EP4121105A1 - Vaccins formés par conjugaison de virus et d'antigène - Google Patents
Vaccins formés par conjugaison de virus et d'antigèneInfo
- Publication number
- EP4121105A1 EP4121105A1 EP21793816.6A EP21793816A EP4121105A1 EP 4121105 A1 EP4121105 A1 EP 4121105A1 EP 21793816 A EP21793816 A EP 21793816A EP 4121105 A1 EP4121105 A1 EP 4121105A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- antigen
- virus
- vaccine
- tmv
- rbd
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 239000000427 antigen Substances 0.000 title claims abstract description 586
- 102000036639 antigens Human genes 0.000 title claims abstract description 566
- 108091007433 antigens Proteins 0.000 title claims abstract description 566
- 241000700605 Viruses Species 0.000 title claims abstract description 425
- 229960005486 vaccine Drugs 0.000 title claims abstract description 301
- 230000021615 conjugation Effects 0.000 title abstract description 155
- 239000002245 particle Substances 0.000 claims abstract description 77
- 241000711573 Coronaviridae Species 0.000 claims abstract description 53
- 244000052769 pathogen Species 0.000 claims abstract description 19
- 241000723873 Tobacco mosaic virus Species 0.000 claims description 339
- 230000027455 binding Effects 0.000 claims description 83
- 102000005962 receptors Human genes 0.000 claims description 54
- 108020003175 receptors Proteins 0.000 claims description 54
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 50
- 206010022000 influenza Diseases 0.000 claims description 35
- 238000003860 storage Methods 0.000 claims description 26
- 101710198474 Spike protein Proteins 0.000 claims description 25
- 230000004927 fusion Effects 0.000 claims description 25
- 229940096437 Protein S Drugs 0.000 claims description 19
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 claims description 16
- 229940031348 multivalent vaccine Drugs 0.000 claims description 16
- 101710154606 Hemagglutinin Proteins 0.000 claims description 15
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims description 15
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims description 15
- 101710176177 Protein A56 Proteins 0.000 claims description 15
- 230000001717 pathogenic effect Effects 0.000 claims description 15
- 239000000185 hemagglutinin Substances 0.000 claims description 14
- 239000012634 fragment Substances 0.000 claims description 8
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 7
- 102000009109 Fc receptors Human genes 0.000 claims description 5
- 108010087819 Fc receptors Proteins 0.000 claims description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims 2
- 239000000203 mixture Substances 0.000 abstract description 77
- 238000000034 method Methods 0.000 abstract description 72
- 238000006243 chemical reaction Methods 0.000 abstract description 48
- 238000011282 treatment Methods 0.000 abstract description 19
- 201000010099 disease Diseases 0.000 abstract description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 11
- 150000001875 compounds Chemical class 0.000 abstract description 10
- 238000000746 purification Methods 0.000 description 98
- 241000196324 Embryophyta Species 0.000 description 96
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 75
- 108090000623 proteins and genes Proteins 0.000 description 74
- 241001465754 Metazoa Species 0.000 description 73
- 102000004169 proteins and genes Human genes 0.000 description 68
- 210000004027 cell Anatomy 0.000 description 61
- 235000018102 proteins Nutrition 0.000 description 61
- 230000028993 immune response Effects 0.000 description 55
- 238000004519 manufacturing process Methods 0.000 description 47
- 241000699670 Mus sp. Species 0.000 description 44
- 208000025721 COVID-19 Diseases 0.000 description 43
- 230000004044 response Effects 0.000 description 43
- 238000004458 analytical method Methods 0.000 description 41
- 239000000047 product Substances 0.000 description 41
- 230000000670 limiting effect Effects 0.000 description 40
- 239000000523 sample Substances 0.000 description 40
- 238000004062 sedimentation Methods 0.000 description 40
- 238000009472 formulation Methods 0.000 description 38
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 34
- 239000007924 injection Substances 0.000 description 34
- 238000002347 injection Methods 0.000 description 34
- 239000002671 adjuvant Substances 0.000 description 32
- 238000006386 neutralization reaction Methods 0.000 description 31
- 230000003472 neutralizing effect Effects 0.000 description 31
- 238000012360 testing method Methods 0.000 description 30
- 230000003612 virological effect Effects 0.000 description 28
- 150000001413 amino acids Chemical group 0.000 description 27
- 230000005847 immunogenicity Effects 0.000 description 27
- 230000001965 increasing effect Effects 0.000 description 27
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 27
- 238000009826 distribution Methods 0.000 description 26
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 26
- 208000015181 infectious disease Diseases 0.000 description 24
- 239000000872 buffer Substances 0.000 description 23
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 22
- 238000003556 assay Methods 0.000 description 22
- 239000012535 impurity Substances 0.000 description 22
- 238000002965 ELISA Methods 0.000 description 21
- 239000000919 ceramic Substances 0.000 description 21
- 241000282339 Mustela Species 0.000 description 20
- 238000010790 dilution Methods 0.000 description 20
- 239000012895 dilution Substances 0.000 description 20
- 238000002255 vaccination Methods 0.000 description 20
- 230000008901 benefit Effects 0.000 description 19
- 230000000694 effects Effects 0.000 description 19
- 239000000463 material Substances 0.000 description 19
- 239000011148 porous material Substances 0.000 description 19
- 210000002966 serum Anatomy 0.000 description 19
- 241000283973 Oryctolagus cuniculus Species 0.000 description 18
- 208000037797 influenza A Diseases 0.000 description 18
- 229940031351 tetravalent vaccine Drugs 0.000 description 18
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 17
- 239000000284 extract Substances 0.000 description 17
- 238000003917 TEM image Methods 0.000 description 16
- 230000033228 biological regulation Effects 0.000 description 16
- 239000012466 permeate Substances 0.000 description 16
- 210000001519 tissue Anatomy 0.000 description 16
- 238000001262 western blot Methods 0.000 description 16
- 238000011018 current good manufacturing practice Methods 0.000 description 15
- 238000001914 filtration Methods 0.000 description 15
- 239000012528 membrane Substances 0.000 description 15
- 239000002953 phosphate buffered saline Substances 0.000 description 15
- 230000008569 process Effects 0.000 description 15
- 241000127282 Middle East respiratory syndrome-related coronavirus Species 0.000 description 14
- 229950006323 angiotensin ii Drugs 0.000 description 14
- 238000013459 approach Methods 0.000 description 14
- 230000003053 immunization Effects 0.000 description 14
- 238000002649 immunization Methods 0.000 description 14
- 229960003971 influenza vaccine Drugs 0.000 description 14
- 210000000056 organ Anatomy 0.000 description 14
- 239000000126 substance Substances 0.000 description 14
- 231100000041 toxicology testing Toxicity 0.000 description 14
- CUKWUWBLQQDQAC-VEQWQPCFSA-N (3s)-3-amino-4-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s,3s)-1-[[(2s)-1-[(2s)-2-[[(1s)-1-carboxyethyl]carbamoyl]pyrrolidin-1-yl]-3-(1h-imidazol-5-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-3-methyl-1-ox Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C1=CC=C(O)C=C1 CUKWUWBLQQDQAC-VEQWQPCFSA-N 0.000 description 13
- 102000005862 Angiotensin II Human genes 0.000 description 13
- 101800000733 Angiotensin-2 Proteins 0.000 description 13
- 229940124894 Fluzone Drugs 0.000 description 13
- 241001529936 Murinae Species 0.000 description 13
- 230000010530 Virus Neutralization Effects 0.000 description 13
- 230000002378 acidificating effect Effects 0.000 description 13
- 230000014509 gene expression Effects 0.000 description 13
- 230000009257 reactivity Effects 0.000 description 13
- 230000009467 reduction Effects 0.000 description 13
- 241000712461 unidentified influenza virus Species 0.000 description 13
- 241001678559 COVID-19 virus Species 0.000 description 12
- 230000004913 activation Effects 0.000 description 12
- 238000004587 chromatography analysis Methods 0.000 description 12
- 239000006167 equilibration buffer Substances 0.000 description 12
- 238000011049 filling Methods 0.000 description 12
- 239000000543 intermediate Substances 0.000 description 12
- 239000000178 monomer Substances 0.000 description 12
- 239000000902 placebo Substances 0.000 description 12
- 229940068196 placebo Drugs 0.000 description 12
- 239000012465 retentate Substances 0.000 description 12
- 238000000926 separation method Methods 0.000 description 12
- 235000015724 Trifolium pratense Nutrition 0.000 description 11
- 235000001014 amino acid Nutrition 0.000 description 11
- 230000001413 cellular effect Effects 0.000 description 11
- 238000002296 dynamic light scattering Methods 0.000 description 11
- 230000002779 inactivation Effects 0.000 description 11
- 238000002360 preparation method Methods 0.000 description 11
- 235000013526 red clover Nutrition 0.000 description 11
- 239000013638 trimer Substances 0.000 description 11
- 239000013603 viral vector Substances 0.000 description 11
- 229940022962 COVID-19 vaccine Drugs 0.000 description 10
- 230000001419 dependent effect Effects 0.000 description 10
- 239000000499 gel Substances 0.000 description 10
- 238000011534 incubation Methods 0.000 description 10
- 238000007918 intramuscular administration Methods 0.000 description 10
- 150000007523 nucleic acids Chemical class 0.000 description 10
- 230000004083 survival effect Effects 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 102000008946 Fibrinogen Human genes 0.000 description 9
- 108010049003 Fibrinogen Proteins 0.000 description 9
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 9
- 241000315672 SARS coronavirus Species 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- 230000008045 co-localization Effects 0.000 description 9
- 230000000120 cytopathologic effect Effects 0.000 description 9
- 229940012952 fibrinogen Drugs 0.000 description 9
- 238000005342 ion exchange Methods 0.000 description 9
- 210000002540 macrophage Anatomy 0.000 description 9
- 238000002156 mixing Methods 0.000 description 9
- 238000011084 recovery Methods 0.000 description 9
- 239000011780 sodium chloride Substances 0.000 description 9
- 239000000243 solution Substances 0.000 description 9
- 238000011725 BALB/c mouse Methods 0.000 description 8
- 101710132601 Capsid protein Proteins 0.000 description 8
- 101710094648 Coat protein Proteins 0.000 description 8
- 101710125418 Major capsid protein Proteins 0.000 description 8
- 101710141454 Nucleoprotein Proteins 0.000 description 8
- 101710083689 Probable capsid protein Proteins 0.000 description 8
- 239000000969 carrier Substances 0.000 description 8
- 238000001514 detection method Methods 0.000 description 8
- 231100000673 dose–response relationship Toxicity 0.000 description 8
- 230000012010 growth Effects 0.000 description 8
- 230000002163 immunogen Effects 0.000 description 8
- 238000011068 loading method Methods 0.000 description 8
- 210000004962 mammalian cell Anatomy 0.000 description 8
- 230000007170 pathology Effects 0.000 description 8
- 239000013612 plasmid Substances 0.000 description 8
- 230000002829 reductive effect Effects 0.000 description 8
- 241000894007 species Species 0.000 description 8
- 229940125575 vaccine candidate Drugs 0.000 description 8
- 108091026890 Coding region Proteins 0.000 description 7
- 102100021181 Golgi phosphoprotein 3 Human genes 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 7
- 238000011156 evaluation Methods 0.000 description 7
- 239000013613 expression plasmid Substances 0.000 description 7
- 239000000835 fiber Substances 0.000 description 7
- 230000002068 genetic effect Effects 0.000 description 7
- 238000001764 infiltration Methods 0.000 description 7
- 238000011081 inoculation Methods 0.000 description 7
- 238000004255 ion exchange chromatography Methods 0.000 description 7
- 239000003446 ligand Substances 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 239000003550 marker Substances 0.000 description 7
- 229940031346 monovalent vaccine Drugs 0.000 description 7
- 238000012433 multimodal chromatography Methods 0.000 description 7
- 230000007935 neutral effect Effects 0.000 description 7
- 238000012545 processing Methods 0.000 description 7
- 230000035899 viability Effects 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 108020004414 DNA Proteins 0.000 description 6
- 241000238631 Hexapoda Species 0.000 description 6
- 238000011887 Necropsy Methods 0.000 description 6
- 150000001412 amines Chemical class 0.000 description 6
- 230000005875 antibody response Effects 0.000 description 6
- 230000015572 biosynthetic process Effects 0.000 description 6
- 210000004369 blood Anatomy 0.000 description 6
- 239000008280 blood Substances 0.000 description 6
- 230000036760 body temperature Effects 0.000 description 6
- 230000037396 body weight Effects 0.000 description 6
- 239000013622 capto Q Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 229930002875 chlorophyll Natural products 0.000 description 6
- 235000019804 chlorophyll Nutrition 0.000 description 6
- ATNHDLDRLWWWCB-AENOIHSZSA-M chlorophyll a Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 ATNHDLDRLWWWCB-AENOIHSZSA-M 0.000 description 6
- 229940028617 conventional vaccine Drugs 0.000 description 6
- 238000005034 decoration Methods 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 229940088679 drug related substance Drugs 0.000 description 6
- 230000028996 humoral immune response Effects 0.000 description 6
- 230000008595 infiltration Effects 0.000 description 6
- 210000003141 lower extremity Anatomy 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 230000002441 reversible effect Effects 0.000 description 6
- 239000001488 sodium phosphate Substances 0.000 description 6
- 229910000162 sodium phosphate Inorganic materials 0.000 description 6
- RPENMORRBUTCPR-UHFFFAOYSA-M sodium;1-hydroxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].ON1C(=O)CC(S([O-])(=O)=O)C1=O RPENMORRBUTCPR-UHFFFAOYSA-M 0.000 description 6
- 238000007920 subcutaneous administration Methods 0.000 description 6
- 230000001052 transient effect Effects 0.000 description 6
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 6
- 239000002028 Biomass Substances 0.000 description 5
- 208000031648 Body Weight Changes Diseases 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 101000674040 Homo sapiens Serine-tRNA ligase, mitochondrial Proteins 0.000 description 5
- 206010028980 Neoplasm Diseases 0.000 description 5
- 102100040597 Serine-tRNA ligase, mitochondrial Human genes 0.000 description 5
- 101000629318 Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Proteins 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 239000008186 active pharmaceutical agent Substances 0.000 description 5
- 230000003466 anti-cipated effect Effects 0.000 description 5
- 230000004579 body weight change Effects 0.000 description 5
- 230000003833 cell viability Effects 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 229940126534 drug product Drugs 0.000 description 5
- 239000011536 extraction buffer Substances 0.000 description 5
- 235000012631 food intake Nutrition 0.000 description 5
- 230000006870 function Effects 0.000 description 5
- 230000035931 haemagglutination Effects 0.000 description 5
- 238000003306 harvesting Methods 0.000 description 5
- 230000036541 health Effects 0.000 description 5
