic, bicyclic, tricyclic or tetracyclic ring system, which can include fused or bridged ring systems; and the nitrogen, carbon or sulfur atoms in the heteroaryl radical can be optionally oxidized; the nitrogen atom can be optionally quaternized.
  • Examples include, but are not limited to, azepinyl, acridinyl, benzimidazolyl, benzothiazolyl, benzindolyl, benzodioxolyl, benzofuranyl, benzooxazolyl, benzothiazolyl, benzothiadiazolyl, benzo[b][1,4]dioxepinyl, 1,4-benzodioxanyl, benzonaphthofuranyl, benzoxazolyl, benzodioxolyl, benzodioxinyl, benzopyranyl, benzopyranonyl, benzofuranyl, benzofuranonyl, benzothienyl (benzothiophenyl), benzotriazolyl, benzo[4,6]imidazo[1,2-a]pyridinyl, carbazolyl, cinnolinyl, dibenzofuranyl, dibenzothiophenyl, furany
  • a heteroaryl group can be optionally substituted.
  • substituted means any of the above groups (i.e., alkyl, alkenyl, alkynyl, cycloalkyl, cycloalkenyl, cycloalkynyl, heterocyclyl, aryl, heteroaryl, alkoxy, aryloxy, acyl, alkylcarbamoyl, alkylcarboxamidyl, alkoxycarbonyl, alkylthio, or arylthio) wherein at least one atom is replaced by a non-hydrogen atoms such as, but not limited to: a halogen atom such as F, Cl, Br, and I; an oxygen atom in groups such as hydroxyl groups, alkoxy groups, and ester groups; a sulfur atom in groups such as thiol groups, thioalkyl groups, sul
  • “Substituted” also means any of the above groups in which one or more atoms are replaced by a higher-order bond (e.g., a double- or triple-bond) to a heteroatom such as oxygen in oxo, carbonyl, carboxyl, and ester groups; and nitrogen in groups such as imines, oximes, hydrazones, and nitriles.
  • a higher-order bond e.g., a double- or triple-bond
  • nitrogen in groups such as imines, oximes, hydrazones, and nitriles.
  • R g and R h are the same or different and independently hydrogen, alkyl, alkenyl, alkynyl, alkoxy, alkylamino, thioalkyl, aryl, aralkyl, cycloalkyl, cycloalkenyl, cycloalkynyl, cycloalkylalkyl, haloalkyl, haloalkenyl, haloalkynyl, heterocyclyl, N-heterocyclyl, heterocyclylalkyl, heteroaryl, N-heteroaryl and/or heteroarylalkyl.
  • “Substituted” further means any of the above groups in which one or more atoms are replaced by an amino, cyano, hydroxyl, imino, nitro, oxo, thioxo, halo, alkyl, alkenyl, alkynyl, alkoxy, alkylamino, thioalkyl, aryl, aralkyl, cycloalkyl, cycloalkenyl, cycloalkynyl, cycloalkylalkyl, haloalkyl, haloalkenyl, haloalkynyl, heterocyclyl, N-heterocyclyl, heterocyclylalkyl, heteroaryl, N-heteroaryl and/or heteroarylalkyl group.
  • “Substituted” can also mean an amino acid in which one or more atoms on the side chain are replaced by alkyl, alkenyl, alkynyl, acyl, alkylcarboxamidyl, alkoxycarbonyl, carbocyclyl, heterocyclyl, aryl, or heteroaryl.
  • each of the foregoing substituents can also be optionally substituted with one or more of the above substituents.
  • a point of attachment bond denotes a bond that is a point of attachment between two chemical entities, one of which is depicted as being attached to the point of attachment bond and the other of which is XY not depicted as being attached to the point of attachment bond.
  • “ ” indicates that the chemical entity “XY” is bonded to another chemical entity via the point of attachment bond.
  • the specific point of attachment to the non-depicted chemical entity can be 3 3 in R 3 XY specified by inference.
  • the compound CH -R where is H or “ ” infers that when R 3 is “XY”, the point of attachment bond is the same bond as the bond by which R 3 is depicted as being bonded to CH 3 .
  • a “subject” is meant an individual.
  • the “subject” can include domesticated animals (e.g., cats, dogs, etc.), livestock (e.g., cattle, horses, pigs, sheep, goats, etc.), laboratory animals (e.g., mouse, rabbit, rat, guinea pig, etc.), and birds.
  • “Subject” can also include a mammal, such as a primate or a human.
  • the subject can be a human or veterinary patient.
  • patient refers to a subject under the treatment of a clinician, e.g., physician.
  • inhibitor refers to a decrease in an activity, expression, function or other biological parameter and can include, but does not require complete ablation of the activity, expression, function or other biological parameter. Inhibition can include, for example, at least about a 10% reduction in the activity, response, condition, or disease as compared to a control. In embodiments, expression, activity or function of a gene or protein is decreased by a statistically significant amount.
  • activity or function is decreased by at least about 10%, about 20%, about 30%, about 40%, about 50%, and up to about 60%, about 70%, about 80%, about 90% or about 100%.
  • reduce or other forms of the word, such as “reducing” or “reduction,” is meant lowering of an event or characteristic (e.g., tumor growth). It is understood that this is typically in relation to some standard or expected value, in other words it is relative, but that it is not always necessary for the standard or relative value to be referred to.
  • “reduces tumor growth” means reducing the rate of growth of a tumor relative to a standard or a control (e.g., an untreated tumor).
  • treat refers to any administration of the disclosed compounds that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms or features of a disease as described herein.
  • treatment refers to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder.
  • active treatment that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder
  • causal treatment that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder.
  • this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
  • palliative treatment that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder
  • preventative treatment that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder
  • supportive treatment that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.
  • therapeutically effective refers to the amount of the disclosed compound and/or composition used is of sufficient quantity to ameliorate one or more causes or symptoms of a disease or disorder. Such amelioration only requires a reduction or alteration, not necessarily elimination.
  • carrier means a compound, composition, substance, or structure that, when in combination with a compound or composition of the present disclosure, aids or facilitates preparation, storage, administration, delivery, effectiveness, selectivity, or any other feature of the compound or composition for its intended use or purpose, or combinations thereof.
  • a carrier can be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject.
  • a pharmaceutical carrier refers to a carrier suitable for administration to a patient.
  • a pharmaceutical carrier may be a substance that aids or facilitates preparation, storage, administration, delivery, effectiveness, selectivity, or any other feature of the compound or composition of the present disclosure for its intended use or purpose, or combinations thereof.
  • a carrier can be selected to reduce degradation of the compound or to reduce adverse side effects in the patient.
  • a pharmaceutically acceptable carrier can be a sterile aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, as well as sterile powders for reconstitution into sterile injectable solutions or dispersions just prior to use.
  • aqueous and nonaqueous carriers, diluents, solvents or vehicles examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol and the like), carboxymethylcellulose and suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate.
  • polyols such as glycerol, propylene glycol, polyethylene glycol and the like
  • carboxymethylcellulose and suitable mixtures thereof such as vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate.
  • Proper fluidity can be maintained, for example, by the use of coating materials such as lecithin, by the maintenance of the required particle size in the case of dispersions and by the use of surfactants.
  • These compositions can also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents.
  • the injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable media just prior to use.
  • Suitable inert carriers can include sugars such as lactose.
  • salts include those obtained by reacting the active compound functioning as a base, with an inorganic or organic acid to form a salt, for example, salts of hydrochloric acid, sulfuric acid, phosphoric acid, methanesulfonic acid, camphorsulfonic acid, oxalic acid, maleic acid, succinic acid, citric acid, formic acid, hydrobromic acid, benzoic acid, tartaric acid, fumaric acid, salicylic acid, mandelic acid, carbonic acid, etc.
  • acid addition salts may be prepared by reaction of the compounds with the appropriate inorganic or organic acid via any of a number of known methods.
  • salts also includes those obtained by reacting the active compound functioning as an acid, with an inorganic or organic base to form a salt, for example salts of ethylenediamine, N-methyl-glucamine, lysine, arginine, ornithine, choline, N,N'- dibenzylethylenediamine, chloroprocaine, diethanolamine, procaine, N-benzylphenethylamine, diethylamine, piperazine, tris-(hydroxymethyl)-aminomethane, tetramethylammonium hydroxide, triethylamine, dibenzylamine, ephenamine, dehydroabietylamine, N-ethylpiperidine, benzylamine, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, ethylamine, basic amino acids, and the like.
  • Non limiting examples of inorganic or metal salts include lithium, sodium, calcium, potassium, magnesium salts, and the like.
  • parenteral administration refers to administration through injection or infusion. Parenteral administration includes, but is not limited to, subcutaneous administration, intravenous administration, or intramuscular administration.
  • subcutaneous administration refers to administration just below the skin.
  • Intravenous administration means administration into a vein.
  • dose refers to a specified quantity of a pharmaceutical agent provided in a single administration. In embodiments, a dose may be administered in two or more boluses, tablets, or injections.
  • the desired dose requires a volume not easily accommodated by a single injection.
  • two or more injections may be used to achieve the desired dose.
  • a dose may be administered in two or more injections to reduce injection site reaction in a patient.