- 238000001597 immobilized metal affinity chromatography Methods 0.000 description 5
- 230000001976 improved effect Effects 0.000 description 5
- 208000037798 influenza B Diseases 0.000 description 5
- 230000005764 inhibitory process Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 238000011587 new zealand white rabbit Methods 0.000 description 5
- 102000039446 nucleic acids Human genes 0.000 description 5
- 108020004707 nucleic acids Proteins 0.000 description 5
- 239000000825 pharmaceutical preparation Substances 0.000 description 5
- 239000008363 phosphate buffer Substances 0.000 description 5
- 230000010076 replication Effects 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 210000000952 spleen Anatomy 0.000 description 5
- 231100000027 toxicology Toxicity 0.000 description 5
- 238000004627 transmission electron microscopy Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 231100001273 GLP toxicology study Toxicity 0.000 description 4
- 101710114810 Glycoprotein Proteins 0.000 description 4
- 241000207746 Nicotiana benthamiana Species 0.000 description 4
- 244000061176 Nicotiana tabacum Species 0.000 description 4
- 108090001074 Nucleocapsid Proteins Proteins 0.000 description 4
- 108700036684 S1 domains Proteins 0.000 description 4
- 102000044437 S1 domains Human genes 0.000 description 4
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 4
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 4
- 101710167605 Spike glycoprotein Proteins 0.000 description 4
- 108091034135 Vault RNA Proteins 0.000 description 4
- 241000710886 West Nile virus Species 0.000 description 4
- 230000002411 adverse Effects 0.000 description 4
- 230000002776 aggregation Effects 0.000 description 4
- 238000004220 aggregation Methods 0.000 description 4
- 239000000556 agonist Substances 0.000 description 4
- 238000013103 analytical ultracentrifugation Methods 0.000 description 4
- 210000004102 animal cell Anatomy 0.000 description 4
- 210000000612 antigen-presenting cell Anatomy 0.000 description 4
- 230000001580 bacterial effect Effects 0.000 description 4
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 238000005352 clarification Methods 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 238000011026 diafiltration Methods 0.000 description 4
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 4
- 238000012377 drug delivery Methods 0.000 description 4
- 238000010828 elution Methods 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 230000004727 humoral immunity Effects 0.000 description 4
- 238000003384 imaging method Methods 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 239000007927 intramuscular injection Substances 0.000 description 4
- 230000002265 prevention Effects 0.000 description 4
- 230000001681 protective effect Effects 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 230000001932 seasonal effect Effects 0.000 description 4
- 239000001632 sodium acetate Substances 0.000 description 4
- 235000017281 sodium acetate Nutrition 0.000 description 4
- 229940124597 therapeutic agent Drugs 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 230000002110 toxicologic effect Effects 0.000 description 4
- 230000009385 viral infection Effects 0.000 description 4
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 3
- 102000053723 Angiotensin-converting enzyme 2 Human genes 0.000 description 3
- 108090000975 Angiotensin-converting enzyme 2 Proteins 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- 108090000565 Capsid Proteins Proteins 0.000 description 3
- 241000701489 Cauliflower mosaic virus Species 0.000 description 3
- 102100031673 Corneodesmosin Human genes 0.000 description 3
- 101710139375 Corneodesmosin Proteins 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 241000713196 Influenza B virus Species 0.000 description 3
- 206010022095 Injection Site reaction Diseases 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 108010076504 Protein Sorting Signals Proteins 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 101000874347 Streptococcus agalactiae IgA FC receptor Proteins 0.000 description 3
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- 108020000999 Viral RNA Proteins 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 230000000052 comparative effect Effects 0.000 description 3
- 229940031670 conjugate vaccine Drugs 0.000 description 3
- 239000000356 contaminant Substances 0.000 description 3
- 238000011109 contamination Methods 0.000 description 3
- 229940127089 cytotoxic agent Drugs 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 230000008348 humoral response Effects 0.000 description 3
- 229910052588 hydroxylapatite Inorganic materials 0.000 description 3
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 3
- 210000004201 immune sera Anatomy 0.000 description 3
- 229940042743 immune sera Drugs 0.000 description 3
- 230000009851 immunogenic response Effects 0.000 description 3
- 238000010255 intramuscular injection Methods 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 210000001165 lymph node Anatomy 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 210000003205 muscle Anatomy 0.000 description 3
- XYJRXVWERLGGKC-UHFFFAOYSA-D pentacalcium;hydroxide;triphosphate Chemical compound [OH-].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O XYJRXVWERLGGKC-UHFFFAOYSA-D 0.000 description 3
- 230000002516 postimmunization Effects 0.000 description 3
- 230000003389 potentiating effect Effects 0.000 description 3
- 230000000241 respiratory effect Effects 0.000 description 3
- 210000003497 sciatic nerve Anatomy 0.000 description 3
- 238000013356 sedimentation velocity analytical ultracentrifugation Methods 0.000 description 3
- 231100000161 signs of toxicity Toxicity 0.000 description 3
- 210000002027 skeletal muscle Anatomy 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 238000005829 trimerization reaction Methods 0.000 description 3
- 238000005199 ultracentrifugation Methods 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- 230000007502 viral entry Effects 0.000 description 3
- 210000000605 viral structure Anatomy 0.000 description 3
- 210000002845 virion Anatomy 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- GVJXGCIPWAVXJP-UHFFFAOYSA-N 2,5-dioxo-1-oxoniopyrrolidine-3-sulfonate Chemical class ON1C(=O)CC(S(O)(=O)=O)C1=O GVJXGCIPWAVXJP-UHFFFAOYSA-N 0.000 description 2
- SXGZJKUKBWWHRA-UHFFFAOYSA-N 2-(N-morpholiniumyl)ethanesulfonate Chemical compound [O-]S(=O)(=O)CC[NH+]1CCOCC1 SXGZJKUKBWWHRA-UHFFFAOYSA-N 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- 238000000035 BCA protein assay Methods 0.000 description 2
- 241000702451 Begomovirus Species 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 108010060123 Conjugate Vaccines Proteins 0.000 description 2
- 241000494545 Cordyline virus 2 Species 0.000 description 2
- 241000702461 Curtovirus Species 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 2
- 108090000288 Glycoproteins Proteins 0.000 description 2
- 102000003886 Glycoproteins Human genes 0.000 description 2
- 238000012369 In process control Methods 0.000 description 2
- 206010023927 Lassa fever Diseases 0.000 description 2
- 244000207740 Lemna minor Species 0.000 description 2
- 235000006439 Lemna minor Nutrition 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 241000702459 Mastrevirus Species 0.000 description 2
- 241000282341 Mustela putorius furo Species 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108091006367 SARS-CoV-2 Spike Subunit S2 Proteins 0.000 description 2
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 description 2
- 208000037847 SARS-CoV-2-infection Diseases 0.000 description 2
- 241000961587 Secoviridae Species 0.000 description 2
- 244000107946 Spondias cytherea Species 0.000 description 2
- 108091027544 Subgenomic mRNA Proteins 0.000 description 2
- 230000029662 T-helper 1 type immune response Effects 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 101710123661 Venom allergen 5 Proteins 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 239000008351 acetate buffer Substances 0.000 description 2
- 239000000654 additive Substances 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 235000021028 berry Nutrition 0.000 description 2
- 229960000074 biopharmaceutical Drugs 0.000 description 2
- 230000003139 buffering effect Effects 0.000 description 2
- 239000013592 cell lysate Substances 0.000 description 2
- 230000007969 cellular immunity Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 210000003763 chloroplast Anatomy 0.000 description 2
- 238000011210 chromatographic step Methods 0.000 description 2
- 239000008395 clarifying agent Substances 0.000 description 2
- 238000004140 cleaning Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000005345 coagulation Methods 0.000 description 2
- 230000015271 coagulation Effects 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 229910017052 cobalt Inorganic materials 0.000 description 2
- 239000010941 cobalt Substances 0.000 description 2
- GUTLYIVDDKVIGB-UHFFFAOYSA-N cobalt atom Chemical compound [Co] GUTLYIVDDKVIGB-UHFFFAOYSA-N 0.000 description 2
- 230000009137 competitive binding Effects 0.000 description 2
- 238000004624 confocal microscopy Methods 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 230000000875 corresponding effect Effects 0.000 description 2
- 230000009260 cross reactivity Effects 0.000 description 2
- 238000009295 crossflow filtration Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 238000009792 diffusion process Methods 0.000 description 2
- 239000000539 dimer Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 150000002148 esters Chemical class 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 239000000706 filtrate Substances 0.000 description 2
- 239000012467 final product Substances 0.000 description 2
- 235000011389 fruit/vegetable juice Nutrition 0.000 description 2
- 239000003365 glass fiber Substances 0.000 description 2
- 210000002216 heart Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 238000010965 in-process control Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000002757 inflammatory effect Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 230000002262 irrigation Effects 0.000 description 2
- 238000003973 irrigation Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 230000005923 long-lasting effect Effects 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000014759 maintenance of location Effects 0.000 description 2
- 238000013411 master cell bank Methods 0.000 description 2
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 230000008520 organization Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 238000012856 packing Methods 0.000 description 2
- 239000000419 plant extract Substances 0.000 description 2
- 230000008635 plant growth Effects 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 210000004777 protein coat Anatomy 0.000 description 2
- 238000001273 protein sequence alignment Methods 0.000 description 2
- 239000008213 purified water Substances 0.000 description 2
- 238000003762 quantitative reverse transcription PCR Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 239000013049 sediment Substances 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000001542 size-exclusion chromatography Methods 0.000 description 2
- 239000007921 spray Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 230000001954 sterilising effect Effects 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229940031626 subunit vaccine Drugs 0.000 description 2
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 2
- 230000003319 supportive effect Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 210000001541 thymus gland Anatomy 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 229940031418 trivalent vaccine Drugs 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- 239000011800 void material Substances 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- 101800001991 5 kDa coat protein Proteins 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 1
- 241000724328 Alfalfa mosaic virus Species 0.000 description 1
- 241000724330 Alfamovirus Species 0.000 description 1
- 241000701513 Badnavirus Species 0.000 description 1
- 241000724306 Barley stripe mosaic virus Species 0.000 description 1
- 241000709756 Barley yellow dwarf virus Species 0.000 description 1
- 241000724681 Barley yellow mosaic virus Species 0.000 description 1
- 241000702325 Beet curly top virus Species 0.000 description 1
- 241000710149 Beet yellows virus Species 0.000 description 1
- 240000008100 Brassica rapa Species 0.000 description 1
- 241000372028 Broad bean wilt virus Species 0.000 description 1
- 241000724256 Brome mosaic virus Species 0.000 description 1
- 241001533462 Bromoviridae Species 0.000 description 1
- 241000724268 Bromovirus Species 0.000 description 1
- 241001533357 Bymovirus Species 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 229940125579 COVID-19 vaccine candidate Drugs 0.000 description 1
- 241000710011 Capillovirus Species 0.000 description 1
- 238000013449 Capto Q chromatography Methods 0.000 description 1
- 241000710175 Carlavirus Species 0.000 description 1
- 241000714207 Carmovirus Species 0.000 description 1
- 241000710173 Carnation latent virus Species 0.000 description 1
- 241000714206 Carnation mottle virus Species 0.000 description 1
- 241000723666 Carnation ringspot virus Species 0.000 description 1
- 241001515826 Cassava vein mosaic virus Species 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 241001115395 Caulimoviridae Species 0.000 description 1
- 241000701459 Caulimovirus Species 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 241000973027 Closteroviridae Species 0.000 description 1
- 241000710151 Closterovirus Species 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 241000701515 Commelina yellow mottle virus Species 0.000 description 1
- 241000723607 Comovirus Species 0.000 description 1
- 108010061994 Coronavirus Spike Glycoprotein Proteins 0.000 description 1
- 241000723655 Cowpea mosaic virus Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 241000948358 Crinivirus Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 244000024469 Cucumis prophetarum Species 0.000 description 1
- 241000724253 Cucumovirus Species 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 241001338022 Daucus carota subsp. sativus Species 0.000 description 1
- 241000723672 Dianthovirus Species 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 239000006145 Eagle's minimal essential medium Substances 0.000 description 1
- 201000011001 Ebola Hemorrhagic Fever Diseases 0.000 description 1
- 241000723747 Enamovirus Species 0.000 description 1
- 101710129170 Extensin Proteins 0.000 description 1
- 241000723648 Fabavirus Species 0.000 description 1
- 241000723722 Furovirus Species 0.000 description 1
- 241000702463 Geminiviridae Species 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 241000724309 Hordeivirus Species 0.000 description 1
- 244000309467 Human Coronavirus Species 0.000 description 1
- 101001057752 Human cytomegalovirus (strain AD169) Uncharacterized protein IRL4 Proteins 0.000 description 1
- 241001533403 Idaeovirus Species 0.000 description 1
- 241000724277 Ilarvirus Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 241000712431 Influenza A virus Species 0.000 description 1
- 241001293495 Lactuca virosa Species 0.000 description 1
- 244000207747 Lemna gibba Species 0.000 description 1
- 235000006438 Lemna gibba Nutrition 0.000 description 1
- 241000709757 Luteovirus Species 0.000 description 1
- 241000701076 Macacine alphaherpesvirus 1 Species 0.000 description 1
- 241001533339 Machlomovirus Species 0.000 description 1
- 241000710118 Maize chlorotic mottle virus Species 0.000 description 1
- 241000611254 Maize rayado fino virus Species 0.000 description 1
- 241000702489 Maize streak virus Species 0.000 description 1
- 101710175243 Major antigen Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000709759 Marafivirus Species 0.000 description 1
- 101710159910 Movement protein Proteins 0.000 description 1
- 241000723638 Nepovirus Species 0.000 description 1
- 241000208125 Nicotiana Species 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- 206010030113 Oedema Diseases 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 241000726026 Parsnip yellow fleck virus Species 0.000 description 1
- 241000702437 Parvovirus H3 Species 0.000 description 1
- 240000007377 Petunia x hybrida Species 0.000 description 1
- 241001112770 Petuvirus Species 0.000 description 1
- 240000004713 Pisum sativum Species 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 241000709992 Potato virus X Species 0.000 description 1
- 241000723762 Potato virus Y Species 0.000 description 1
- 241000710007 Potexvirus Species 0.000 description 1
- 241001533393 Potyviridae Species 0.000 description 1
- 241000710078 Potyvirus Species 0.000 description 1
- 241000724648 Raspberry bushy dwarf virus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 101710145875 Replicase large subunit Proteins 0.000 description 1
- 101710088839 Replication initiation protein Proteins 0.000 description 1
- 101710203837 Replication-associated protein Proteins 0.000 description 1
- 206010038687 Respiratory distress Diseases 0.000 description 1
- 241000724205 Rice stripe tenuivirus Species 0.000 description 1
- 241000701507 Rice tungro bacilliform virus Species 0.000 description 1
- 241001492231 Rice tungro spherical virus Species 0.000 description 1
- 241000124072 Ryegrass mosaic virus Species 0.000 description 1
- 241001533356 Rymovirus Species 0.000 description 1
- 241000709666 Sequivirus Species 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 241000710119 Sobemovirus Species 0.000 description 1
- 241001135883 Soil-borne wheat mosaic virus Species 0.000 description 1
- 241001291279 Solanum galapagense Species 0.000 description 1
- 241000710117 Southern bean mosaic virus Species 0.000 description 1
- 241000701529 Soybean chlorotic mottle virus Species 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 241000724318 Tenuivirus Species 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 101500019501 Tobacco etch virus Nuclear inclusion protein A Proteins 0.000 description 1
- 241000723573 Tobacco rattle virus Species 0.000 description 1
- 241000723677 Tobacco ringspot virus Species 0.000 description 1
- 241000724291 Tobacco streak virus Species 0.000 description 1
- 241000723848 Tobamovirus Species 0.000 description 1
- 241000723717 Tobravirus Species 0.000 description 1
- 229940123384 Toll-like receptor (TLR) agonist Drugs 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 241001533336 Tombusviridae Species 0.000 description 1
- 241000710141 Tombusvirus Species 0.000 description 1
- 241000122134 Trichovirus Species 0.000 description 1
- 241000219793 Trifolium Species 0.000 description 1
- 240000007026 Tylosema esculentum Species 0.000 description 1
- 241000710136 Tymovirus Species 0.000 description 1
- 241001533358 Umbravirus Species 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 108010087302 Viral Structural Proteins Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 108050006628 Viral movement proteins Proteins 0.000 description 1
- 102000018265 Virus Receptors Human genes 0.000 description 1
- 108010066342 Virus Receptors Proteins 0.000 description 1
- 241000709760 Waikavirus Species 0.000 description 1
- 201000006449 West Nile encephalitis Diseases 0.000 description 1
- 206010057293 West Nile viral infection Diseases 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 239000012670 alkaline solution Substances 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 238000004500 asepsis Methods 0.000 description 1
- 230000002238 attenuated effect Effects 0.000 description 1
- 230000003190 augmentative effect Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 229940031416 bivalent vaccine Drugs 0.000 description 1
- 239000007844 bleaching agent Substances 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 238000013043 cell viability test Methods 0.000 description 1
- 238000012054 celltiter-glo Methods 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 239000012539 chromatography resin Substances 0.000 description 1
- 230000001332 colony forming effect Effects 0.000 description 1
- 230000002301 combined effect Effects 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 238000000942 confocal micrograph Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 239000008380 degradant Substances 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 238000002716 delivery method Methods 0.000 description 1
- 238000002298 density-gradient ultracentrifugation Methods 0.000 description 1
- 238000011118 depth filtration Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000001493 electron microscopy Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000011067 equilibration Methods 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- -1 feed pressure Substances 0.000 description 1
- 239000003337 fertilizer Substances 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 230000035784 germination Effects 0.000 description 1
- 238000011194 good manufacturing practice Methods 0.000 description 1
- 230000003370 grooming effect Effects 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000000899 immune system response Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000012405 in silico analysis Methods 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010874 in vitro model Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 238000011221 initial treatment Methods 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- NBQNWMBBSKPBAY-UHFFFAOYSA-N iodixanol Chemical compound IC=1C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C(I)C=1N(C(=O)C)CC(O)CN(C(C)=O)C1=C(I)C(C(=O)NCC(O)CO)=C(I)C(C(=O)NCC(O)CO)=C1I NBQNWMBBSKPBAY-UHFFFAOYSA-N 0.000 description 1
- 229960004359 iodixanol Drugs 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 238000000464 low-speed centrifugation Methods 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000034217 membrane fusion Effects 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000001000 micrograph Methods 0.000 description 1
- 230000005012 migration Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 210000001087 myotubule Anatomy 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000031990 negative regulation of inflammatory response Effects 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- IOQPZZOEVPZRBK-UHFFFAOYSA-N octan-1-amine Chemical compound CCCCCCCCN IOQPZZOEVPZRBK-UHFFFAOYSA-N 0.000 description 1
- 238000001543 one-way ANOVA Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 238000002638 palliative care Methods 0.000 description 1
- 229940127557 pharmaceutical product Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000008055 phosphate buffer solution Substances 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 238000011020 pilot scale process Methods 0.000 description 1
- 235000021118 plant-derived protein Nutrition 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 238000012809 post-inoculation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000007112 pro inflammatory response Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 229940124740 quadrivalent influenza vaccine Drugs 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 239000000376 reactant Substances 0.000 description 1
- 239000011535 reaction buffer Substances 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 210000005084 renal tissue Anatomy 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 239000012898 sample dilution Substances 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000012430 stability testing Methods 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000012536 storage buffer Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 239000003970 toll like receptor agonist Substances 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000014616 translation Effects 0.000 description 1
- 210000001944 turbinate Anatomy 0.000 description 1
- 230000029069 type 2 immune response Effects 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 238000009281 ultraviolet germicidal irradiation Methods 0.000 description 1
- 238000002211 ultraviolet spectrum Methods 0.000 description 1
- 241000709655 unidentified tobacco necrosis virus Species 0.000 description 1
- 238000010977 unit operation Methods 0.000 description 1
- 210000003462 vein Anatomy 0.000 description 1
- 210000003501 vero cell Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the embodiments described herein include use of a multi-set process for producing highly purified, recombinant viruses as antigen carriers, and still further various embodiments relate to vaccine production using a purified virus and a purified antigen, including vaccines intended for prevention of novel coronaviruses, such as SARS-CoV2 (referred to herein as Covid-19 or SARS-2) Disease.
- SARS-CoV2 referred to herein as Covid-19 or SARS-2
- BACKGROUND Viruses have a nucleic acid molecule in a protein coat and replicate only inside the living cells of other organisms. Often thought of as harmful, a wide range of viruses are capable of infecting all types of life forms such as humans, livestock, and plants.
- viruses for a range of therapeutic purposes, including without limitation vaccine creation, gene therapy, and cancer treatments, to name a few.
- viruses first must be purified to remove any cell debris, macro-molecular fibers, organelles, lipids, and other impurities that would interfere with the intended function of the virus.
- viruses Once purified, viruses are suitable for a number of uses.
- One that is relevant to the current disclosure is the traditional notion of using the virus (considered a pathogen in this context) for study and development of genetic strategies against viruses. But discussed at further length in the present disclosure is the use of purified viruses as antigen carriers to prepare a vaccine.
- Antigens are molecules that, when appropriately delivered to an organism, are capable of producing an immune response in that organism, by stimulating the production of antibodies through binding with an antibody within the organism that matches the molecular structure of the antigen.
- Recombinant antigens are produced from recombinant DNA, which through known techniques is cloned into vectors which are then introduced into specific host cells, such as bacteria, mammalian cells, yeast cells, and plant cells, to name some. The recombinant antigen is then expressed using the host cell’s translational apparatus. After expression, the recombinant antigen can be harvested and attached to a virus via covalent bonds, through a process known as conjugation.
- the virus can serve as a carrier to deliver the antigen to an organism and activate the immune system response.
- a virus-antigen conjugate can provide a therapeutic use.
- Proper virus-antigen conjugation is needed for the antigen to activate an immune response that produces antibodies in the host cells of a source organism. Purification of both the virus and antigen fosters this proper conjugation.
- Current methods to purify viruses generally are limited for use in small biochemical quantities, e.g., on the order of nanograms to milligrams, and have not been proven in industrial quantities, which are on the order of grams to kilograms.
- a previously used method known as “Crude Infected Cell Lysate” utilizes crude cell lysates or cell culture media from virus-infected cells. Infected mammalian cells are lysed by freeze-thaw or through other known methods, the debris is removed by low-speed centrifugation, and supernatants are then used for experimentation. The intact infected organisms are ruptured or ground physically, and the resulting extract is clarified using centrifugation or filtration to produce crude virus preparations.
- this method suffers from high contamination with many non-virus factors that impact the ability to conduct experimentation and manipulate the virus.
- a second example of prior purification steps is high-speed ultracentrifugation, by which viruses are pelleted, or further purified through pelleting, via a low-density sucrose solution, or suspended in between sucrose solutions of various densities. Limitations of this method include production of purified viruses in only small quantities due to the limited size and scalability of high velocity separations, and poor virus purity due to additional host proteins often co-purifying with virus samples.
- a third method previously used to enhance virus purity is density gradient ultracentrifugation. In this method, gradients of cesium chloride, sucrose, iodixanol or other solutions are used for separation of assembled virus particles or for removal of particles lacking genetic content.
- Limitations of this method include the time required to purify the virus (often 2-3 days), the limited number of samples, the amount of samples that can be analyzed at a time (generally 6 per rotor), and the small quantity of virus that can be purified (generally micrograms to milligrams of final product).
- Organic extraction and poly-ethylene glycol precipitation also have been used to purify viruses, including viruses from plants, such as by removing lipids and chloroplasts. Again, however, these known methods suffer from poor purity, with products typically still attached to host proteins, nucleic acids, lipids, and sugars which result in significant aggregation of resulting virus products.
- Scalability refers to a process that consistently and reproducibly produces the same product even as the quantity of product increases, e.g., going from laboratory scale ( ⁇ 0.1 square meters) to at least systems > 20 square meters.
- the methods previously used as identified above all suffer from a lack of consistency, low scalability (i.e., creates product only in biochemical quantities), and a lack of compliance with the cGMP regulations.
- plant-based production In terms of large-scale production, plant-based production has garnered attention, although prominent limitations exist with their use. Plant-based production systems are capable of producing industrial scale yields at much less cost than animal cell production systems such as Chinese Hamster Ovary (CHO).
- coronaviruses have been identified as being capable of human infection, including severe acute respiratory syndrome coronavirus (SARS-CoV), Middle East respiratory syndrome coronavirus (MERS-CoV), and the newly identified CoV (SARS-CoV2, 2019-nCoV, or Covid-19).
- SARS-CoV severe acute respiratory syndrome coronavirus
- MERS-CoV Middle East respiratory syndrome coronavirus
- SARS-CoV2 2019-nCoV, or Covid-19
- SARS-CoV Middle East respiratory syndrome coronavirus
- SARS-CoV2 Middle East respiratory syndrome coronavirus
- Covid-19 According to the Johns Hopkins Coronavirus Resource Center, Covid-19 currently has spread to more than 188 countries, infected more than 10 million people, and has been attributed to more than 500,000 deaths worldwide. These numbers are growing exponentially and the outbreak has created a world-wide health and economic crisis. The emergence of Covid-19, and its effects on human health and the economy, demand an urgent response, particularly a vaccine for prevention of Covid-19 Disease. In spite of a global effort to find a vaccine to control or slow infections, no antiviral therapeutics are currently approved to target human coronavirus. Instead, the primary treatment remains supportive and palliative care. [0015] The development of effective SARS-CoV and MERS-CoV vaccines has also been met with limited success.