  • the term "dosage unit" refers to a form in which a pharmaceutical agent is provided.
  • a dosage unit is a vial that includes lyophilized compounds or compositions described herein.
  • a dosage unit is a vial that includes reconstituted compounds or compositions described herein.
  • TM refers to a compound that can be used for treating, at least one symptom of a disease or disorder and can include, but is not limited to, therapeutic polypeptides, oligonucleotides, small molecules and other agents that can be used to treat at least one symptom of a disease or disorder.
  • the TM modulates the activity, expression, and/or levels of a target transcript.
  • the TM decreases the levels of the target transcript through decay mechanisms.
  • the activity is the ability of the target transcript to bind to (e.g., sequester) one or more proteins.
  • the TM modulates the activity of the target transcript by reducing the affinity between the target transcript and one or more proteins that bind to the target transcript.
  • the activity of the one or more proteins may be modulated.
  • the one or more proteins are not bound to the target transcript, they are available to carry out their functions, such as, for example, facilitating the splicing, alternative splicing, and/or exon skipping of other transcripts.
  • the function of a TM the activity, expression, and/or levels of the downstream genes that are regulated by the one or more proteins whose interaction with the target transcript is disrupted by the TM may be modulated.
  • modulate refers to a perturbation of expression, function or activity when compared to the level of expression, function or activity prior to modulation. Modulation can include an increase (stimulation or induction) or a decrease (inhibition or reduction) in expression, function, or activity.
  • the activity of a target transcript is modulated.
  • modulating the activity of the target transcript includes decreasing the ability of the target transcript to bind to one or more proteins.
  • decreasing the affinity between the target transcript and the one or more proteins results in the modulation of the activity of the one or more proteins that interact with the target transcript.
  • amino acid refers to an organic compound that includes an amino group and a carboxylic acid group and has the general formula where R can be any organic group.
  • An amino acid may be a naturally occurring amino acid or non-naturally occurring amino acid.
  • amino acid may be a proteogenic amino acid or a non-proteogenic amino acid.
  • An amino acid can be an L-amino acid or a D- amino acid.
  • amino acid side chain or side chain refers to the characterizing substituent (“R”) bound to the ⁇ -carbon of a natural or non-natural ⁇ -amino acid.
  • R substituent
  • An amino acid may be incorporated into a polypeptide via a peptide bond.
  • an “uncharged” amino acid is an amino acid having a side chain that has a net neutral charge at pH 7.35 to 7.45. Examples of uncharged amino acids include, but are not limited to, glycine and citrulline.
  • sequence identity refers to the percentage of nucleic acids or amino acids between two oligonucleotide or polypeptide sequences, respectively, that are the same and in the same relative position. As such, one sequence has a certain percentage of sequence identity compared to another sequence. For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared.
  • sequence identity between sequences may be determined using the Needleman-Wunsch algorithm (Needleman and Wunsch, 1970, J. Mol. Biol.48: 443-453) as implemented in the Needle program of the EMBOSS package (EMBOSS: The European Molecular Biology Open Software Suite, Rice et al., Trends Genet.(2000), 16: 276-277), in the version that exists as of the date of filing.
  • the parameters used are gap open penalty of 10, gap extension penalty of 0.5, and the EBLOSUM62 (EMBOSS version of BLOSUM62) substitution matrix.
  • sequence identity is calculated as follows: (Identical Residues ⁇ 100)/(Length of Alignment ⁇ Total Number of Gaps in Alignment) [0581]
  • sequence identity may be determined using the Smith-Waterman algorithm, in the version that exists as of the date of filing.
  • sequence homology refers to the percentage of amino acids between two polypeptide sequences that are homologous and in the same relative position. As such one polypeptide sequence has a certain percentage of sequence homology compared to another polypeptide sequence.
  • homologous residues may be identical residues.
  • homologous residues may be non-identical residues with appropriately similar structural and/or functional characteristics.
  • certain amino acids are typically classified as “hydrophobic” or “hydrophilic” amino acids, and/or as having “polar” or “non-polar” side chains, and substitution of one amino acid for another of the same type may often be considered a “homologous” substitution.
  • amino acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTP, gapped BLAST, and PSI-BLAST, in existence as of the date of filing.
  • BLASTP Altschul, et al., J. Mol. Biol., (1990),215(3): 403-410; Altschul, et al., Nucleic Acids Res.
  • cell targeting moiety refers to a molecule or macromolecule that specifically binds to a molecule, such as a receptor, on the surface of a target cell. In embodiments, the cell surface molecule is expressed only on the surface of a target cell.
  • the cell surface molecule is also present on the surface of one or more non-target cells, but the amount of cell surface molecule expression is higher on the surface of the target cells.
  • a cell targeting moiety include, but are not limited to, an antibody, a peptide, a protein, an aptamer, or a small molecule.
  • the AC may be a short (in embodiments, less than 50 bases) polynucleotide or polynucleotide homologue that includes at least a portion of a sequence complimentary to a target sequence.
  • the AC is a polynucleotide or polynucleotide homologue that includes a portion that has a sequence complimentary to a target sequence in a target pre-mRNA strand.
  • the AC may be formed of natural nucleic acids, synthetic nucleic acids, nucleic acid homologues, or any combination thereof.
  • the AC includes oligonucleosides.
  • AC includes antisense oligonucleotides.
  • the AC includes conjugate groups.
  • Nonlimiting examples of ACs include, but are not limited to, primers, probes, antisense oligonucleotides, external guide sequence (EGS) oligonucleotides, siRNAs, oligonucleotides, oligonucleosides, oligonucleotide analogs, oligonucleotide mimetics, and chimeric combinations of these.
  • EGS external guide sequence
  • these compounds can be introduced in the form of single-stranded, double-stranded, circular, branched or hairpins and can contain structural elements such as internal or terminal bulges or loops.
  • Oligomeric double- stranded compounds can be two strands hybridized to form double-stranded compounds or a single strand with sufficient self-complementarity to allow for hybridization and formation of a fully or partially double-stranded compound.
  • an AC modulates (increases, decreases, or changes) the expression, levels, and/or activity of a target transcript (e.g., target nucleic acid).
  • the AC decreases the level of the target transcript through inducing decay mechanisms.
  • the AC modulates the activity of the target transcript.
  • the AC modulates the activity of the target transcript by decreasing the ability of the target transcript to bind one or more proteins.
  • decreasing the affinity between the target transcript and the one or more proteins may result in the modulation of the activity of the one or more proteins.
  • the one or more proteins are not bound to the target transcript, they are available to carry out their functions, such as, for example, facilitating the splicing, alternative splicing, and/or exon skipping of other transcripts (downstream transcripts).
  • AC mediated modulation of the activity of the target transcript may result in modulation of the activity, expression, and/or levels of the downstream genes that are regulated by the one or more proteins whose interaction with the target transcript may be disrupted.
  • the terms “targeting” or “targeted to” refer to the association of a therapeutic moiety, for example, an antisense compound with a target nucleic acid molecule or a region of a target nucleic acid molecule.
  • the therapeutic moiety includes an antisense compound that is capable of hybridizing to a target nucleic acid under physiological conditions.
  • the antisense compound targets a specific portion or site within the target nucleic acid, for example, a portion of the target nucleic acid having at least one identifiable structure, function, or characteristic such as a particular exon or intron, or selected nucleobases or motifs within an exon or intron.
  • target nucleic acid sequence refers to the nucleic acid sequence or the nucleotide sequence to which a therapeutic moiety, such as an antisense compound, binds or hybridizes.
  • Target nucleic acids include, but are not limited, to a portion of a target transcript, target RNA (including, but not limited to pre-mRNA and mRNA or portions thereof), a portion of target cDNA derived from such RNA, as well as a portion of target non-translated RNA, such as miRNA.
  • a target nucleic acid can be a portion of a target cellular gene (or mRNA transcribed from such gene) whose expression or transcription is associated with a particular disorder or disease state.
  • portion refers to a defined number of contiguous (i.e., linked) nucleotides of a nucleic acid.
  • transcript or “gene transcript” refers to an RNA molecule transcribed from DNA and includes, but is not limited to mRNA, pre-mRNA, and partially processed RNA.
  • target transcript and “target RNA” refer to the pre-mRNA or mRNA transcript that is bound by the therapeutic moiety.
  • the target transcript may include a target nucleotide sequence.
  • the target transcript includes a target nucleotide sequence that includes an expanded CUG trinucleotide repeat.
  • target gene and “gene of interest” refer to the gene of which modulation of the expression and/or activity is desired or intended.