- SARS vaccines have primarily focused on the Spike (S) protein due to its functionality in human receptor binding, membrane fusion, and viral entry. Furthermore, the S protein is the major antigen of coronaviruses and is the binding site of protective neutralizing antibodies that block virus receptor binding and initiation of infection. Although inactivated SARS-CoV preparations utilizing full-length S proteins induced neutralizing antibodies in immunized animals, these conventional vaccines were not as effective in humans and have been found to raise significant safety concerns (e.g. by actually enhancing viral infection in many systems).
- viral vectors are known as carriers for a range of antigens, providing effective therapeutic delivery to a host organism, e.g., a mammal, such as a human. Such viral vectors tend to vary, however, in terms of an immune responses elicited by the vector separate from the particular antigen being delivered. For example, some viral vectors, such as the ERVEBO® Ebola Zaire Vaccine, are live viruses, which stimulate a response by the host’s immune system.
- antigens of the present disclosure can be conjugated with a TMV NtK vector without the latter stimulating the host’s immune response, without showing immune dominance of one antigen, and without affecting later dose administration for subsequent vaccines using the same viral vector. Also, avoiding such an immune response, caused by the viral vector itself, provides further advantages for bivalent, trivalent, and quadrivalent vaccines because the response for each antigen can be assessed without having to account for effects of the viral vector, both in the current administration of the vaccine as well as future administrations.
- a virus purification method is directed to a multi-set process that comprises harvesting from a source organism virus material containing at least one virus; removing cellular debris from the at least one virus thereby clarifying the structure of the at least one virus; concentrating the separated and clarified virus which in some embodiments is performed with a filtration device comprising a membrane with pores of a size not to exceed a predetermined limit as selected by a user; and processing the concentrated virus by subjecting it to a series of separation procedures and collecting the virus after each separation procedure, wherein at least one separation procedure includes ion-exchange chromatography to separate host cell contaminants from the virus, and at least one separation procedure includes a multi-modal chromatography to separate residual impur
- a plant is the source organism undergoing recombinant expression of a virus, with Nicotiana benthamiana and Lemna minor as non- limiting examples.
- harvesting may include seed production and plant germination with inducement of transient gene expression to from a desired protein, as discussed below.
- the source organism undergoing recombinant expression of a virus is a non-plant host such as, without limitation, bacterial, algal, yeast, insect, or mammalian organisms.
- various aspects of multiple embodiments described herein are directed to producing or purifying, or both, an antigen which can be conjugated with a virus particle.
- a virus particle includes without limitation, one of, some of, or all of viruses and/or fragments thereof, such as rod-shaped viruses, icosahedral viruses, enveloped viruses, and fragments of one or more of the foregoing.
- a plant is the source organism undergoing recombinant expression of antigen; alternatively, the source organism undergoing recombinant expression of antigen is a non-plant host such as, without limitation, bacterial, algal, yeast, insect, or mammalian organisms.
- a multi-set process practiced according to various embodiments described herein produces highly purified viruses or recombinant antigens, or both, on a commercial scale.
- Various steps are employed to improve the upstream purification processes, such as enriching plant viruses.
- Some embodiments utilize size exclusion chromatography, as well as other features, to produce purified recombinant viruses and recombinant antigens.
- various embodiments described herein provide one or more viruses and one or more antigens suitable for the preparation of one or more vaccines of conjugated virus and antigen.
- viruses through the practice of some embodiments of an inventive virus purification platform described herein, purification of rod-shaped plant viruses (such as tobacco mosaic virus, i.e., “TMV”) and icosahedral plant viruses (such as red clover mosaic virus) has been achieved.
- TMV tobacco mosaic virus
- icosahedral plant viruses such as red clover mosaic virus
- TMV red clover mosaic virus
- TMV is approximately 18 nm in diameter, 300 nm in length and contains 2160 capsid proteins with TMV virions that are rigid rod-shaped particles composed of approximately 2,131 copies of the 17.5 kDa coat protein, helically encapsidating the genomic RNA at a ratio of 3 nt per coat protein.
- TMV NtK genome is 6,407 nucleotides and is predicted to be encapsidated by 2,135 coat proteins. While the following statement is not intended to be limiting toward any particular virus carriers to use with present embodiments, additional description and characterization of suitable TMV-NtK intermediates and the coat proteins of such viruses can be found in references such as, but not necessarily limited to, U.S. Pat. No. 7,939,318 (McCormick, et al., “Flexible vaccine assembly and vaccine delivery platform”) and Smith, et al. “Modified Tobacco mosaic virus particles as scaffolds for display of protein antigens for vaccine applications,” Virology 2006;348(2):475-88.
- the inventive process has worked based on two structurally different viruses to allow virus passage into the permeate while retaining unwanted cellular debris.
- operational parameters can be controlled so all types of viruses both pass into the permeate, while chlorophyll/cellular debris are retained, and the tangential flow (TFF) system continues to operate efficiently without unduly or untimely becoming fouled.
- Additional TFF steps are designed to retain virus while allowing smaller proteins to pass into the permeate, and dual chromatography steps are controlled to exclude viruses both large and small, while capturing host cell proteins, host cell DNA, endotoxin, and plant polyphenolics.
- viruses comprising a range of genetic materials (e.g. double- and single-stranded DNA viruses, and RNA viruses), geometries (e.g. rod-shaped, flexious rods, and icosahedral), and families (Caulimoviridae, Geminiviridae, Bromoviridae, Closteroviridae, Comoviridae, Potyviridae, Sequiviridae, Tombusviridae).
- viruses comprising a range of genetic materials (e.g. double- and single-stranded DNA viruses, and RNA viruses), geometries (e.g. rod-shaped, flexious rods, and icosahedral), and families (Caulimoviridae, Geminiviridae, Bromoviridae, Closteroviridae, Comoviridae, Potyviridae, Sequiviridae, Tombusviridae).
- Non-limiting viruses upon which the embodiments described herein are expected to succeed include those of the genuses Badnavirus (e.g. commelina yellow mottle virus); Caulimovirus (e.g. cauliflower mosaic virus); SbCMV-like viruses (e.g. Soybean chlorotic mottle virus); CsVMV-like viruses (e.g. Cassava vein mosaicvirus); RTBV-like viruses (e.g. rice tungro bacilliformvirus); petunia vein clearing-like viruses (e.g. petunia vein clearing virus); Mastrevirus (Subgroup I Geminivirus) (e.g. maize streak virus) and Curtovirus (Subgroup II Geminivirus) (e.g.
- Begomovirus (Subgroup III Geminivirus) (e.g. bean golden mosaic virus); Alfamovirus (e.g. alfalfa mosaic virus); Ilarvirus (e.g. tobacco streak virus); Bromovirus (e.g. brome mosaic virus); Cucumovirus (e.g. cucumber mosaic virus); Closterovirus (e.g. beet yellows virus); Crinivirus (e.g. Lettuce infectious yellows virus); Comovirus (e.g. cowpea mosaic virus ); Fabavirus (e.g. broad bean wilt virus 1); Nepovirus (e.g. tobacco ringspot virus); Potyvirus (e.g. potato virus Y); Rymovirus (e.g.
- ryegrass mosaic virus Bymovirus (e.g. barley yellow mosaic virus); Sequivirus (e.g. parsnip yellow fleck virus); Waikavirus (e.g. rice tungro spherical virus); Carmovirus (e.g. carnation mottle virus); Dianthovirus (e.g. carnation ringspot virus); Machlomovirus (e.g. maize chlorotic mottle virus); Necrovirus (e.g. tobacco necrosis virus); Tombusvirus (e.g. tomato bushy stunt virus); Capillovirus (e.g. apple stem grooving virus); Carlavirus (e.g. carnation latent virus); Enamovirus (e.g. pea enation mosaic virus); Furovirus (e.g.
- Hordeivirus e.g. barley stripe mosaic virus
- Idaeovirus e.g. raspberry bushy dwarf virus
- Luteovirus e.g.barley yellow dwarf virus
- Marafivirus e.g. maize rayado fino virus
- Potexvirus e.g. potato virus X and clover mosaic viruses
- Sobemovirus e.g. Southern bean mosaic virus
- Tenuivirus e.g. rice stripe virus
- Tobamovirus e.g. tobacco mosaic virus
- Tobravirus e.g. tobacco rattle virus
- Trichovirus e.g. apple chlorotic leaf spot virus
- Tymovirus e.g. turnip yellow mosaic virus
- Umbravirus e.g.
- a virus purification platform begins by growing plants in a controlled growth room, infecting the plants with virus replication, recovering the viruses by rupturing the cells with a disintegrator and removing the plant fiber from the liquid via a screw press.
- purification steps include concentrating the clarified extract using tangential flow system, wherein the cassette pore size, transmembrane pressure, and load of clarified extract per square meter of membrane surface area are controlled.
- Transmembrane pressure is the pressure differential between the upstream and downstream sides of the separation membrane and is calculated based on the following formula: ((feed pressure + retentate pressure) / 2) – permeate pressure.
- the feed pressure, the retentate pressure, and the permeate pressure are each controlled to obtain an appropriate TMP.
- the clarified extract is concentrated further with an ion-exchange column volume and washed with ion-exchange chromatography equilibration buffer.
- a Capto Q ion-exchange column is equilibrated and the feed is loaded and collected in the flow-through fraction. The column is then washed to baseline and the host cell contaminants are stripped from the column with high salt.
- an extraction buffer is added before removing chlorophyll and other large cellular debris such as macro-molecular fibers, organelles, lipids, etc. using tangential flow ceramic filtration.
- ceramic filtration promotes the retention of chlorophyll from plant hosts, cell debris, and other impurities while optimizing for virus passage. Whether for plant-based or non-plant viruses, this approach -- wherein the desirable matter (virus or antigen) passes through as permeate and impurities are retained as retentate -- promotes the scalability of the process. Additionally, parameters such as transmembrane pressure, ceramic pore size, and biomass loaded per square meter are all controlled to ensure passage of the virus through the ceramic to create a clarified extract. Ceramic TFF systems are highly scalable and parameters such as TMP, cross flow velocity, pore size, and surface area can be scaled readily to accept larger amounts of biomass. Additional ceramic modules are easily added to the system.
- Feed, retentate, and permeate pressure can also be controlled to maintain efficient cross flow velocity allowing little to no fouling of system.
- cross velocity and pressure differential are set and controlled to produce a TMP of approximately 10-20 psi allowing for efficient passage of virus at smaller and larger scales.
- Ceramic TFF systems are amenable to using highly efficient cleaning chemicals such as nitric acid, bleach, and sodium hydroxide allowing for cleaning studies to be performed addressing GMP and/or cGMP requirements.
- a purification method Whether for plant-based or non-plant viruses, a purification method according to multiple embodiments and alternatives, and otherwise consistent with the development of scalable and high-throughput methods for purifying viruses, utilizes at least one separation procedure using multi-modal chromatography to separate residual impurities from a virus on the basis of at least size differences between the virus and the impurities, and chemical interaction occurring between the impurities and one or more chromatography ligands.
- conducting the at least one separation procedure with Capto® Core 700 chromatography resin (GE Healthcare Bio-Sciences) is included within the scope of embodiments.
- Capto® Core 700 ‘beads’ comprises octylamine ligands designed to have both hydrophobic and positively charged properties that trap molecules under a certain size, e.g. 700 kilodaltons (kDA). Because certain viruses are fairly large (e.g. greater than 700 kDA), and the bead exteriors are inactive, Capto® Core 700 permits purification of viruses by size exclusion, wherein the desirable matter (virus or antigen) passes through as permeate and impurities are retained as retentate. [0028] In some embodiments, again for plant-based and non-plant viruses alike, prior to the multi-modal chromatography column, equilibration is performed with five column volumes of equilibration buffer.
- kDA kilodaltons
- the combined flow-through and wash fractions from Capto Q ion-exchange chromatography are loaded onto the multi-modal chromatography column and the virus is collected in the void volume of the column.
- the column is washed to baseline and stripped with high conductivity sodium hydroxide. Aspects of some embodiments provide for controlling the loading ratio, column bed height, residence time, and chromatography buffers during this step.
- the purified virus is sterile filtered, for example with diafiltration, and stored.
- the recombinant antigens H5 recombinant influenza hemagglutinin (rHA), H7 rHA, domain III of West Nile virus (WNV rDIII), and lassa fever virus recombinant protein 1/2 (LFV rGP1/2), H1N1 (Influenza A/Michigan), H1N1 (Influenza A/Brisbane), H3N2 (Influenza A/Singapore), H3N2 (Influenza A/Kansas), B/Colorado, B/Phuket, RBD-Fc 121 (receptor binding domain (RBD, S1 domain) of the SARS-2 spike glycoprotein fused to a human IgG1 Fc domain (herein “RBD-Fc 121” refers an amino acid sequence of the SARS-2 spike protein as explained in further detail below)), and RBD
- Antigens for various embodiments herein can be from many sources, and may be produced using traditional recombinant protein manufacturing strategies, including bacterial, yeast, insect, mammalian or plant-based expression approaches.
- an antigen manufacturing platform begins by growing plants in a controlled growth room, infecting the plants for recombinant antigen replication, then antigen recovery using a disintegrator followed by removal of fiber from the aqueous liquid via a screw press.
- An extraction buffer is added to assist in removal of chlorophyll (in the plant context) and large cellular debris by filtration.
- clarified extract is next concentrated and washed with an ion- exchange chromatography equilibration buffer.
- One way for this step to be undertaken is by loading feed onto an equilibrated Capto Q ion-exchange column, followed by washing with equilibration buffer and eluting/stripping with salt.
- Antigen fractions are then collected in the elution and prepared for cobalt immobilized metal affinity chromatography (IMAC).
- IMAC cobalt immobilized metal affinity chromatography
- the IMAC is equilibrated, the feed is loaded, then washed with equilibration buffer and eluted.
- the elution fraction is diluted and checked for pH, then loaded onto a multi-modal ceramic hydroxyapatite (CHT) chromatography column.
- CHT ceramic hydroxyapatite
- the CHT resin is equilibrated with equilibration buffer and the antigens are eluted. Loading ratio, column bed height, residence time, and chromatography buffers are among factors being controlled. Lastly, the antigen is concentrated and diafiltered with a saline buffer. The recombinant antigen is sterile filtered and then stored.
- H7 rHA to TMV H1N1 (Influenza A/Michigan) to TMV
- H3N2 Influenza A/Singapore
- B/Colorado B/Phuket
- RBD-Fc 121 SARS-2
- RBD-Fc 139 SARS-2)
- the bivalent formulation of TMV to two Influenza B viruses has also been successfully conjugated, as well as the quadrivalent conjugation of TMV to H1N1 (Influenza A/Michigan), H3N2 (Influenza A/Singapore), B/Phuket, and B/Colorado.
- a “quadrivalent” influenza vaccine is designed to protect against four different influenza viruses: two influenza A viruses and two influenza B viruses.
- trivalent vaccines were commonly used, but now quadrivalent vaccines are the most common because they may beneficially provide broader protection against circulating influenza viruses by adding another B virus.
- the term “multivalent” vaccine refers to more than one antigen conjugated to a virus.
- the protein consists of any type of therapeutic agent capable of being conjugated to a virus to create a vaccine, and then delivered to a source organism to produce an immune response according to multiple embodiments and alternatives. Accordingly, the disclosures herein provide compositions comprising an array of virus-protein conjugates, including virus- antigen conjugates.
- the virus selected is TMV, or any of a number of viruses identified and/or indicated by the teachings herein.
- the protein can be an antigen, such as but not limited to influenza hemagglutinin antigen (HA), including without limitation ones listed in this paragraph including as soluble forms of HA proteins found on a surface of an influenza virus that mediates virus infection.
- HA hemagglutinin antigen
- the HA exhibits at least about 50% trimer formation. HAs are clinically important because they tend to be recognized by certain antibodies an organism produces, providing the main thrust of protection against various influenza infections. Because HA antigenicity and, therefore, HA immunogenicity are tied to conformation, it is known that HA trimerization is advantageous over the monomeric form in terms of triggering immune responses.
- conjugation begins by concentrating and diafiltering purified antigen and virus into a slightly acidic buffer. The antigen and virus are then combined based upon molarity and mixed. A freshly prepared water-soluble carbodiimide, such as 1-ethyl-3- (3-dimethylaminopropyl) carbodiimide (also known as EDC) is added to the mixture while mixing based upon molarity. A chemical reagent for converting carboxyl groups to amine reactive N-hydroxysulfosuccinimide esters, such as ThermoFisher’s Sulfo-NHS, is then added based upon molarity. The reaction is continued until a predetermining stop time.
- a freshly prepared water-soluble carbodiimide such as 1-ethyl-3- (3-dimethylaminopropyl) carbodiimide (also known as EDC) is added to the mixture while mixing based upon molarity.
- the reaction is then quenched, with one exemplary involving the addition of an amine group (e.g., liquid containing free amines) and any chemical linker(s) used in facilitating the reaction (e.g., EDC, Sulfo-NHS) is removed through a multi-modal chromatography step or diafiltration, with the mixture then being diluted to target concentration.
- an amine group e.g., liquid containing free amines
- any chemical linker(s) used in facilitating the reaction e.g., EDC, Sulfo-NHS
- the conjugated and purified virus particles that are decorated with proteins and antigens may be used for vaccines and/or diagnostic tools. These particles may be used as diagnostic tools because of their ability to track antigens in the host organism.
- the purified virus – antigen fusion may be derived from genetic fusion, in addition to the various embodiments disclosed herein.
- the antigen and virus structural proteins form a single continuous open reading frame.
- the reading frame produces an antigen-coat protein in a plant such that the coat protein self assembles into virus particles.
- the plant materials are harvested and the virus particles are purified according to the embodiments disclosed herein.
- the virus particles decorated with the fusion-coat proteins may then be used as a vaccine and/or a diagnostic tool according to the various embodiments disclosed.
- Some viruses (such as icosahedral viruses as a non-limiting example) swell under certain pH conditions and in some embodiments this “swelling” may be used for conjugation.
- the purified virus may be conjugated to a therapeutic agent by subjecting the virus structure to acidic pH conditions that cause the virus to “swell.” By treating the virus structure with neutral pH conditions, the virus structure relaxes and creates pores between pentamer or other structural subunits of the virus.
- a therapeutic agent such as a chemotherapeutic agent
- the virus particles tighten and remove the pore structures packing the pentamer or structural submits together such that chemical diffusion in or out of the virus particle is prevented.
- the plant materials are harvested, the virus particles are purified, and the virus particles containing a therapeutic agent are used for drug delivery, according to the embodiments disclosed herein.
- multiple embodiments and alternatives encompass production of one or more highly purified viruses. Still further, multiple embodiments and alternatives encompass production or purification or both of a recombinant antigen. Still further, multiple embodiments and alternatives encompass conjugation of purified antigens and viruses for use as vaccines. Indeed, in pre-clinical studies, TMV-platform vaccines produced in accordance with the embodiments described herein stimulated efficacious immune responses against a number of pathogens, comprising both viral and antibacterial systems. Further, vaccines produced on the inventive TMV-platform demonstrate the ability to conjugate to multiple coronavirus (CoV) antigens at once (i.e. a multivalent vaccine) to stimulate efficacious immune responses.
- CoV coronavirus
- viruses may be practiced by itself in accordance with the present embodiments.
- production or purification of recombinant antigens may be practiced alone in accordance with the present embodiments.
- combining embodiments would include, among other ways of practicing these embodiments, starting with one or more source organisms, from which are produced one or more viruses and one or more antigens, then purifying such viruses and antigens, then forming vaccines which are conjugates between at least one antigen and at least one virus.
- the international application file with respect to the present disclosure contains one or more drawings executed in color, due to impracticability or impossibility in presenting in a black and white drawing what is to be shown, for instance, but not limited to, protein structure and RBD-Fc fusion in Fig.51(A) and Fig.51(B), respectively, microscopy images in Fig.61, and graphs presenting multiple lines in Figs. 71(A)-(C), 79(A)-(B), and 81(A)-(B), respectively.
- Applicant will provide true black and white drawings if required, representing the color images and without adding subject matter.
- Fig.1 is a flow chart showing the steps in a certain virus purification platform within the scope of the present disclosure, according to multiple embodiments and alternatives.
- Fig. 2 is purified icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.
- Fig. 2 is purified icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.
- FIG. 3 is a western blot analysis of the purification of the icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.
- Fig. 4 is purified icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.
- Fig. 5 is a western blot analysis of the purification of the icosahedral red clover mosaic virus, according to multiple embodiments and alternatives.
- Fig. 6 is purified rod-shaped tobacco mosaic virus, according to multiple embodiments and alternatives.
- Fig.7 is a western blot analysis of the purification of the rod-shaped tobacco mosaic virus, according to multiple embodiments and alternatives. [0047] Fig.
- FIG. 8 is a flow chart showing the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.
- Fig. 9 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.
- Fig.10 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.
- Fig.11 is a western blot analysis of some of the steps of an antigen manufacturing platform, according to multiple embodiments and alternatives.
- Fig.12 is a western blot analysis of the purification of various antigens through the antigen manufacturing platform, according to multiple embodiments and alternatives.
- Fig. 12 is a western blot analysis of the purification of various antigens through the antigen manufacturing platform, according to multiple embodiments and alternatives.
- FIG. 13 is an illustration of the conjugation of recombinant antigen to a virus, according to multiple embodiments and alternatives.
- Fig.14 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.
- Fig.15 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.
- Fig.16 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.
- Fig.17 is a report of size exclusion-high-performance liquid chromatography (SEC- HPLC) of a free TMV product, according to multiple embodiments and alternatives.
- SEC- HPLC size exclusion-high-performance liquid chromatography
- Fig.18 is a report of SEC-HPLC of conjugation between a virus and an antigen for fifteen minutes, according to multiple embodiments and alternatives.
- Fig.19 is a report of SEC-HPLC of conjugation between a virus and an antigen two hours, according to multiple embodiments and alternatives.
- Fig. 20 is a western blot analysis of conjugation between a virus and an antigen, according to multiple embodiments and alternatives.
- Fig.21 is a graph illustrating the infectivity of viruses treated with various levels of UV irradiation, according to multiple embodiments and alternatives. [0061] Fig.
- Fig. 22 is an illustration of some of the steps of the conjugation platform of recombinant antigen to a virus, according to multiple embodiments and alternatives.
- Fig.23 is a SDS-PAGE analysis of the conjugation of an antigen to a virus, according to multiple embodiments and alternatives.
- Fig. 24 is a negative stain transmission electron microscopy (TEM) image of recombinant antigen, according to multiple embodiments and alternatives.
- Fig.25 is a negative stain TEM image of a virus, according to multiple embodiments and alternatives.
- Fig. 26 is a negative stain TEM image of a recombinant antigen conjugated to another recombinant antigen with added virus, according to multiple embodiments and alternatives.
- Fig.27 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.
- Fig.28 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.
- Fig.29 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 4:1, according to multiple embodiments and alternatives.
- Fig.30 is a negative stain TEM image of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 16:1, according to multiple embodiments and alternatives.
- Fig. 31 is a normalized sedimentation coefficient distribution of an antigen, according to multiple embodiments and alternatives.
- Fig. 32 is a normalized sedimentation coefficient distribution of a virus, according to multiple embodiments and alternatives.
- Fig.33 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.
- Fig.34 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.
- Fig.35 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 1:1, according to multiple embodiments and alternatives.
- Fig.36 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 4:1, according to multiple embodiments and alternatives.
- Fig.37 is a normalized sedimentation coefficient distribution of recombinant antigen conjugated to a virus at a virus to recombinant antigen ratio of 16:1, according to multiple embodiments and alternatives.
- Fig. 38 is a scatterplot of antigen-relevant titers in a source organism following administration of virus-antigen products at various virus to recombinant ratios, according to multiple embodiments and alternatives.
- Fig.39 is a geometric mean testing illustrating the antigen-relevant titers in a source organism following administration of virus-antigen products at various virus to recombinant ratios, according to multiple embodiments and alternatives.
- Fig. 40 is a SDS-PAGE analysis of a purified recombinant antigen, according to multiple embodiments and alternatives.
- Figs.41(A)-(B) provide graphs of stability data at two different temperature ranges for QIV conjugates.
- Fig.42 is a graph of the immunogenicity of a quadrivalent vaccine in mice, according to multiple embodiments and alternatives.
- Fig.43 is an illustration of an immunogenicity and challenge study of a quadrivalent vaccine in ferrets, according to multiple embodiments and alternatives.
- Fig. 44 is an illustration of the nasal wash virus titers following virus challenge in ferrets, according to multiple embodiments and alternatives.
- Fig. 45 is an illustration of the nasal wash virus titers following virus challenge in ferrets, according to multiple embodiments and alternatives.
- Fig.46 is an illustration of the immunogenicity of a monovalent vaccine produced in mice at various virus to recombinant antigen ratios, according to multiple embodiments and alternatives.
- Fig.47 is an illustration of TMV vRNA in tissues over time following an injection of a quadrivalent vaccine, according to multiple embodiments and alternatives.
- Fig.48 is an illustration of TMV vRNA in tissues eight days following an injection of a quadrivalent vaccine, according to multiple embodiments and alternatives.
- Fig. 49 is an illustration of total anti-influenza titers based on an ELISA analysis from rabbit serum samples following injections of a quadrivalent vaccine, according to multiple embodiments and alternatives.
- Fig. 50 is an illustration of neutralization titers measured in rabbits following injections of a quadrivalent vaccine, according to multiple embodiments and alternatives.
- Fig.51 (A) is an illustration of the protein structure of the Covid-19 Spike timer in space-filling model with the receptor binding domain circled in lateral and vertical views.
- Fig. 51(B) is an illustration of the fusion of the Covid-19 receptor binding domain to a human Fc domain, according to multiple embodiments and alternatives.
- Fig. 52 is an illustration of an expression plasmid containing the construct of a recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 53 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 53 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 54 is a report of SEC-HPLC of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 55 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 56 is an illustration of some of the steps of the conjugation platform of recombinant Covid-19 antigen to a virus and drug substance filling, according to multiple embodiments and alternatives.
- Fig. 57 is a normalized sedimentation coefficient distribution of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.
- Fig. 57 is a normalized sedimentation coefficient distribution of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.
- Fig. 58 is a normalized sedimentation coefficient distribution of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.