  • the target gene may be transcribed into a target transcript that includes a target nucleotide sequence.
  • the target transcript may be translated into a protein of interest.
  • target protein refers to the polypeptide or protein encoded by the target transcript (e.g., target mRNA).
  • mRNA refers to an RNA molecule that encodes a protein and includes pre-mRNA and mature mRNA.
  • Pre-mRNA refers to a newly synthesized eukaryotic mRNA molecule directly after DNA transcription.
  • a pre-mRNA is capped with a 5' cap, modified with a 3' poly-A tail, and/or spliced to produce a mature mRNA sequence.
  • pre-mRNA includes one or more introns.
  • the pre-mRNA undergoes a process known as splicing to remove introns and join exons.
  • pre- mRNA includes one or more splicing elements or splice regulatory elements.
  • pre-mRNA includes a polyadenylation site.
  • expression refers to all the functions and steps by which information encoded in a gene is converted into a functional gene product, such as a polypeptide or a non-coding RNA, in a cell.
  • non- coding RNA include transfer RNA (tRNA) and ribosomal RNA.
  • Gene expression of a polypeptide includes transcription of the gene to form a pre-mRNA, processing of the pre-mRNA to form a mature mRNA, translocating the mature mRNA from the nucleus to the cytoplasm, translation of the mature mRNA into the polypeptide, and assembly of the encoded polypeptide.
  • Expression includes partial expression. For example, expression of a gene may be referred to as generation of a gene transcript. Translation of a mature mRNA may be referred to as expression of the mature mRNA.
  • “modulation of gene expression” or the like refers to modulation of one or more of the processes associated with gene expression.
  • modification of gene expression may include modification of one or more of gene transcription, RNA processing, RNA translocation from the nucleus to the cytoplasm, and translation of mRNA into a protein.
  • gene refers to a nucleic acid sequence that encompasses a 5' promoter region associated with the expression of the gene product, and any intron and exon regions and 3' untranslated regions ("UTR") associated with the expression of the gene product.
  • UTR 3' untranslated regions
  • immune cell refers to a cell of hematopoietic origin and that plays a role in the immune response.
  • Immune cells include, but are not limited to, lymphocytes (e.g., B cells and T cells), natural killer (NK) cells, and myeloid cells.
  • lymphocytes e.g., B cells and T cells
  • NK natural killer
  • myeloid cells includes monocytes, macrophages and granulocytes (e.g., basophils, neutrophils, eosinophils and mast cells).
  • Monocytes are lymphocytes that circulate through the blood for 1–3 days, after which time, they either migrate into tissues and differentiate into macrophages or inflammatory dendritic cells or die.
  • macrophage includes fetal-derived macrophages (which also can be referred to as resident tissue macrophages) and macrophages derived from monocytes that have migrated from the bloodstream into a tissue in the body (which can be referred to as monocyte- derived macrophages).
  • tissue macrophages which can be referred to as monocyte- derived macrophages.
  • a Kupffer cell liver
  • an intraglomular mesangial cell kidney
  • an alveolar macrophage lungs
  • sinus histiocyte lymph nodes
  • hofbauer cell placenta
  • microglia brain and spinal cord
  • langerhans skin
  • oligonucleotide refers to an oligomeric compound comprising a plurality of linked nucleotides or nucleosides.
  • One or more nucleotides of an oligonucleotide can be modified.
  • An oligonucleotide can comprise ribonucleic acid (RNA) or deoxyribonucleic acid (DNA).
  • Oligonucleotides can be composed of natural and/or modified nucleobases, sugars and covalent internucleoside linkages, and can further include non-nucleic acid conjugates.
  • nucleoside refers to a glycosylamine that includes a nucleobase and a sugar. Nucleosides include, but are not limited to, natural nucleosides, abasic nucleosides, modified nucleosides, and nucleosides having mimetic bases and/or sugar groups.
  • a "natural nucleoside” or “unmodified nucleoside” is a nucleoside that includes a natural nucleobase and a natural sugar. Natural nucleosides include RNA and DNA nucleosides.
  • nucleoside refers to a nucleoside having a phosphate group covalently linked to the sugar. Nucleotides may be modified with any of a variety of substituents.
  • nucleobase refers to the base portion of a nucleoside or nucleotide. A nucleobase may include any atom or group of atoms capable of hydrogen bonding to a base of another nucleic acid.
  • a natural nucleobase is a nucleobase that is unmodified from its naturally occurring form in RNA or DNA.
  • heterocyclic base moiety refers to a nucleobase that includes a heterocycle.
  • internal linkage refers to a covalent linkage between adjacent nucleosides.
  • natural internucleoside linkage refers to a 3' to 5' phosphodiester linkage.
  • modified internucleoside linkage refers to any linkage between nucleosides or nucleotides other than a naturally occurring internucleoside linkage.
  • oligonucleoside refers to an oligonucleotide in which the internucleoside linkages do not contain a phosphorus atom.
  • chimeric antisense compound refers to an antisense compound, having at least one sugar, nucleobase, and/or internucleoside linkage that is differentially modified as compared to the other sugars, nucleobases, and internucleoside linkages within the same oligomeric compound. The remainder of the sugars, nucleobases, and internucleoside linkages can be independently modified or unmodified.
  • a chimeric oligomeric compound will have modified nucleosides that can be in isolated positions or grouped together in regions that will define a particular motif. Any combination of modifications and or mimetic groups can include a chimeric oligomeric compound as described herein.
  • the term "mixed-backbone antisense oligonucleotide” refers to an antisense oligonucleotide wherein at least one internucleoside linkage of the antisense oligonucleotide is different from at least one other internucleoside linkage of the antisense oligonucleotide.
  • nucleobase complementarity refers to a nucleobase that is capable of base pairing with another nucleobase.
  • adenine (A) is complementary to thymine (T).
  • adenine (A) is complementary to uracil (U).
  • complementary nucleobase refers to a nucleobase of an antisense compound that is capable of base pairing with a nucleobase of its target nucleic acid.
  • nucleobase at a certain position of an antisense compound is capable of hydrogen bonding with a nucleobase at a certain position of a target nucleic acid
  • the position of hydrogen bonding between the oligonucleotide and the target nucleic acid is considered to be complementary at that nucleobase pair.
  • non-complementary nucleobase refers to a pair of nucleobases that do not form hydrogen bonds with one another or otherwise support hybridization.
  • complementary refers to the capacity of an oligomeric compound to hybridize to another oligomeric compound or nucleic acid through nucleobase complementarity.
  • an antisense compound and its target are complementary to each other when a sufficient number of corresponding positions in each molecule are occupied by nucleobases that can bond with each other to allow stable association between the antisense compound and the target.
  • nucleobases that can bond with each other to allow stable association between the antisense compound and the target.
  • antisense compounds may include up to about 20% nucleotides that are mismatched (i.e., are not nucleobase complementary to the corresponding nucleotides of the target).
  • the antisense compounds contain no more than about 15%, for example, not more than about 10%, for example, not more than 5%, or no mismatches.
  • nucleobase complementary or otherwise do not disrupt hybridization e.g., universal bases.
  • hybridization means the pairing of complementary oligomeric compounds (e.g., an antisense compound and its target nucleic acid).
  • the most common mechanism of pairing involves hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleoside or nucleotide bases (nucleobases).
  • hydrogen bonding which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleoside or nucleotide bases (nucleobases).
  • nucleobases complementary to the natural nucleobases thymine and uracil which pair through the formation of hydrogen bonds.
  • the natural base guanine is nucleobase complementary to the natural bases cytosine and 5-methyl cytosine. Hybridization can occur under varying circumstances.
  • the term “specifically hybridizes” refers to the ability of an oligomeric compound to hybridize to one nucleic acid site with greater affinity than it hybridizes to another nucleic acid site.
  • an antisense oligonucleotide specifically hybridizes to more than one target site.
  • an oligomeric compound specifically hybridizes with its target under stringent hybridization conditions.
  • An example of stringent hybridization conditions for hybridization of complementary nucleotide sequences which have more than 100 complementary residues on a filter in a Southern or Northern blot is 50% formamide with 1 mg of heparin at 42°C, with the hybridization being carried out overnight.
  • An example of highly stringent wash conditions is 0.15M NaCl at 72°C for about 15 minutes.
  • An example of stringent wash conditions is a 0.2x SSC wash at 65°C for 15 minutes (see, Sambrook and Russel, Molecular Cloning: A laboratory Manual, 3 rd ed., Cold Spring Harbor Laboratory Press, 2001 for a description of SSC buffer). Often, a high stringency wash is preceded by a low stringency wash to remove background probe signal.
  • An example of a medium stringency wash for a duplex of, e.g., more than 100 nucleotides, is 1x SSC at 45°C for 15 minutes.
  • An example of a low stringency wash for a duplex of, e.g., more than 100 nucleotides, is 4-6x SSC at 40°C for 15 minutes.
  • stringent conditions typically involve salt concentrations of less than about 1.0 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3, and the temperature is typically at least about 30°C. Stringent conditions can also be achieved with the addition of destabilizing agents such as formamide.
  • 2'-modified or “2'-substituted” means a sugar that includes substituent at the 2' position other than H or OH.
  • the term “MOE” refers to a 2'-O-methoxyethyl substituent.
  • the term “high-affinity modified nucleotide” refers to a nucleotide having at least one modified nucleobase, internucleoside linkage or sugar moiety, such that the modification increases the affinity of an antisense compound that includes the modified nucleotide to a target nucleic acid. High-affinity modifications include, but are not limited to, BNAs, LNAs and 2'-MOE.
  • mimetic refers to groups that are substituted for a sugar, a nucleobase, and/ or internucleoside linkage in an AC. Generally, a mimetic is used in place of the sugar or sugar-internucleoside linkage combination, and the nucleobase is maintained for hybridization to a selected target.
  • Representative examples of a sugar mimetic include, but are not limited to, cyclohexenyl or morpholino.
  • Representative examples of a mimetic for a sugar- internucleoside linkage combination include, but are not limited to, peptide nucleic acids (PNA) and morpholino groups linked by uncharged achiral linkages.
  • PNA peptide nucleic acids
  • nucleobase mimetics are well known in the art and include, but are not limited to, tricyclic phenoxazine analogs and universal bases (Berger et al., Nuc Acid Res. 2000, 28:2911-14, incorporated herein by reference). Methods of synthesis of sugar, nucleoside, and nucleobase mimetics are well known to those skilled in the art.
  • BNA bicyclic nucleoside
  • the term "bicyclic nucleoside” or “BNA” refers to a nucleoside wherein the furanose portion of the nucleoside includes a bridge connecting two atoms on the furanose ring, thereby forming a bicyclic ring system.
  • BNAs include, but are not limited to, ⁇ -L-LNA, ⁇ -D-LNA, ENA, Oxyamino BNA (2'-O-N(CH3)-CH2-4') and Aminooxy BNA (2'-N(CH3)-O-CH2-4').
  • the term "4' to 2' bicyclic nucleoside” refers to a BNA wherein the bridge connecting two atoms of the furanose ring bridges the 4' carbon atom and the 2' carbon atom of the furanose ring, thereby forming a bicyclic ring system.
  • a "locked nucleic acid” or “LNA” refers to a nucleotide modified such that the 2'-hydroxyl group of the ribosyl sugar ring is linked to the 4' carbon atom of the sugar ring via a methylene group, thereby forming a 2'-C,4'-C-oxymethylene linkage.
  • LNAs include, but are not limited to, ⁇ -L-LNA, and ⁇ -D-LNA.
  • cap structure or “terminal cap moiety” refers to chemical modifications, which have been incorporated at either end of an AC.
  • therapeutic polypeptide refers to a naturally occurring or recombinantly produced macromolecule that includes two or more amino acids and has therapeutic, prophylactic or other biological activity.
  • small molecule refers to an organic compound with pharmacological activity and a molecular weight of less than about 2000 Daltons, or less than about 1000 Daltons, or less than about 500 Daltons. Small molecule therapeutics are typically manufactured by chemical synthesis.
  • Wild type target protein refers to a native, functional protein isomer produced by a wild type, normal, or unmutated version of the target gene.
  • the wild type target protein also refers to a protein resulting from a target pre-mRNA that has been re-spliced.
  • a "re-spliced target protein”, as used herein, refers to the protein encoded by the mRNA resulting from the splicing of the target pre-mRNA to which the AC hybridizes.
  • Re-spliced target protein may be identical to a wild type target protein, may be homologous to a wild type target protein, may be a functional variant of a wild type target protein, may be an isoform of a wild type target protein, or may be an active fragment of a wild type target protein.
  • an “expanded trinucleotide repeat,” such as an “expanded” CUG or and “expanded” CTG repeat means a gene containing or encoding the trinucleotide repeat contains a number of repeated consecutive trinucleotides that is greater than present in a wild type gene.
  • Expanded nucleotide repeats may be written as XXX ⁇ NNN or (XXX ⁇ NNN) where XXX refers to the DNA repeat and NNN refers to the RNA repeat that is transcribed from the DNA repeat.
  • the CTG ⁇ CUG repeat refers to a gene having a CTG DNA repeat from which a RNA having a CUG repeat is transcribed.
  • the number of repeats in an expanded trinucleotide repeat is 5 or more, 10 or more 15, or more or 20 or more than the wild type gene.
  • the expanded trinucleotide repeat includes 2x, 3x, 4x, 5x, 10x, 20x, 50x or more trinucleotide repeats than the wild type gene.
  • the expanded trinucleotide repeat may result in a disease in a subject having a gene that contains the expanded trinucleotide repeat.
  • a subject having an expanded CTG repeat in a gene may suffer from DM1 or FECD.
  • the DPMK gene contains an expanded CTG repeat.
  • Subjects that suffer from DM1 may have 50 or more CTG repeats in the 3’ untranslated region (UTR) of the DPMK gene, while non-disease subjects typically have 5 to 34 CTG repeats in the 3’ UTR of the DPMK gene.
  • the TCF4 gene contains an expanded CTG repeat.
  • Subjects that suffer from FECD may have 40 or more CTG repeats in a CTG18.1 locus of the TCF4 gene, while non-disease subjects typically have 30 or less CTG repeats in the CTG18.1 locus of the TCF4 gene.
  • mRNA transcribed from a gene having an expanded CTG repeat will have an expanded CUG repeat.
  • downstream in the present disclosure, as it relates to a gene, mRNA, or protein, refers to a gene, mRNA, or protein that is affected by binding of AC to the target nucleotide (e.g., target transcript) but is not the gene, mRNA, or protein corresponding to the target nucleotide. Binding of the AC to the target nucleotide may reduce aggregation or sequestration of RNA binding protein such as MBNL1 or CUGBP1 on accumulated mRNA having CUG repeats, which may make available such RNA binding proteins for proper transcription, RNA processing, and/or expression of downstream gene products.
  • target nucleotide e.g., target transcript
  • “functional fragment” or “active fragment” refers to a portion of a eukaryotic wild type target protein that exhibits an activity, such as one or more activities of a full- length wild type target protein, or that possesses another activity.
  • a re-spliced target protein that shares at least one biological activity of wild type target protein is considered to be an active fragment of the wild type target protein.
  • Activity can be any percentage of activity (i.e., more or less) of the full-length wild type target protein, including but not limited to, about 1% of the activity, about 2%, about 3%, about 4%, about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99%, about 100%, about 200%, about 300%, about 400%, about 500%, or more (including all values and ranges in between these values) activity compared to the wild type target protein.
  • the active fragment may retain at least a portion of one or more biological activities of wild type target protein.
  • the active fragment may enhance one or more biological activities of wild type target protein.
  • Wild type target protein refers to a native, functional protein isomer produced by a wild type, normal, or unmutated version of the target gene.
  • the wild type target protein also refers to the protein resulting from a target pre-mRNA that has been properly spliced.
  • splicing and “processing” refer to the modification of a pre- mRNA following transcription, in which introns are removed and exons are joined.
  • RNA-protein complex composed of five small nuclear ribonucleoproteins (snRNPs) referred to as a spliceosome.
  • snRNPs small nuclear ribonucleoproteins
  • intron a 3′ splice site, a 5′ splice site, and a branch site are required for splicing.
  • the RNA components of snRNPs interact with the intron and may be involved in catalysis.
  • alternative splicing refers to the splicing of different combinations of exons present in a gene, which results in the generation of different mRNA transcripts from a single gene.
  • a "re-spliced target protein”, as used herein, refers to the protein encoded by the mRNA resulting from the splicing of the target pre-mRNA to which the AC hybridizes.
  • Re-spliced target protein may be identical to a wild type target protein, may be homologous to a wild type target protein, may be a functional variant of a wild type target protein, or may be an active fragment of a wild type target protein.
  • HeLa-480 DM1 HeLa cell model
  • DM1 myoblasts derived from a DM1 patient with about 2600 CTG repeats and downstream splicing defects.
  • HeLa-480 recapitulates pathogenic hallmarks of DM1, including CUG ribonuclear foci and mis-splicing of pre-mRNA targets of the muscleblind (MBNL) alternative splicing factors. It was noted that DM1 myoblasts grow quite slowly (doubling time of about 7 days) and do not transfect well. Control HeLa and HeLa-480 cells were treated with ENDOPORTER without additional compounds.
  • HeLa-480 cells represent the disease state and HeLa cells represent the un- diseased state.
  • RNA foci analysis HeLa-480 cells or DM1 myoblasts were treated with 1 ⁇ M, 3 ⁇ M, or 10 ⁇ M of compounds A-D (Table 12). All compounds were transfected without a transfection reagent or using the ENDOPORTER (available from GENETOOLS LLC in Philomath, Oregon) transfection agent designed to deliver naturally charged PMOs into cells. Cells were incubated for 24 hours and then fixed for qualitative RNA foci analysis via microscopy. Upon qualitative visual inspection of the treated Hela-480 cells, compound A (PMO-EEV) showed the least amount of RNA foci.
  • FIG. 6A-6D show the RT-PCR results of the alternative splicing events of MBNL1 (6A and 6C, exon 5 inclusion) and CLASP1 (6B and 6D, exon 19 inclusion) 24 hours (6A and 6B) and 48 hours (6C and 6D) after HeLa-480 cells were treated with compounds A-D and the ENDOPORTER transfection agent.
  • a reduction of exon 5 inclusion in MBNL1 was observed for cells treated with each of compounds A-D at both the 24- and 48-hour time points (FIG. 6A and 6C). Cells treated with compound A showed the largest rescue (decrease in exon 5 inclusion).