- Fig.59 is a SDS-PAGE analysis of a recombinant Covid-19 antigen conjugated to a virus, according to multiple embodiments and alternatives.
- Fig. 60(A) is an ELISA standard curve illustrating the binding of the recombinant Covid-19 antigen to a Covid-19 human neutralizing monoclonal antibody.
- FIG. 60(B) is a graph illustrating the binding of various vaccine alternatives in accordance with multiple embodiments and alternatives described herein (sometimes referred to herein as vaccine candidates), and the binding to a Covid-19 human neutralizing monoclonal antibody, according to multiple embodiments and alternatives.
- Fig.61 consists of confocal microscopy images illustrating the co-localization of the recombinant Covid-19 antigen to ACE-2 specific antibodies, according to multiple embodiments and alternatives.
- Fig. 62(A) is a graph illustrating the co-localization of a native agonist and a recombinant Covid-19 antigen to ACE-2 specific antibodies, according to multiple embodiments and alternatives.
- Fig.62(B) is a graph illustrating the co-localization of a native agonist and a recombinant Covid-19 antigen to ACE-2 specific antibodies in the presence of a co-localization control, according to multiple embodiments and alternatives.
- Figs. 63(A)-(D) are graphs showing results of pooled serum samples undergoing a plaque neutralization assay at preimmune, day 12, day 28, and day 42 following first administration (followed by boost at day 14) of exemplary vaccines at increasing dilution levels and containing varying concentrations of RBD-Fc antigen, with and without adjuvant.
- Figs. 63(A)-(D) are graphs showing results of pooled serum samples undergoing a plaque neutralization assay at preimmune, day 12, day 28, and day 42 following first administration (followed by boost at day 14) of exemplary vaccines at increasing dilution levels and containing varying concentrations of RBD-Fc antigen, with and without adjuvant
- Fig.65(A) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen and a control.
- Fig. 65(B) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen conjugated to a virus (unadjuvanted).
- Fig. 65(C) illustrates the immune response in animals immunized with an adjuvanted Covid-19 antigen conjugated to a virus.
- Fig. 65(A) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen and a control.
- Fig. 65(B) is a graph illustrating the immune response in animals immunized with a recombinant Covid-19 antigen conjugated to a virus (unadjuvanted).
- Fig. 65(C) illustrates the immune response in animals immunized with an adjuvanted Covid-19 antigen conjug
- Figs 66(A) – 63(C) are graphs illustrating an IgG isotype analysis for individual sera taken from animals immunized with a recombinant Covid-19 antigen conjugated to a virus, controls, and adjuvant, according to multiple embodiments and alternatives.
- Fig. 66(A) illustrates the Th1 response (IgG2a and IgG2c) associated with the analysis, Fig.
- Fig. 67 is a graph illustrating the cell viability after incubation with SARS2 virus with murine sera, according to multiple embodiments and alternatives.
- Fig.68 is a graph illustrating the immune response titers in animals immunized with a recombinant Covid-19 antigen conjugated to a virus, controls, and historical comparisons, according to multiple embodiments and alternatives.
- Fig. 69 graphs virus neutralization titers following vaccination of mice with exemplary vaccines of varying concentrations.
- Fig.70(A) is a graph illustrating an IFN ⁇ ELISpot analysis for animals immunized with a virus and a recombinant Covid-19 antigen.
- Fig. 70(B) is a graph illustrating an IFN ⁇ ELISpot analysis for animals immunized with an unadjuvanted TMV:RBD-Fc vaccine.
- Fig. 70(C) is a graph illustrating an IFN ⁇ ELISpot analysis for animals immunized with a TMV:RBD-Fc vaccine and an adjuvant.
- Figs. 71(A)-(C) provide graphs of survival rates, Fig.
- Fig. 72 is a graph illustrating a VaxArray ⁇ analysis of murine sera from mice immunized with various TMV:RBD-Fc vaccine dosages, and both with and without adjuvant, according to multiple embodiments and alternatives.
- Figs. 73(A)-(B) provide graphs of experimental results through analysis of specificity and relative titer of sera from animal studies by VaxArray ⁇ , comparing different capture antigens.
- Fig.74 is a graph of titers measured by VaxArray® in day 42 sera from individual animals compared with individual and pooled neutralization titers.
- Fig. 75(A) is a graph showing results on the viability of macrophages exposed to nucleocapsid and spike proteins of SARS-2 with non-inventive antibodies added, as an indicator of antibody enhancement of disease.
- Fig.75(B) is a graph of mouse sera containing antibodies, which were generated from TMV:RBD-Fc vaccines according to multiple embodiments and alternatives, following exposure to nucleocapsid and spike proteins of SARS-CoV2.
- Fig.75(C) shows statistical differences applicable to the graphs in Figs.75(A- B).
- Fig. 76 is a SDS-PAGE analysis of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 77 is a report of SEC-HPLC of a purified recombinant Covid-19 antigen, according to multiple embodiments and alternatives.
- Fig. 78 illustrates the receptor binding domain of the spike protein sequence alignment of SARS-2 and other related coronaviruses.
- Figs. 79(A)-(B) provide graphs of data on challenge studies in mice and ferrets, respectively, in which the subjects were administered an exemplary vaccine at different ratios, with and without adjuvant.
- Fig.80 provides a graph of vaccine tolerability based on change in weight over time following administration of exemplary vaccines without infection.
- Figs. 81(A)-(B) provide graphs of data on challenge studies in rabbits for weight gain and survival, respectively, in which the subjects were administered an exemplary vaccine at different ratios, with and without adjuvant.
- MULTIPLE EMBODIMENTS AND ALTERNATIVES [00121] A multi-set process according to multiple embodiments and alternatives herein improves upstream purification processes, further enriching plant viruses, and facilitates the conjugation of virus and antigen to form a vaccine. Steps for producing and purifying a virus in accordance with multiple embodiments and alternatives are listed and discussed in connection with Table 1 and Figure 1.
- Table 1 and Figure 1 illustrate the steps of the virus purification platform according to multiple embodiments and alternatives. Table 1. Production and Purification of Virus
- virus expression is accomplished through methods that are appropriate for a particular host.
- virus-based delivery of genes to a plant host is accomplished with a modified TMV expression vector that causes tobacco plants to recombinantly form the virus.
- GENEWARE® platform described in United States Patent 7,939,318, “Flexible vaccine assembly and vaccine delivery platform.”
- This transient plant- based expression platform described in this patent employs the plant virus TMV to harness plant protein production machinery, which expresses a variety of viruses in a short amount of harvest time post inoculation (e.g., less than 21 days).
- Tobacco plants inoculated with the virus genes express the particular virus in infected cells, and the viruses are extracted at harvest. Inoculation occurs by, as examples to be selected by a user of the methods herein described, hand inoculation of a surface of a leaf, mechanical inoculation of a plant bed, a high-pressure spray of a leaf, or vacuum infiltration.
- Nicotiana benthamiana other plant and non-plant hosts are contemplated by this disclosure, including those mentioned in the Summary.
- GENEWARE® platform other strategies can be employed to deliver genes to plant (Lemna gibba or Lemna minor as non-limiting examples) and non-plant organisms (algae as a non-limiting example).
- These other strategies include Agro-infiltration, which introduces the viral gene via an Agrobacterium bacterial vector to many cells throughout the transfected plant.
- Another is electroporation to open pores in the cell membranes of the host to introduce the genes that recombinantly produce the viruses and antigens such as but not limited to those described in Examples 1 and 3 below.
- TMV RNA-based overexpression vector which utilizes a 35S promotor-driven TMV replicon that lacks the TMV coat protein gene sequence, as described in John Lindbo, “TRBO: A High-Efficiency Tobacco Mosaic Virus RNA-Based Overexpression Vector,” Plant Physiol. Vol.145, 2007.
- TRBO TMV RNA-based overexpression vector
- DPS days post sow
- Virus recovery/cell rupture involves a disintegrator configured with an optimized blade/screen size followed by removal of residual cellulosic plant fiber from aqueous liquid (such as through a screw press, as one example).
- An appropriate extraction buffer e.g., 200 mM Sodium Acetate, pH 5.0; step 201 of Fig. 1 as a non-limiting example
- tangential flow (TFF) ceramic filtration 1.4 micron/5.0 micron
- an additional 0.1-micron ceramic tangential flow filtration step is employed.
- Transmembrane pressure, ceramic pore size and biomass loaded per square meter of membrane surface are all controlled to ensure passage of the virus through the ceramic.
- the feed pressure, retentate pressure, and permeate pressure are set and controlled to produce a resulting transmembrane pressure in a range of about 1.5 – 2 Bar TMP.
- ceramic tangential flow filtration is followed by dead-end filtration, e.g., using 1.2 micron glass fiber filtration.
- Ceramic permeate is further clarified via the use of glass fiber depth filtration (step 203 of Fig.1 as a non-limiting example).
- Clarified extract is concentrated with a TFF system (available from Sartorius AG). Cassette pore size (100 – 300 kDa), an appropriate TMP as described herein, and load of clarified extract per square meter of membrane surface area are controlled.
- the clarified extract is concentrated to NMT 2X the ion-exchange column volume and washed 7X with ion-exchange chromatography equilibration buffer (200 mM Sodium Acetate, pH 5.0, step 204 of Fig. 1 provides a non-limiting example).
- the Capto Q ion- exchange column is equilibrated for five column volumes with 200 mM Sodium Acetate, pH 5.0 (step 205 of Fig.1 provides a non-limiting example), and the feed is loaded and collected in the flow-through fraction. The column is washed to baseline and host cell contaminants are stripped from the column with high salt. [00134] The flow through and wash fractions are collected, combined and prepared for multi- modal Capto® Core 700 chromatography. The multi-modal chromatography column is equilibrated with five column volumes of equilibration buffer (200 mM Sodium Acetate, pH 5.0; step 206 of Fig.1 provides a non-limiting example).
- Virus is concentrated to an appropriate concentration, such as 10 mg/ml, and in some embodiments is diafiltered with an appropriate buffer, such as Sodium Phosphate. Formulated virus is sterilized and stored appropriately. In some embodiments, sterilization is provided via a PES filter.
- All examples provided herein are meant as illustrative of various aspects of multiple embodiments and alternatives of any or all of virus production, virus purification, antigen production, antigen purification, and virus-antigen conjugation. These examples are non- limiting and merely characteristic of multiple alternative embodiments herein.
- Example 1 – Purification of Icosahedral Red Clover Mosaic Virus [00137] The Western Blot, provided in Fig.
- FIG. 3 shows successful purification of the icosahedral red clover mosaic virus illustrated in Fig.2.
- the Western Blot in Figure 5 shows successful purification of the icosahedral red clover mosaic virus illustrated in Fig. 4.
- Both viruses were purified according to the embodiments described herein.
- target proteins were extracted from the tissue. Then proteins of the sample were separated using gel electrophoreses based on their isoelectric point, molecular weight, electrical charge, or various combinations of these factors. Samples were then loaded into various lanes in the gel, with a lane reserved for a “ladder” containing a mixture of known proteins with defined molecular weights.
- lane 12 serves as the ladder.
- a voltage was then applied to the gel, causing the various proteins to migrate through the gel at different speeds based on the aforementioned factors.
- the separation of the different proteins into visible bands within each lane occurred as provided in Figures 3 and 5, respectively.
- Figures 3 and 5 illustrate the virus purification platform successfully purifying the icosahedral red clover mosaic virus.
- Each lane of the western blot shows the purity of the virus after the conclusion of a different step in the virus purification platform.
- the lanes include: lane 1 - green juice, lane 2 - TFF Ceramic Clarification Retentate, lane 3 - TFF Ceramic Clarification Permeate, lane 4 - TFF Cassette Retentate, lane 5 - TFF Cassette Permeate, lane 6 - Ion Exchange, lane 7 - Ion Exchange, lane 8 - multimodal, lane 9 - multimodal, lane 10 - 30K TFF Permeate, lane 11 - 30K Retentate, lane 12 - marker.
- the lanes of the western blot include the following: lane 1 - Green Juice, lane 3 - TFF Ceramic Clarification Retentate, lane 5 - TFF Ceramic Clarification Permeate, lane 7 - TFF Cassette Retentate, lane 9 - TFF Cassette Permeate, lane 11 - Ion Exchange, lane 13 - Multimodal, and Lane 14 - Marker.
- the resulting viral product is highly purified, as shown by the visible band in lane 11 of Fig.3 and lane 13 of Fig. 5.
- Fig.6 shows a purified rod-shaped TMV
- Fig.7 illustrates a virus purification platform used in achieving this purified TMV, within the scope of multiple embodiments and alternatives disclosed herein. Similar to Figures 3 and 5, Fig.7 illustrates the purity of the virus product after the conclusion of the various steps of the current virus purification platform. After the final purification step, the resulting product is highly purified virus product consistent with a clear and visible band in lane 13 of Fig.7.
- the identity of such an exemplary, pre-conjugation, TMV-NtK intermediate can be confirmed by mass spectrometry, e.g. MALDI-TOF mass spectrometry.
- physicochemical properties of the TMV-NtK intermediate include a pH between about 7.0-7.4, an osmolality between about 15-45 mOsm/kg H 2 0, a bioburden no greater than 100 CFU (colony forming units)/mL, and residual host cell proteins less than 100 ng/mg.
- Table 2 and Figure 8 illustrate the steps of the antigen purification platform according to multiple embodiments and alternatives.
- Table 2 Production and Purification of Recombinant Antigen Operative Unit Operations In-Process Controls In-Process Steps Analytics
- This purification platform is designed for commercial scalability and compliance with the cGMP regulations and utilizes one buffer throughout the entire purification process.
- the steps of the antigen purification platform are as follows: [00144] Growth of Nicotiana benthamiana wild type plants in a controlled growth room. Plant growth is controlled via irrigation, light and fertilizer cycles. Plants are grown in a soilless media and temperature is controlled throughout the process. After an appropriate number of DPS, for example 23 to 25, plants are infected for protein replication of a selected antigen. Once tagged, the protein is sufficient for retention in the ER of the transgenic plant cell.
- the extraction buffer may be 50-100 mM Sodium Phosphate + 2 mM EDTA + 250 mM NaCl + 0.1% Tween80, pH 8.5. Removal of chlorophyll and large cellular debris involves the use of filtration. Celpure300 is added at a ratio of 33 g/L and mixed for 15 minutes. Feed pressure ( ⁇ 30 PSI), filtrate pore size (0.3 microns), clarifying agent (Celpure300) and biomass loaded per square meter of membrane surface are all controlled to ensure passage of the antigens. [00147] Clarified extract is concentrated with a TFF system (such as the Sartorius AG system).
- TFF such as the Sartorius AG system
- the cassette pore size (for e.g., 30 kDa), an appropriate TMP as described herein, and load of clarified extract per square meter of membrane surface area are controlled.
- the clarified extract is concentrated and washed 7X with an appropriate ion- exchange chromatography equilibration buffer (such as 50 mM Sodium Phosphate + 75 mM NaCl, pH 6.5).
- the Capto Q ion-exchange column is equilibrated for five column volumes with 50 mM Sodium Phosphate + 75 mM NaCl, pH 6.5, the feed is loaded, washed with equilibration buffer, and the column eluted/stripped with high salt.
- Antigen fractions are collected in the elution for preparation for Cobalt IMAC chromatography.
- IMAC is equilibrated for five column volumes with 50 mM Sodium Phosphate + 500 mM Sodium Chloride, pH 8.0, feed is loaded, washed with equilibration buffer and eluted using imidazole.
- the elution fraction is diluted to conductivity, pH is checked and loaded onto a multi- modal ceramic hydroxyapatite (CHT) chromatography column.
- the CHT resin is equilibrated with five column volumes of equilibration buffer (5 mM Sodium Phosphate, pH 6.5).
- Antigens are eluted using a gradient of phosphate and NaCl. Loading ratio, column bed height, residence time and chromatography buffers are all controlled. Formulation and concentration of the antigens takes place using a TFF system (such as the Sartorius AG system). Pore size (in kDa), TMP, load per square meter of membrane surface area and pore material are all controlled, as further discussed herein. [00151] Antigen is next concentrated to a suitable concentration, such as 3 mg/ml, and diafiltered with a suitable buffer (for example, phosphate buffered saline, pH 7.4). Formulated antigen is sterilized and stored appropriately. In some embodiments, sterilization is provided via a PES filter.
- a suitable buffer for example, phosphate buffered saline, pH 7.4
- Figures 9, 10, and 11 illustrate the various steps of the antigen purification platform according to multiple embodiments and alternatives.
- Fig. 9 shows the purity of the antigen product after the Capto Q chromatography step has concluded
- Fig.10 shows the purity of the antigen product after the affinity chromatography step
- Fig.11 shows the purity after the CHT chromatography column. Examples 3, 4, 5, and 6 - H5 rHA, H7 rhA, WNV rDIII, and LFV rGP1/2
- the antigen purification platform according to multiple embodiments and alternatives has successfully purified H5 rHA, H7 rhA, WNV rDIII, and LFV rGP1/2.
- Fig.12 contains two images taken from the conclusion of the antigen purification platform: the image on the left contains a SDS Page gel indicating purity for the viral vector TMV NtK (where NtK is an abbreviation for N-terminal lysine) and influenza antigens, and the image on the right contains a western blot indicating the immunoreactivity for West Nile and Lassa Fever antigens.
- TMV NtK where NtK is an abbreviation for N-terminal lysine
- influenza antigens the image on the right contains a western blot indicating the immunoreactivity for West Nile and Lassa Fever antigens.
- each antigen product is highly pure. Therefore, the antigen purification platform according to multiple embodiments and alternatives consistently purified each type of antigen on a commercial scale it was used with in a manner that is also compliant with cGMP regulations.
- the steps of a conjugation platform are as follows: [00157] Purified antigen and virus are separately concentrated and diafiltered into a slightly acidic buffer, such as a 2-(N-morpholino) ethanesulfonic acid (MES) buffer containing NaCl. [00158] A water soluble carbodiimide, such as 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (known as EDC) is formulated in purified water to a molarity of 0.5 M.
- MES 2-(N-morpholino) ethanesulfonic acid
- a chemical reagent for converting carboxyl groups to amine reactive N- hydroxysulfosuccinimide esters such as ThermoFisher’s Sulfo-NHS, is formulated in purified water to a molarity of 0.1 M.
- Antigen and virus are combined based upon weight or molarity and mixed to homogeneity (e.g. a 1:1 mg:mg addition).
- the freshly prepared water soluble carbodiimide (such as EDC) is added to the mixture while mixing based upon molarity.
- a chemical reagent for converting carboxyl groups to amine reactive esters (such as Sulfo-NHS) is added based upon molarity within one minute of EDC addition.
- the conjugation reaction begins and is continued until a predetermined mixing stop time, such as four hours, and the room temperature is controlled.
- a predetermined mixing stop time such as four hours
- the reaction is quenched by adding free amines, and the chemical linker (for example EDC and Sulfo-NHS) is removed through a multi-modal chromatography step, such as Capto® Core 700, or diafiltration into a phosphate buffered saline.
- the residual impurities are removed from the results of the conjugation reaction, sometimes referred to herein as a conjugate mixture, based on sized differences between impurities as the retentate, and the conjugate mixture as the permeate.
- the conjugate mixture is diluted to target concentration.
- the virus- antigen conjugate is prepared for use as a purified vaccine/drug substance.
- a suitable delivery mechanism of the vaccine would include a liquid vial or lyophilized material to be reconstituted with physiologic buffering for project injection. Injection could be intramuscular or sub- cutaneous. Other delivery methods are contemplated, including without limitation intra-nasal.
- Fig.13 provides an illustration of the conjugation of a recombinant antigen (denoted by the “vaccine antigen”) to a virus, with lighter- and darker-shaded ovals representing the extent of conjugation for the vaccine antigen depicted in the example.
- the lighter shade represents free virus, while the darker shade represents antigen conjugated to the protein coat of the virus.
- some viruses contain coat positioned proteins around the RNA genome.
- the viral vector TMV NtK includes N-terminal lysines that serve as connector points to the coat proteins.
- portions of the virus associated with N-terminal lysine residues are modified to enhance presentment for binding of recombinant antigen providing amine-targeted conjugation of the protein, for example antigen to virus.
- the viral radius greatly increases following conjugation of the recombinant antigens to the viral coat proteins.
- modification is performed when enveloped viruses are changed to allow enhanced presentment of their residues.
- Figures 14-16 show an analysis based on sodium dodecyl sulfate–polyacrylamide gel electrophoresis (“SDS-PAGE”) of the conjugation between H7 rHA to TMV at pH 5.50. As illustrated in these figures, nearly all of the H7 rHA was conjugated to the TMV within 2 hours. The disappearance of the rHA protein band and simultaneous appearance of complexes staining above the 200KDa marker indicates the complex formation. The reactivity of the bands with HA-specific antibodies further establishes this conclusion. [00167] SEC-HPLC reports also indicated successful conjugation of H7 rHA to TMV in accordance with the current embodiments of the conjugation platform. Fig.17 shows a SEC- HPLC report of free TMV product.
- SDS-PAGE sodium dodecyl sulfate–polyacrylamide gel electrophoresis
- Fig.17 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for fifteen minutes according to current embodiments of the conjugation platform.
- the SEC- HPLC report after H7 rHA is conjugated to TMV for fifteen minutes produced the signal data detailed in Table 5.
- Table 5. SEC-HPLC Data After H7 rHA is conjugated to TMV for 15 Minutes
- Fig.19 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for two hours according to current embodiments of the conjugation platform.
- Fig.19 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for two hours according to current embodiments of the conjugation platform.
- Fig.19 shows a SEC-HPLC report after H7 rHA is conjugated to TMV for two hours according to current embodiments of the conjugation platform. In Fig.
- the SEC-HPLC report taken after H7 rHA is conjugated to TMV for two hours produced the signal data detailed in Table 6 below. Table 6.
- SEC-HPLC Data After H7 rHA is conjugated to TMV for 2 Hours [00170] As illustrated in Figures 19 and 20, the SEC-HPLC reports indicated that all TMV rods were coated with some H7 rhA after conjugation for fifteen minutes, and more H7 rhA was added to the rods for up to two hours. After two hours, no additional conjugation was detected.
- the SEC-HPLC reports indicate that the conjugation reaction achieves at least about 50% reduction in non-conjugated, native molecular weight, virus coat protein, and that approximately 3% free TMV remained after conjugation took place for four hours.
- western blot analysis of the conjugate product indicated successful conjugation of H7 rhA to TMV via covalent attachment.
- Fig.20 shows a western blot analysis of the various steps of the conjugation platform according to current embodiments, wherein all samples were loaded at 10 ⁇ L.
- the various lanes illustrate different conjugation reaction times between the antigen and the virus. Lanes 14 and 13 show that all the TMV rods were coated with the antigen after fifteen minutes.
- Example 8 UV Inactivation of TMV NtK
- many regulatory agencies have enacted rules (such as the cGMP regulations) that require at least one effective inactivation step in the purification process of viral products. While UV-C radiation has been used in water treatment systems for many years, its use with biopharmaceutical products remains unexplored and there are limited studies regarding its ability to effectively inactivate viruses.
- the steps of the viral inactivation are as follows: [00176] Dilution of the TMV NtK solution to a concentration less than 50 micrograms/ml, as measured by A260 (which is a common method of quantifying nucleic acids by exposing a sample to UV light at a wavelength of 260 nm and measuring the amount of light that passes through the sample). [00177] 0.45 micron filtration of the TMV solution to remove bacteria and any other large species that might interfere with UV line of sight, and other purification steps according to present embodiments, occur immediately before inactivation with UV light.
- Inactivating the TMV NtK by exposing the virus to light in the UV spectrum with an energy density between about 2400 J/m 2 and about 5142 J/m 2 .
- the energy density of the UV light is between about 4800 J/m 2 and about 5142 J/m 2 .
- the wavelength of the UV light is 254 nm.
- reaction 1 exhibited successful conjugation (due to the ordered decrease in free TMV from zero minutes) while reaction 2 was unsuccessful as shown by the percent remaining free TMV.
- Table 7 Reaction 1, Successful Conjugation – TMV Formulated in Acidic pH Table 8.
- Reaction 2 Unsuccessful Conjugation – TMV Formulated in Phosphate Buffer
- virus activation occurs by formulating the virus in an acidic pH prior to the conjugation reaction such that positive charge aggregates on the virus surface.
- the activating step involves exposing the virus to a pH of about 5.5 or less for a period of time sufficient for activation. In some embodiments, such period of exposure to the conjugation environment is between about 18 and 72 hours.
- processing the purified virus in an acidic pH activates the virus by charging the coat protein lysine. As a result of this activation step in the conjugation environment, positive charges aggregate on the virus surface (as shown in Fig.22) via the clustering of the amine groups and the virus is ready for conjugation with the carboxyl end of the recombinant antigen.
- the virus activation steps are in contrast with traditional approaches in which the pH when storing viruses generally is maintained at or near neutral pH. As shown in Fig. 22, the traditional approach does not aggregate positive charge on the virus surface, and as a result the percent conjugation remains below 50% (see Table 8). Furthermore, the conventional approach utilizes phosphate buffers which promote solubility at the expense of having favorable surface charge. [00186] During the investigation of successful conjugations involving TMV, it was observed that successful conjugations generally occurred when the Dynamic Light Scattering (DLS)- measured radius of the virus increased during the activation step by at least a factor of 2.75 (see Table 9A, compared to Table 9B).
- DLS Dynamic Light Scattering
- the antigen pH target typically is pH 5.50 to 6.50, depending upon the nature of the molecule.
- the storage buffer is replaced with a MES/NaCl buffer at acidic pH using ultrafiltration.
- the protein concentration is also increased to greater than 3 mg/mL.
- the conjugation reaction is then initiated within four hours of antigen preparation completion to prevent destabilizing the protein structure.
- the steps for preparing the purified virus for conjugation are as follows: [00194] After storage at neutral pH, the virus is activated at acidic pH prior to conjugation.
- the virus is formulated from phosphate buffer at pH 7.4 into acetate buffer at pH 5.50 for a minimum of about 18 hours to a maximum of about 72 hours prior to the conjugation reaction start.
- the virus is formulated from phosphate buffer at pH 7.4 into acetate buffer at pH 4.50 for a minimum of about 18 hours to a maximum of 72 hours prior to the conjugation reaction start. It was observed that storage of the virus for greater than 72 hours at acidic pH creates self-association between the viruses which causes virus insolubility and inhibits the efficiency of the conjugation.
- Tables 9A and 9B further demonstrate the activation step in terms of increasing the radius of the virus (in this case, TMV) as measured by DLS.
- Table 9A provides data for DLS radius increase of TMV after being activated, and before a successful conjugation occurred, with the antigens listed in the right-hand column.