  • FIG. 7A-7B show the RT-PCR results of alternative splicing events of MBNL1 and CLASP1 after DM1 myoblasts were treated with compound A-D, the negative control DM-04, or the positive control DM-05. Treatment with all the compounds resulted in the rescue of the splicing events of MBNL1 (FIG. 7A) and CLASP1 (FIG. 7B).
  • HSA-LR is a transgenic mouse model having expanded long CUG repeats (LR) in the 3′-UTR of a human skeletal actin (HSA) transgene and expresses CUGexp RNA (e.g., expanded CUG RNA) at high levels in skeletal muscle (Mankodi et al., Science 2000, 289(5485):1769-1773).
  • the HSA-LR mouse shows myotonic phenotype along with splicing defects.
  • a Friend Virus B NIH Jackson (FVB/NJ) mouse model was used as a control and to make the HSA-LR transgenic mice.
  • Experimental design was used as a control and to make the HSA-LR transgenic mice.
  • Compounds A-D were administered to the mice via Retro-orbital injection or intravenous (IV) injection at a single dose of 100 ⁇ L compound solution per 20 g body weight.
  • the scale was proportional to body weight of each mouse (e.g., 150 ⁇ L per 30 g body weight).
  • Table 13 PMOs and PMO-EEVs tested in Example 2.
  • Animals were age matched and assigned into six treatment groups. Two control groups were used; Group 1: FVB/NJ mice (FVB/NJ; un-diseased control) and Group 2: HSA-LR (diseased control) mice, each of which were injected with saline.
  • mice Four treatment groups (Groups A-D) were used; HSA-LR mice injected with compounds A, B, C, or D.
  • the FVB/NJ mice were 5 weeks and 4 days old when injected, while the HSA-LR mice were 6 weeks and 1 or 2 days old when injected.
  • mice two males and two females per group were utilized for this experiment. Mice were sacrificed 1 week post treatment. Tissues (Gastrocnemius, Quadriceps, Tibialis Anterior (TA)) were harvested and flash frozen in liquid nitrogen and stored at -80°C for further evaluation of splicing rescue analysis.
  • Tissues Gastrocnemius, Quadriceps, Tibialis Anterior (TA)
  • FIGs. 8A-10D show the RNA splicing measurements for Atp2a1 (for exon 22 inclusion; FIGs. 8A, 9A, and 10A), Nfix (for exon 7 inclusion; FIG. 8B, 9B, and 10B), Clcn1 (for exon 7a inclusion; FIG. 8C, 9C, and 10C) and Mbnl1 (for exon 5 inclusion; FIG. 8D, 9D, and 10D) in gastrocnemius (FIGs. 8A-8D), quadricep (FIG. 9A-9D), and tibialis anterior (FIG.
  • mice treated with compounds C and D showed a rescue of Atp2a1 and Nfix splicing events in gastrocnemius, quadriceps, and tibialis anterior tissue while the PMO and saline groups did not show rescue of splicing events (FIG. 8A, 8B, 9A, 9B, 10A, and 10B.
  • mice treated with compounds C and D showed a rescue of Clcn1 (FIG. 8C and 9C) and Mbnl1 (FIG. 8D and 9D) splicing events while the PMO and saline groups did not show rescue of splicing events.
  • Myoblasts were cultured in a growth medium of Skeletal Muscle Cell Growth Medium (available from PromoCell in Heidelberg, Germany), 2% horse serum (available from Gibco in Bristol, RI), 1% chick embryo extract (available from USB Corp in Cleveland, OH), and 0.5 mg/mL penicillin/streptomycin (Gibco).
  • Skeletal Muscle Cell Growth Medium available from PromoCell in Heidelberg, Germany
  • 2% horse serum available from Gibco in Bristol, RI
  • 1% chick embryo extract available from USB Corp in Cleveland, OH
  • penicillin/streptomycin Gibco
  • Table 14 Compounds tested in Example 3 [0653] Treatment.
  • DM1 patient muscle cells were treated with 10 ⁇ m, 3 ⁇ m, 1 ⁇ m, or 0.3 ⁇ m of the compounds using two different treatment conditions.
  • RNA isolation and PCR Total RNA was isolated with the RNEASY Mini Kit (available from Qiagen in Germantown, MD) according to the manufacturer’s instructions.
  • FIG. 11A-11F shows mixed rescue of splicing defect of MBNL1 (FIG. 11A) and its targets (SOS1, IR, DMD, BIN1, LDB3; FIG.
  • EEV-PMO 197-777 elicited moderate correction of mis-splicing events in DM1 patient muscle cells.
  • MBNL1 and SOS1 showed the best response of mis-splicing correction.
  • EEV-PMO 197-777 chosen as tool compound for follow-up experiments described below. [0656] DM1 patient derived myoblasts and myotubes were treated with 10 ⁇ m, 3 ⁇ m, and 1 ⁇ m of DMPK CUG-targeting EEV-PMO 197-777 using methods similar to those described above.
  • FIGS. 12A, 12B, INSR, exon 11 inclusion; FIG. 12C), DMD (exon 78 inclusion, FIG. 12D), BIN1(exon 11 inclusion; FIG. 12E), and LDB3 exon 11 exclusion; FIG. 12F
  • FIG. 44A-44D show the reversal of myotonia phenotypes in HSA-LR mice treated with 20 mpk 221-1106 quantified by muscle relaxation assay.
  • FIG. 44A and 44C show plots of relaxation time to 80% of peak isometric force and
  • FIG.44B shows the force trace raw data.
  • FIG. 44D shows the reversal of myotonia phenotypes in HSA-LR mice treated with 20 mpk 221-1106 quantified by representative electromyography (EMG) traces.
  • EMG electromyography
  • mice There were two general treatment groups: 1) wild-type mice; and 2) HSA- LR mice (DM1 disease model). Within the HSA-LR treatment group there were two sub-treatment groups: 1) HSA-LR treated with saline (control); and 2) HSA-LR + EEV-PMO 221-1120. Mice were treated with 15 mpk, 30 mpk, 60 mpk, or 90 mpk (based on the PMO) of the PMO-EEV or saline via tail intravenous injection. Seven days after treatment, mice were sacrificed, and tissues were collected for analysis. [0660] RT-PCR assays (correction of splicing).
  • RNA samples were homogenized by OMNI BEAD MILL HOMOGENIZER and the RNA was extracted by QIACUBEQ.
  • RT-PCR assays were performed using one-step RT-PCT kit (Qiagen) following the manufacturer’s protocols with 35 PCR cycles of 94° C for 30 seconds; 60° C for 30 seconds and 72° C for 30 seconds.
  • normalized splicing values were calculated for each splice event j as (PSI i,j – PSI wildtype,j )/(PSI HSALR,j –PSI wildtype,j ), where PSI wildtype,j is the average PSI for event j across the wildtype mice, and PSI HSALR,j is the average PSI for event j across the HSALR mice.
  • mDSI is then calculated as the mean of all normalized splicing values, which are Atp2a1, Nfix, Mbnl1 and Clcn1 in the studies.
  • RNAseq PolyA RNAseq using Next Generation Sequencing was done for transcriptome profiling. The Z-score for each gene was calculated as the (sample value – the mean)/(the standard deviation). Differential splicing analysis was done on the RNAseq data to calculate the percent spliced (PSI) of individual exons for each gene.
  • PSI percent spliced
  • the PSI is a ratio of normalized read counts indicating the inclusion of a transcript element over the total normalized reads for that event (inclusion and exclusion reads). For example, if an exon is included in the reads 100% of the time, the PSI is 1. Additionally, if an exon is excluded from the reads 100% of the time, the PSI is 0. [0664] Twenty-two genes of interest known to be predictive of DM1 were analyzed. Additionally, the genes studied in Wagner et al. (PLOS Gen 2016 (47)) and Tanner et al. (NAR 2021 (48), 4, 2240-2254) were analyzed. The mouse exons were mapped to the human location. In some cases, the boundary of the exons in mice and/or the human genome was not completely known.
  • RNA CUG Foci analysis Tibialis anterior muscle sections were stained for CUG foci (FISH, red) and nuclei (Hoechst, blue). TA muscle sections were imaged and the number of nuclei having a CUG RNA foci were quantified.
  • Results [0667] HSA mRNA knockdown. The diaphragm only expressed 5-10% of the HSA mRNA levels compared to quadriceps, tibialis anterior, and triceps (FIG. 13A).
  • EEV-PMO treatment did not seem to change the HSA mRNA levels in the diaphragm (FIG.13B).
  • the expression level of the HSA 220 CUG repeats may not be sufficient for the mis-splicing phenotype in DM1 in the diaphragm.
  • mDSI cycle threshold
  • the mouse DM1 splicing index (mDSI) for the quadriceps, the gastrocnemius, the triceps, and the tibialis anterior are shown in FIG. 15A-15D.
  • EEV-PMO corrected DM1 relevant splicing defects (Atp2a1 exon 22, Nfix exon 7, Clcn1 exon 7a, Mbnl1 exon 5) at 1-week post injection in the quadriceps (FIG.
  • FIGS. 16A-B show images of tibialis anterior tissue of HSA-LR mice (FIG. 16A) and HSA-LR mice treated with EEV-PMO (FIG. 16B) stained for CUG foci (red) and nuclei (blue). Qualitative and quantitative assessment (FIG.
  • FIG. 17A-17D show a dose dependent response for PMO-EEV exposure in the quadriceps (FIG. 17A), triceps (FIG. 17B), heart (FIG. 17C), gastrocnemius (FIG. 17D), tibialis anterior (TA; FIG. 17F), liver (FIG. 17I), and kidney (FIG. 17J). No dose-dependent response was observed in the diaphragm (FIG.17G). The EEV-PMO was not detected in the brain except at the 60 mpk and 90 mpk dosage levels.
  • FIG.17K shows drug exposure of various tissues at the 60 mpk dosage level.
  • Myotonia Response A dose dependent myotonia reduction in HSA-LR mice 7 days after treatment with EEV-PMO-DM1-3at 15, 30, 60 and 90 mpk was observed (FIG. 18A). Myotonia is likely ameliorated one week after treatment with EEV-PMO-DM1-3. HSA-LR mice treated with a single dose of 90 mpk EEV-PMO-DM1-3 did not exhibit obvious signs of hind limb myotonia after induction.
  • RNAseq Data Analysis FIG.19A-19D show the results of a principal component analysis. Principal component analysis can be used to reveal the similarity between samples based on the distance matrix.
  • FIG. 20A is a heatmap showing differentially expressed genes (by Z-score) from three treatment groups: 1) WT mice; 2) HSA-LR mice; and 3) HSA-LR + EEV-PMO 221-1120 (60 mpk).
  • FIG.20B is a heatmap used to visualize the expression profile of 40 of the 43 genes found to have more than 7 CTG repeats from a BLAST analysis. Three of the CTG repeat gene found in the Blast analysis (Crb2, Hsd3b6, and Inhbe) were not included due to low reads number.
  • FIG. 21 shows a volcano plot of the global transcriptional change across the EEV-PMO treated group and the HSA-LA group. Each data point in the scatter plot represents a gene. The fold change of each gene is represented on the x-axis and the log10 of its adjusted p-value is on the y-axis. Genes with an adjusted p-value less than 0.05 and a fold change greater than 2 are indicated by red dots. These represent up-regulated genes. Genes with an adjusted p-value less than 0.05 and a fold change less than -2 are indicated by blue dots. These represent down-regulated genes.
  • FIGS. 23A-23D show the transcriptome data for various genes and various treatment groups.
  • FIGS. 24 show the percent spliced (PSI) of individual exons for various genes.
  • the genes are MBNL-1 responsive splicing biomarkers (e.g., downstream genes). The choice of MBNL-1 dependent biomarkers was selected based on the dynamic range between the wildtype and disease groups as described in the literature.
  • the HSA-LR+EEV-PMO 221-1120 treatment group showed correction for exon inclusion/exclusion for all of the 20 genes of interest including Mbnl1, Nfix, Atp2a1, Ldb3, Camk2g, Trim55, Fbox31, Slc8a3, Map3k4, Dctn4, Cacna1s, Ryr1, Slain2, Phka1, Ppp3cc, Ttn, Neb, lrrfip2, Rapgef1, and Vsp39.
  • PMO-EEV 221-1120 in a DM1 mouse model second DM1 mouse model
  • PMO-EEV DM1-3 (221-1120; see Example 4 for the sequence) was evaluated in a second DM1 mouse model using method similar to those described in Example 4.
  • RT-PCR was used to determine alternative splicing for specific genes (Atp2a1, Clcn1, Nfix, MBNL1).
  • Q-PCR was used to determine the reduction of mRNA level of actin-HSA after treatment.
  • LC-mass was used to determine drug level in quadricep, gastrocnemius, tibialis anterior, triceps, diaphragm, heart, kidney, liver, brain, and plasma. Myotonia reduction was recorded 7 days after treatment with the EEV-PMO-DM1-3 compound.
  • FIG.25A-25D are plots showing a decrease in drug level with 80 mpk EEV-PMO-DM1- 3 after 1 week to 8 weeks in the tibialis anterior (FIG. 25A), gastrocnemius (FIG.
  • EEV-PMO-DM1-3 60 mpk oligo, 80 mpk whole drug
  • FIG.26A-26B are plots showing a decrease in drug levels was observed with the single 80 mpk dose of EEV-PMO-DM1-3 after 1 week to 4 weeks, to 8 weeks, and to 12 weeks in the liver.
  • a relatively higher amount of EEV-PMO-DM1-3 in the liver was observed 2 weeks post the last dose of the 6-week dosing regime when compared to 4 weeks post the single dose regime.
  • FIG.26C-26D shows a decrease in drug levels was observed with the single 80 mpk dose of EEV- PMO-DM1-3 after 1 week to 4 weeks, to 8 weeks, and to 12 weeks in the kidney.
  • a relatively low amount of EEV-PMO-DM1-3 in the kidney was also observed from 2 weeks post the last dose of the 6-week dosing regime when compared to 4 weeks post the single dose regime.
  • the drug was still present in the kidney but not in the liver.
  • mice treated with the single 80 mpk dose There was a mixed effect on myotonia in mice treated with the single 80 mpk dose that disappeared by 12 weeks post treatment.
  • Eight-week-old HSA-LR mice were treated with 40 mpk, 60 mpk, 80 mpk, or 120 mpk of EEV-PMO-DM1-3 intravenously and tissues were harvested after 4 weeks to 12 weeks.
  • RT-PCR was used to determine alternative splicing for specific genes (Atp2a1, Clcn1, Nfix, MBNL1). Myotonia reduction was recorded 7 days after treatment with EEV-PMO-DM1-3. Similar trends to those observed in Example 4 were observed for the rescue of splicing for Atp2a1, Clcn1, Nfix, and MBNL1 in the tibialis anterior gastrocnemius tissues (data not shown). [0685] Subjective myotonia observations were made and shown in Table 16. Females displayed more myotonia than males. There are no signs of myotonia in both male and female mice dosed with 120 mpk after 8 weeks post treatment. Table 16. Myotonia Observations Example 6.
  • FIG. 27A-27C are plots showing that EEV-PMO-DM1-3 promotes significant biomarker splicing correction (MBLN1, SOS1, and NFIX) in DM1 patient-derived muscle cells. Additionally, treatment with DM1-3 resulted in the reduction of nuclear foci in DM1 patient- derived muscle cells (FIG.28A-28C).
  • FIG.29A-29B show that PMO-DM1 or its conjugated EEV-PMO-DM1-3 did not show any toxicity even with the highest concentration of 817 ⁇ M or 797 ⁇ M, respectively.
  • EEV 1113 is Ac-PKKKRKV-miniPEG- K(cyclo(Ff-Nal-GrGrQ)-PEG12-OH (Ac-(SEQ ID NO: 42)-miniPEG-K(cyclo(SEQ ID NO: 80)- PEG12-OH).
  • EEV-PMO 221-1113 is EEV 1113 conjugated to PMO sequence 221 (5’-CAG CAG CAG CAG CAG CAG CAG-3’ (SEQ ID NO: 154; all PMO monomers) via amide bond chemistry.
  • Experimental. Methods similar to those described in Example 1 and Example 3 were used.
  • Results. [0695] RNA CUG Foci analysis. Cells were stained for nuclei (Hoeschet, blue) and for RNA CUG repeat foci (green) and imaged. A reduction in RNA CUG foci was observed between untreated DM1 patient cells and EEV-PMO treated DM1 cells (FIG. 30A-30C).
  • RNA CUG foci was observed between untreated HeLa-480 cells and EEV-PMO HeLa-480 cells (FIG.31A-31B).
  • PMO-EEV treated DM1 patient derived cells and HeLa-480 cells were analyzed for percent exon 5 inclusion for MBLN1, percent exon 25 inclusion for SOS1, and percent inclusion of exon 7 for NFIX.
  • Treatment with EEV-PMO resulted in a rescue of splicing events for Mbnl1 (FIG. 32A), Sos1 (FIG.32B), and NFIX (FIG.32C).
  • EEV-PMO showed a dose dependent correction of MBNL1 (FIG. 33A) splicing and the downstream missplicings of SOS1 (FIG. 33B), CLASP1 (FIG.33C), NFIX (FIG. 33D), and INSR (FIG. 33E) in a dose dependent manner.
  • HSA-LR Human skeletal actin long repeat
  • FIGS. 34A-34D show a dose dependent correction of the inclusion of exon 22 in Atp2a1 (FIG. 34A), exon 7 in Nfix (FIG. 34B), exon 7A in Clcn1 (FIG. 34C), and Mbnl1 (FIG. 34D) in the gastrocnemius of mice treated with various concentrations of EEV-PMO 221-1106. Treatment with PMO 221 alone did not result in correction of splicing.
  • Example 10
  • DM1 mouse model to study effect of different lengths of CUG repeats in PMOs [0701]
  • a DM1 mouse model was done to study the effect of PMO-EEV 221-1121 (PMO has7 CAG repeats, 21-mer) and PMO-EEV 0325-1121 (PMO has 8 CAG repeats, 24-mer) on the splicing and mRNA levels of downstream genes.
  • PMO-EEV 221-1121 is PMO 221 (5’-CAG CAG CAG CAG CAG CAG-3’; SEQ ID NO: 154; all PMO monomers) conjugated to EEV 1121 (Ac-PKKKRKV-miniPEG2-Lys(cyclo[GfFGrGrQ])-PEG12-OH; Ac-(SEQ ID NO: 42)- miniPEG2-Lys(SEQ ID NO:74)-PEG12-OH ) via amide chemistry.
  • PMO-EEV 0325-1121 is PMO 0325 (5’-CAG CAG CAG CAG CAG CAG CAG CAG-CAG-3’; SEQ ID NO: 155; all PMO monomers) conjugated to EEV 1121 via amide chemistry.
  • HSA-LR Human skeletal actin long repeat
  • 0221-1121 (21-mer) was more effective in correcting exon splicing in Mbnl1 (FIG. 35A), Nfix (FIG. 35B), and Atp2a1 (FIG. 35C) than 0325-1121 (24-mer) in the tibialis anterior tissue. This result was unexpected. It was expected that the 24-mer would be more effective as it would have a higher hybridization efficiency and higher thermal melting temperature. In the gastrocnemius tissue, the differences were less pronounced as shown in FIGS. 36A-36C. Subjective myotonia observations were made using the male mice (Table 17). Mixed myotonia was observed at 1 week post treatment for the 21-mer at 40 mpk, similar to the results in Table 11.
  • the AUC values for the metabolite is ⁇ 1000-fold lower in the tibias anterior compared to the kidney.
  • the metabolite mean residence time (MRT) values in plasma may be directly related to tissue MRT values as a result of moving from tissues to plasma before urinary excretion.
  • Table 18 Plasma pharmacokinetic properties
  • Table 19 Kidney pharmacokinetic properties
  • Table 20 Tibialis anterior pharmacokinetic properties Example 12. Evaluation of PMO-EEV 221-1120 in a third DM1 mouse model
  • a DM1 mouse model study similar to Examples 5 and 9 was conducted to evaluate the effect of various doses of PMO-EEV 221-220 (see Example 4 for the sequence) in HSA-LR mice. [0709] Experimental.
  • HSA-LR mice Eight-week-old HSA-LR mice were administered 40, 60, 80 or 120 mpk of PMO-EEV 221-1120 intravenously and tissues were harvested after 4 to 12 weeks.
  • RT-PCR was used to determine alternative splicing for specific genes (Atp2a1, Clcn1, Nfix, MBNL1).
  • LC- mass was used to determine drug level in Quad, gastro, TA, Triceps, diaphragm, heart, kidney, liver, brain, plasma.
  • RNA-seq was used to determine the transcription level change between a treated disease model, an untreated disease model and wild-type.
  • Q-PCR was used to determine the reduction of mRNA level of actin-HSA after treatment. [0710] Results.
  • MBNL1, NFIX, and ATP2A1splicing correction was observed in both the tibialis anterior and gastrocnemius 12 weeks post treatment with 120 mpk EEV-PMO.
  • Example 13 Evaluation of EEV-PMO 221-1120 in HeLa480 cells [0712] HeLa480 cells were treated with various concentrations of EEV-PMO 221-1120 (see Example 4 for the sequence) and analyzed for CUG repeat foci, selective r(CUG) reduction, and downstream splicing correction of MBNL1 and SOS1. [0713] Experimental. Hela480 cells were constructed as described in earlier Examples. RT-PCR and foci staining was performed similar to other Examples described herein. [0714] Results.
  • FIG.41A-41B shows example images of control cells (untreated) and cells treated with 5 ⁇ M, 10 ⁇ M, 20 ⁇ M, 50 ⁇ M, and 100 ⁇ M of EEV-PMO 221-1120. There is a reduction in CUG foci (green) in the treated HeLa480 group when compared to the untreated HeLa480 cells.
  • FIG.41B is a plot quantifying the foci per nuclear area.
  • FIG.41A-41B show that EEV-PMO 221- 1120 can reduce nuclear CUG RNA foci. Almost a complete reduction is observed in the 5 ⁇ M dose. [0715]
  • FIG.41A-41B shows example images of control cells (untreated) and cells treated with 5 ⁇ M, 10 ⁇ M, 20 ⁇ M, 50 ⁇ M, and 100 ⁇ M of EEV-PMO 221-1120. There is a reduction in CUG foci (green) in the treated HeLa480 group when compared to the untreated HeLa480 cells.
  • FIG. 42A-42B indicate the EEV-PMO 221-1120 treatment can selectively knockdown repeat expansion-containing DMPK transcript in the HeLa480 cell line.
  • FIG. 42C-42D show that treatment with EEV-PMO 221-1120 corrected MBNL1 (FIG. 42C) and SOCS1 (FIG.42D) splicing in a dose dependent manner.
  • FIG. 42C show that treatment with EEV-PMO 221-1120 corrected MBNL1 (FIG. 42C) and SOCS1 (FIG.42D) splicing in a dose dependent manner.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Neurology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physics & Mathematics (AREA)
  • Neurosurgery (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
EP22744043.5A 2021-06-23 2022-06-22 Antisense compounds and methods for targeting cug repeats Pending EP4359006A1 (en)

Applications Claiming Priority (16)

Application Number Priority Date Filing Date Title
US202163213900P 2021-06-23 2021-06-23
US202163239671P 2021-09-01 2021-09-01
US202163239847P 2021-09-01 2021-09-01
US202163290960P 2021-12-17 2021-12-17
US202163290892P 2021-12-17 2021-12-17
US202263298565P 2022-01-11 2022-01-11
US202263305071P 2022-01-31 2022-01-31
US202263268577P 2022-02-25 2022-02-25
US202263314369P 2022-02-26 2022-02-26
US202263316634P 2022-03-04 2022-03-04
US202263317856P 2022-03-08 2022-03-08
US202263362295P 2022-03-31 2022-03-31
US202263326201P 2022-03-31 2022-03-31
US202263327179P 2022-04-04 2022-04-04
US202263339250P 2022-05-06 2022-05-06
PCT/US2022/034517 WO2022271818A1 (en) 2021-06-23 2022-06-22 Antisense compounds and methods for targeting cug repeats

Publications (1)

Publication Number Publication Date
EP4359006A1 true EP4359006A1 (en) 2024-05-01

Family

ID=82608300

Family Applications (1)

Application Number Title Priority Date Filing Date
EP22744043.5A Pending EP4359006A1 (en) 2021-06-23 2022-06-22 Antisense compounds and methods for targeting cug repeats

Country Status (15)

Country Link
EP (1) EP4359006A1 (https=)
JP (1) JP2024524291A (https=)
KR (1) KR20240038967A (https=)
AU (1) AU2022298774A1 (https=)
CA (1) CA3222824A1 (https=)
CL (1) CL2023003840A1 (https=)
CO (1) CO2023018002A2 (https=)
DO (1) DOP2023000279A (https=)
EC (1) ECSP23096162A (https=)
GE (1) GEAP202416440A (https=)
IL (1) IL309001A (https=)
JO (1) JOP20230327A1 (https=)
MX (1) MX2023015509A (https=)
PE (1) PE20242357A1 (https=)
WO (1) WO2022271818A1 (https=)

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023219933A1 (en) * 2022-05-09 2023-11-16 Entrada Therapeutics, Inc. Compositions and methods for delivery of nucleic acid therapeutics
GB2628421A (en) * 2023-03-24 2024-09-25 Syntherix Ltd Peptides and uses thereof
WO2024263649A1 (en) * 2023-06-19 2024-12-26 Yale University Methods and compositions for enrichment and sequencing of expansion-specific rna transcripts
WO2025038901A1 (en) * 2023-08-17 2025-02-20 Entrada Therapeutics, Inc. Cyclic peptides for delivering therapeutics
WO2025072246A1 (en) * 2023-09-26 2025-04-03 Entrada Therapeutics, Inc. Compounds and methods for skipping exon 50 in duchenne muscular dystrophy
WO2025137623A1 (en) * 2023-12-22 2025-06-26 Iris Medicine, Inc. Methods and compositions for treating ctg repeat expansion diseases
EP4692348A1 (en) * 2024-08-07 2026-02-11 Nocturna Therapeutics SL Artificial rnas for treating repeat expansion disorders

Family Cites Families (85)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5118800A (en) 1983-12-20 1992-06-02 California Institute Of Technology Oligonucleotides possessing a primary amino group in the terminal nucleotide
FR2567892B1 (fr) 1984-07-19 1989-02-17 Centre Nat Rech Scient Nouveaux oligonucleotides, leur procede de preparation et leurs applications comme mediateurs dans le developpement des effets des interferons
US4987071A (en) 1986-12-03 1991-01-22 University Patents, Inc. RNA ribozyme polymerases, dephosphorylases, restriction endoribonucleases and methods
CA1340323C (en) 1988-09-20 1999-01-19 Arnold E. Hampel Rna catalyst for cleaving specific rna sequences
AU637800B2 (en) 1989-08-31 1993-06-10 City Of Hope Chimeric dna-rna catalytic sequences
US5591722A (en) 1989-09-15 1997-01-07 Southern Research Institute 2'-deoxy-4'-thioribonucleosides and their antiviral activity
DE69034150T2 (de) 1989-10-24 2005-08-25 Isis Pharmaceuticals, Inc., Carlsbad 2'-Modifizierte Oligonukleotide
US5670633A (en) 1990-01-11 1997-09-23 Isis Pharmaceuticals, Inc. Sugar modified oligonucleotides that detect and modulate gene expression
US5646265A (en) 1990-01-11 1997-07-08 Isis Pharmceuticals, Inc. Process for the preparation of 2'-O-alkyl purine phosphoramidites
GB9009980D0 (en) 1990-05-03 1990-06-27 Amersham Int Plc Phosphoramidite derivatives,their preparation and the use thereof in the incorporation of reporter groups on synthetic oligonucleotides
ES2116977T3 (es) 1990-05-11 1998-08-01 Microprobe Corp Soportes solidos para ensayos de hibridacion de acidos nucleicos y metodos para inmovilizar oligonucleotidos de modo covalente.
US6365730B1 (en) 1990-06-19 2002-04-02 Gene Shears Pty. Limited DNA-Armed ribozymes and minizymes
ES2061416T3 (es) 1990-10-12 1997-03-01 Max Planck Gesellschaft Ribozimas modificadas.
DE4216134A1 (de) 1991-06-20 1992-12-24 Europ Lab Molekularbiolog Synthetische katalytische oligonukleotidstrukturen
EP0538194B1 (de) 1991-10-17 1997-06-04 Novartis AG Bicyclische Nukleoside, Oligonukleotide, Verfahren zu deren Herstellung und Zwischenprodukte
US5359044A (en) 1991-12-13 1994-10-25 Isis Pharmaceuticals Cyclobutyl oligonucleotide surrogates
US5652094A (en) 1992-01-31 1997-07-29 University Of Montreal Nucleozymes
FR2687679B1 (fr) 1992-02-05 1994-10-28 Centre Nat Rech Scient Oligothionucleotides.
EP0642589A4 (en) 1992-05-11 1997-05-21 Ribozyme Pharm Inc METHOD AND REAGENT TO INHIBIT VIRAL REPLICATION.
EP0577558A2 (de) 1992-07-01 1994-01-05 Ciba-Geigy Ag Carbocyclische Nukleoside mit bicyclischen Ringen, Oligonukleotide daraus, Verfahren zu deren Herstellung, deren Verwendung und Zwischenproduckte
EP0786522A2 (en) 1992-07-17 1997-07-30 Ribozyme Pharmaceuticals, Inc. Enzymatic RNA molecules for treatment of stenotic conditions
JPH08504559A (ja) 1992-12-14 1996-05-14 ハネウエル・インコーポレーテッド 個別に制御される冗長巻線を有するモータシステム
CA2159631A1 (en) 1993-03-30 1994-10-13 Sanofi Acyclic nucleoside analogs and oligonucleotide sequences containing them
DE4311944A1 (de) 1993-04-10 1994-10-13 Degussa Umhüllte Natriumpercarbonatpartikel, Verfahren zu deren Herstellung und sie enthaltende Wasch-, Reinigungs- und Bleichmittelzusammensetzungen
US5446137B1 (en) 1993-12-09 1998-10-06 Behringwerke Ag Oligonucleotides containing 4'-substituted nucleotides
US5519134A (en) 1994-01-11 1996-05-21 Isis Pharmaceuticals, Inc. Pyrrolidine-containing monomers and oligomers
US5631359A (en) 1994-10-11 1997-05-20 Ribozyme Pharmaceuticals, Inc. Hairpin ribozymes
US5627053A (en) 1994-03-29 1997-05-06 Ribozyme Pharmaceuticals, Inc. 2'deoxy-2'-alkylnucleotide containing nucleic acid
US5597909A (en) 1994-08-25 1997-01-28 Chiron Corporation Polynucleotide reagents containing modified deoxyribose moieties, and associated methods of synthesis and use
WO1996011266A2 (en) 1994-10-05 1996-04-18 Amgen Inc. Method for inhibiting smooth muscle cell proliferation and oligonucleotides for use therein
US5792747A (en) 1995-01-24 1998-08-11 The Administrators Of The Tulane Educational Fund Highly potent agonists of growth hormone releasing hormone
US20080119427A1 (en) 1996-06-06 2008-05-22 Isis Pharmaceuticals, Inc. Double Strand Compositions Comprising Differentially Modified Strands for Use in Gene Modulation
JP3756313B2 (ja) 1997-03-07 2006-03-15 武 今西 新規ビシクロヌクレオシド及びオリゴヌクレオチド類縁体
US6770748B2 (en) 1997-03-07 2004-08-03 Takeshi Imanishi Bicyclonucleoside and oligonucleotide analogue
JP4236812B2 (ja) 1997-09-12 2009-03-11 エクシコン エ/エス オリゴヌクレオチド類似体
US6794499B2 (en) 1997-09-12 2004-09-21 Exiqon A/S Oligonucleotide analogues
US6043352A (en) 1998-08-07 2000-03-28 Isis Pharmaceuticals, Inc. 2'-O-Dimethylaminoethyloxyethyl-modified oligonucleotides
JP2002535247A (ja) 1998-11-26 2002-10-22 ペンタファルム アクチェンゲゼルシャフト 輸送系複合体
ES2234563T5 (es) 1999-02-12 2018-01-17 Daiichi Sankyo Company, Limited Nuevos análogos de nucleósidos y oligonucleótidos
US7084125B2 (en) 1999-03-18 2006-08-01 Exiqon A/S Xylo-LNA analogues
US7053207B2 (en) 1999-05-04 2006-05-30 Exiqon A/S L-ribo-LNA analogues
US6525191B1 (en) 1999-05-11 2003-02-25 Kanda S. Ramasamy Conformationally constrained L-nucleosides
JP4151751B2 (ja) 1999-07-22 2008-09-17 第一三共株式会社 新規ビシクロヌクレオシド類縁体
EP1235914A2 (en) 1999-11-24 2002-09-04 Joseph Rosenecker Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
EP1191097A1 (en) 2000-09-21 2002-03-27 Leids Universitair Medisch Centrum Induction of exon skipping in eukaryotic cells
US7033597B2 (en) 2000-10-13 2006-04-25 Université de Lausanne Intracellular delivery of biological effectors
US7034109B2 (en) 2000-10-13 2006-04-25 Christophe Bonny Intracellular delivery of biological effectors
US7569575B2 (en) 2002-05-08 2009-08-04 Santaris Pharma A/S Synthesis of locked nucleic acid derivatives
US20040219565A1 (en) 2002-10-21 2004-11-04 Sakari Kauppinen Oligonucleotides useful for detecting and analyzing nucleic acids of interest
WO2004041889A2 (en) 2002-11-05 2004-05-21 Isis Pharmaceuticals, Inc. Polycyclic sugar surrogate-containing oligomeric compounds and compositions for use in gene modulation
AU2003225410A1 (en) 2003-03-21 2004-10-11 Academisch Ziekenhuis Leiden Modulation of exon recognition in pre-mrna by interfering with the secondary rna structure
EP1661905B9 (en) 2003-08-28 2012-12-19 IMANISHI, Takeshi Novel artificial nucleic acids of n-o bond crosslinkage type
US7523096B2 (en) 2003-12-03 2009-04-21 Google Inc. Methods and systems for personalized network searching
WO2006112705A2 (en) 2005-04-22 2006-10-26 Academisch Ziekenhuis Leiden Modulation of exon recognition in pre-mrna by interfering with the binding of sr proteins and by interfering with secondary rna structure.
WO2007090071A2 (en) 2006-01-27 2007-08-09 Isis Pharmaceuticals, Inc. 6-modified bicyclic nucleic acid analogs
WO2007095387A2 (en) 2006-02-17 2007-08-23 Dharmacon, Inc. Compositions and methods for inhibiting gene silencing by rna interference
WO2007123391A1 (en) 2006-04-20 2007-11-01 Academisch Ziekenhuis Leiden Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene.
EP1857548A1 (en) 2006-05-19 2007-11-21 Academisch Ziekenhuis Leiden Means and method for inducing exon-skipping
AU2007299705B2 (en) 2006-09-22 2012-09-06 Dharmacon, Inc. Duplex oligonucleotide complexes and methods for gene silencing by RNA interference
ES2526295T5 (es) 2006-10-18 2021-05-04 Ionis Pharmaceuticals Inc Compuestos antisentido
US20100016215A1 (en) 2007-06-29 2010-01-21 Avi Biopharma, Inc. Compound and method for treating myotonic dystrophy
ES2639852T3 (es) 2007-10-26 2017-10-30 Academisch Ziekenhuis Leiden Medios y métodos para contrarrestar los trastornos musculares
EP2119783A1 (en) 2008-05-14 2009-11-18 Prosensa Technologies B.V. Method for efficient exon (44) skipping in Duchenne Muscular Dystrophy and associated means
CA2758189C (en) 2009-04-10 2020-12-29 Association Institut De Myologie Tricyclo-dna antisense oligonucleotides, compositions, and methods for the treatment of disease
US20110269665A1 (en) 2009-06-26 2011-11-03 Avi Biopharma, Inc. Compound and method for treating myotonic dystrophy
US9161948B2 (en) 2011-05-05 2015-10-20 Sarepta Therapeutics, Inc. Peptide oligonucleotide conjugates
EP2900821B1 (en) * 2012-09-25 2020-04-01 Genzyme Corporation Peptide-linked morpholino antisense oligonucleotides for treatment of myotonic dystrophy
US20140310830A1 (en) 2012-12-12 2014-10-16 Feng Zhang CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes
CN113355357B (zh) 2012-12-12 2024-12-03 布罗德研究所有限公司 对用于序列操纵的改进的系统、方法和酶组合物进行的工程化和优化
EP2840140B2 (en) 2012-12-12 2023-02-22 The Broad Institute, Inc. Crispr-Cas based method for mutation of prokaryotic cells
IL239344B2 (en) 2012-12-12 2024-06-01 Broad Inst Inc Systems engineering, methods and optimal guiding components for sequence manipulation
US8697359B1 (en) 2012-12-12 2014-04-15 The Broad Institute, Inc. CRISPR-Cas systems and methods for altering expression of gene products
WO2014093655A2 (en) 2012-12-12 2014-06-19 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
JP6712948B2 (ja) 2013-12-12 2020-06-24 ザ・ブロード・インスティテュート・インコーポレイテッド 組成物、及びヌクレオチドリピート障害におけるcrispr−cas系の使用方法
ES2905181T3 (es) 2015-05-01 2022-04-07 Prec Biosciences Inc Deleción precisa de secuencias cromosómicas in vivo
EP3359667A1 (en) 2015-10-05 2018-08-15 ProQR Therapeutics II B.V. Use of single-stranded antisense oligonucleotide in prevention or treatment of genetic diseases involving a trinucleotide repeat expansion
JP6657520B2 (ja) 2016-02-03 2020-03-04 株式会社神戸製鋼所 タイヤ試験装置のタイヤ空気充填機構及びタイヤ空気充填方法
KR20170130253A (ko) 2016-05-18 2017-11-28 에스케이텔레콤 주식회사 적응형 스트리밍 서비스 제공 방법 및 이를 위한 장치
US10265249B2 (en) 2016-09-29 2019-04-23 The Procter & Gamble Company Fibrous structures comprising glyceride copolymers
KR20190077568A (ko) 2016-11-16 2019-07-03 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 CRISPR-Cas9의 억제제
KR20180102871A (ko) 2017-03-08 2018-09-18 엘지전자 주식회사 이동단말기 및 이동단말기의 차량 제어 방법
WO2018165541A1 (en) 2017-03-10 2018-09-13 The Board Of Regents Of The University Of Texas System Treatment of fuchs' endothelial corneal dystrophy
WO2019165183A1 (en) * 2018-02-22 2019-08-29 Entrada Therapeutics, Inc. Compositions and methods for treating mitochondrial neurogastrointestinal encephalopathy
GB201812972D0 (en) * 2018-08-09 2018-09-26 Univ Oxford Innovation Ltd Cell-penetrating peptides
EP4058032A4 (en) * 2019-12-19 2024-01-10 Entrada Therapeutics, Inc. Compositions for delivery of antisense compounds

Also Published As

Publication number Publication date
CO2023018002A2 (es) 2024-02-05
IL309001A (en) 2024-02-01
ECSP23096162A (es) 2024-03-01
MX2023015509A (es) 2024-01-22
CL2023003840A1 (es) 2024-07-12
CA3222824A1 (en) 2022-12-29
DOP2023000279A (es) 2024-04-30
JP2024524291A (ja) 2024-07-05
AU2022298774A1 (en) 2023-12-14
GEAP202416440A (en) 2024-04-25
JOP20230327A1 (ar) 2023-12-21
KR20240038967A (ko) 2024-03-26
WO2022271818A1 (en) 2022-12-29
PE20242357A1 (es) 2024-12-16

Similar Documents

Publication Publication Date Title
EP4359006A1 (en) Antisense compounds and methods for targeting cug repeats
US20230020092A1 (en) Compositions for delivery of antisense compounds
US20240247259A1 (en) Compositions and methods for modulating gene expression
KR20240009393A (ko) 사이클릭 세포 침투 펩티드
US20250312422A1 (en) Compositions and methods for facilitating delivery of synthetic nucleic acids to cells
US20240417429A1 (en) Compositions and methods for skipping exon 45 in duchenne muscular dystrophy
US20180312839A1 (en) Methods and compositions for increasing smn expression
US20250051780A1 (en) COMPOSITIONS AND METHODS FOR MODULATING mRNA SPLICING
KR20240012425A (ko) 세포내 치료제를 위한 조성물 및 방법
TW201143780A (en) Treatment of Colony-stimulating factor 3 (CSF3) related diseases by inhibition of natural antisense transcript to CSF3
US20250129365A1 (en) Compounds and methods for skipping exon 44 in duchenne muscular dystrophy
WO2025072246A9 (en) Compounds and methods for skipping exon 50 in duchenne muscular dystrophy
CN117957022A (zh) 用于靶向cug重复序列的反义化合物和方法
US20250011774A1 (en) Antisense compounds and methods for targeting cug repeats
US20250051393A1 (en) Compositions and methods for modulating interferon regulatory factor-5 (irf-5) activity
OA21931A (en) Antisense compounds and methods for targeting CUG repeats.
RU2848055C2 (ru) Соединения и способы пропуска экзона 44 при мышечной дистрофии дюшенна
RU2847465C2 (ru) Композиции и способы пропуска экзона 45 при мышечной дистрофии дюшенна
CN117915957A (zh) 用于调节mRNA剪接的组合物和方法
CN118215504A (zh) 用于跳跃杜兴氏肌营养不良中的外显子44的化合物和方法
BR112018012304B1 (pt) Oligonucleotídeo, seu uso para o tratamento de uma doença associada à tau, e composição

Legal Events

Date Code Title Description
STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: UNKNOWN

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE

PUAI Public reference made under article 153(3) epc to a published international application that has entered the european phase

Free format text: ORIGINAL CODE: 0009012

STAA Information on the status of an ep patent application or granted ep patent

Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE

17P Request for examination filed

Effective date: 20240122

AK Designated contracting states

Kind code of ref document: A1

Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR

REG Reference to a national code

Ref country code: HK

Ref legal event code: DE

Ref document number: 40109927

Country of ref document: HK