- the “Factor by which radius increased” divides the TMV radius after activation by the typical TMV radius at neutral pH, which is about 70 nm.
- Table 9B provides data for DLS radius increase of TMV after an activation step was started, in advance of unsuccessful attempts at conjugation, with the antigens listed in the right-hand column.
- the left column represents the standard radius of TMV rods at neutral pH and under general storage conditions, i.e., before any activation occurs.
- Table 9A Free TMV radii as measured by DLS (Prior to successful conjugation)
- Table 9B Free TMV radii as measured by DLS (Prior to unsuccessful conjugation) [00196] Following these preparation steps, the antigen and virus reactants were mixed to form a conjugate mixture and the conjugation progress was monitored using DLS and SDS- PAGE methods. Table 9C illustrates the average molecular radius of the conjugation reaction over time using DLS after the virus was activated using acidic pH. As shown in Table 9C, molecular radius is one indicator of successful coating of the viral rods with antigen molecules. Table 9C. TMV NtK SEC and DLS History [00197] In turn, Fig. 23 shows an analysis based on the SDS-PAGE of the conjugation between the activated TMV NtK and purified antigen according to multiple embodiments and alternatives.
- Example 10 TEM Imaging of Different Ratios of Purified Virus to Purified Antigen for Conjugation
- the desired conjugation reaction between purified virus and purified antigen is represented by the following formula: [00199] Virus + Antigen ⁇ Virus-Antigen (Formula 1) [00200]
- Virus + Antigen ⁇ Virus-Antigen + Antigen-Antigen (Formula 2)
- Self-conjugation of the purified antigen is a problem for the successful development of vaccines because the antigen-antigen conjugates are not removed during the size chromatography step and the result is a minimized or reduced immune response.
- Samples 1-3 were control groups and samples 4-7 contained different hemagglutinin (HA) to TMV ratios (at the mixing step of the conjugation platform, as shown at operative step 5 of Table 3).
- Table 10. TEM Imaging Samples – Control Groups Table 11.
- TEM Imaging Samples – Conjugates [00205] In the various designations listed herein, “KBP-VP” describes a TMV Antigen Presentation and is provided for reference purposes only.
- Fig.24 is a TEM image of sample 1 (free HA, lot 19UL-SG-001) at a magnification of 52,000x and a scale bar of 200 nm. In Fig.
- Fig. 25 is a TEM image of sample 2 (TMV NtK alone, lot 18HA-NTK-001) at a magnification of 52,000x and a scale bar of 200 nm.
- rod-shaped particles (arrow A) were observed in sizes ranging from ⁇ 125 nm to ⁇ 700 nm in length and ⁇ 18 nm to ⁇ 20.5 nm in width. These dimensions are consistent with the size and shape of TMV particles.
- a central ⁇ 4 nm channel was observed in the rods (arrow B), which is a known characteristic of TMV.
- Multiple rods were frequently aligned parallel to their long axis and the surface of the rods were generally smooth.
- small ⁇ 8 nm to ⁇ 10 nm globular particles (arrow C) were observed both associated with the surface of the rods and not associated with the rod-shaped particles in the background.
- Fig.26 is a TEM image of sample 3 (HA:HA Self-Conjugates with added TMV NtK, lot 19UL-SG-004) at a magnification of 52,000x and a scale bar of 200 nm.
- rod- shaped particles were observed that ranged from ⁇ 25 nm to ⁇ 885 nm in length to ⁇ 18 nm to ⁇ 20.5 nm in width (arrow A) and a central ⁇ 4 nm inner channel (arrow B).
- the rods were either not decorated at all or sparsely decorated with small, proteinaceous particles of various sizes and shapes (arrow C).
- Fig. 26 illustrates larger clumps of HA particles, but the TMV looks identical to the unconjugated TMV (shown in Fig. 25) as expected.
- Fig.27 is a TEM image of sample 4 (TMV:HA in a 1:1 ratio, lot 18 KBP-VP-SG- 002) at a magnification of 52,000x and a scale bar of 200nm.
- Fig.27 rod-shaped particles were observed that ranged in size from ⁇ 50 nm to more than ⁇ 1000 nm in length and ⁇ 18 nm to ⁇ 20.5 nm in width (arrow A) with a ⁇ 4 nm central inner channel (arrow B).
- the particle rods were similar in size and shape to the conjugated TMV observed in Fig. 28, with the exception that the majority of the rods were heavily decorated with small proteinaceous densities on their surface (arrow C). Some of the small, proteinaceous particles were also seen in the background, not associated with the rods (arrow D).
- the sample 5 shown in Fig. 27 looks superior to the other TEM images which is most likely due to the difference in virus treatment prior to conjugation.
- Fig.28 is a TEM image of sample 5 (TMV:HA in a 1:1 ratio, lot 19UL-SG-001) at a magnification of 52,000x and a scale bar of 200 nm.
- Fig.28 many rod-shaped particles were visible that ranged from ⁇ 65 nm to ⁇ 720 nm in length and ⁇ 18 nm to ⁇ 20.5 nm in width (arrow A) with a ⁇ 4 nm central inner channel (arrow B).
- the particle rods were similar in size and shape to the free TMV NtK (sample 2) observed in Fig. 25.
- the particle rods observed in Fig. 28 were moderately decorated with proteinaceous densities (arrow C). These densities were irregular in shape and size, and appeared to be randomly associated with the surface of the rods with no obvious pattern.
- Fig.29 is a TEM image of sample 6 (TMV:HA in a 4:1 ratio, lot 19UL-SG-002) at a magnification of 52,000x and a scale bar of 200 nm.
- rod-shaped particles were observed that ranged from ⁇ 25 nm to more than ⁇ 1000 nm in length, and ⁇ 18 nm to ⁇ 20.5 nm in width (arrow A) with a ⁇ 4 nm central inner channel (arrow B).
- Fig.30 is a TEM image of sample 7 (TMV:HA in a 16:1 ratio, lot 19UL-SG-003) at a magnification of 52,000x and a scale bar of 200 nm.
- TMV:HA in a 16:1 ratio, lot 19UL-SG-003
- Figs. 30 illustrate that the 1:1 ratio exhibited full rod decoration, the 4:1 ratio exhibited moderate decoration, and the 16:1 ratio exhibited sparse decoration.
- the 1:1 ratio generated virus rods with heavy antigen decoration (i.e. more density) of HA antigen while the 16:1 ratio generated viral rods with less antigen decoration (i.e. less density) of HA antigen on each rod.
- HA-HA self- conjugates were observed, principally in the 1:1 ratio reactions.
- Sedimentation velocity As measured in an analytical ultracentrifuge (“AUC”), is an ideal method for obtaining information about protein heterogeneity and the state of association of aggregation. Specifically, aggregates or different oligomers can be detected on the basis of different sedimentation coefficients. This method also detects aggregates or other minor components at a level below 1% by weight. Furthermore, SV provides high quality quantitation of the relative amounts of species and provides accurate sedimentation coefficients for any aggregates.
- Fig.31 is normalized sedimentation coefficient distribution for sample 1 (HA alone, lot 19S-G-001). Since free antigen is much smaller in size than virus, this sample was analyzed at a much faster rotor speed (35,000 rpm) than samples 2-7 (9,000 RPM) in order to adequately characterize the size distribution. As shown in Fig.31, sample 1 is somewhat homogeneous, providing 73.7% main peak at 8.967 S.
- Fig. 32 is the normalized sedimentation coefficient distribution for sample 2 (free TMV NtK, lot 18HA-NTK-001). As shown in Fig.32, no sedimenting material was detected below ⁇ 60 S. This sample appeared quite heterogeneous, with the most abundant peak sedimenting at 229 S (30.9%). The second most abundant peak was detected at 191 S (28.7%). It is not clear which peak corresponds to fully assembled virus. In addition, 25.3% of the total signal was observed sedimenting from 229 S to 2,000 S, the largest sedimentation coefficient allowed in this Example 11. It is unclear what the partially-resolved peaks from ⁇ 60 S to 2000 S represent.
- Figs. 33-37 show the normalized sedimentation coefficient distribution for virus- antigen conjugates. Each of these figures shows a significant absorbance of about 0.15 OD that did not sediment. This was established by increasing the rotor speed to 35,000 RPM after the completion of each run, in order to pelletize all remaining material. This material was not observed in either the free antigen or the free TMV NtK samples. However, since this material did not sediment, it did not affect the results of the measured size distributions. [00223] Fig.33 is the normalized sedimentation coefficient distribution for sample 3 (TMV to HA at 1:1 Ratio, lot 19UL-SG-004).
- Fig.33 is the normalized sedimentation coefficient distribution for sample 4 (TMV to HA at 1:1 Ratio, lot 18 KBP-VP-SG-002) and Fig.
- Figs.34 and 35 are the normalized sedimentation coefficient distribution for sample 5 (TMV to HA at 1:1 Ratio, lot 19UL-SG-001).
- the results shown in Figs.34 and 35 are similar to those discussed for sample 3 (and shown in Fig.33). However, some notable differences were observed. First, it is difficult to comment on differences observed for the free antigen sample (from 1 - 40 S) because of poor resolution at this rotor speed. Nevertheless, Figs. 34 and 35 show more total signal present from 40 S – 2,000 S (which is indicative of virus associated material) than sample 3.
- Fig.36 is the normalized sedimentation coefficient distribution for sample 6 (TMV to HA at a 4:1 ratio, lot 19UL-SG-002)
- Fig.37 is the normalized sedimentation coefficient for sample 7 (TMV to HA at a 16:1 ratio, lot 19UL-SG-003).
- Fig.36 shows 91.1% total virus- associated material (i.e. virus-antigen conjugates)
- Fig. 37 shows 99.4% virus-associated material (i.e. virus-antigen conjugates).
- the results for the virus-antigen normalized sedimentation coefficient distribution, as shown in Figs.33-37, are set forth in Table 14.
- the fraction between 1 - 40 S indicates the percent HA monomer/trimer, and the fraction between 40 – 2000 S indicates the percent TMV NtK-HA conjugate, according to multiple embodiments and alternatives.
- Table 14 SV-AUC Results of the Different Virus-Antigen Conjugates 000 A
- mice were administered the conjugates as vaccines via intramuscular injection. Each vaccine was a TMV:HA conjugate produced at a 1:1 (TMV:HA) ratio as described herein, administered to most of the animals on Day 0 and 14 of the study (control animals were administered buffer alone, TMV alone, or HA alone).
- HAI hemagglutination inhibition
- H3N2 vaccine Influenza A/ Singapore/INFIMH-16- 0019/2016.
- the number of animals within this cohort responding measurably to H1N1 vaccine was 8/29 with a single animal at 80 HAI titers and all others less.
- the number responding measurably was 14/29, also with a single animal at 80 HAI titers and all others less.
- SEM standard error of the mean
- mice received vaccines for Influenza B viruses (B/Colorado/06/2017 (V) and B/Phuket/3073/2013 (Y), respectively). No response was detected in these animals on any of the days, as expected because B-type influenza viruses and corresponding HA immunogens are known to not generate HAI titers in mice with the efficiency and effectiveness as A-type HA immunogens.
- Table 15 Immune response based on dose and time post-vaccination p
- mice Separate from the previously described immune response study, and to further evaluate the inventive system in terms of suitable virus to antigen ratios, the humoral immune response in mice was evaluated following vaccination at various TMV:HA conjugate ratios (i.e., 1:1, 4:1, 16:1) of both Influenza A Antigen and Influenza B Antigen along with controls as noted below. In this manner, various conjugation ratios and their effect on immune response were studied.
- the mice receiving vaccination were administered 15 mcg HA via injection on Day 0 and Day 14 of the study, in a subcutaneous region dorsally.
- the serum antibody responses to the vaccination were then analyzed for HA-specific activity.
- Tables 15 H3 influenza virus used as capture protein
- 16 recombinant H3 protein used as capture protein
- Table 16 show the groupings of mice (12 mice per grouping), and the agents that were administered, with the right-hand column in each table presenting ELISA antibody (Ab) titers results.
- Table 16 TMV:HA ratio study – A-type influenza HA.
- Figure 38 is a scatterplot associated with Table 16, which provides graphical analysis of H3:HA Ab titers following administration of vaccine at ratios of 0, 1:1, 4:1, and 16:1 (TMV:HA).
- Figure 39 also illustrates graphically the results of geometric mean testing of antigen-relevant Ab titers, using recombinant H3 antigen (Table 17) as coating or capture H3 virus as capture protein (Table 17) that binds with anti Influenza A H3 Antigen antibody.
- density surface area of TMV occupied by HA
- the trend for the three ratios progresses from 1:1 (most dense) > 4:1 > 16:1 (least dense), as demonstrated by TEM and AUC analyses.
- the highest immune response was observed with the least dense conjugate. That is, the trend for immune response was 16:1 > 4:1 > 1:1 and went in reverse of the trend for density.
- Influenza B Antigen In addition to Influenza A H3 Antigen, Influenza B Antigen also was studied (B- Dahl HA) using the binding propensity of recombinant Influenza B Farm Antigen and its corresponding antibody. Table 17, below, presents the results of this part of the study that was there is not as clear of a showing of 16:1 > 4:1 > 1:1 based on the results of average ELISA Ab titers. Table 17. TMV:HA ratio study – B-type influenza HA. [00235] Even so, the 16:1 ratio demonstrated the highest average antibody titer. Thus, is reasonable to predict the same relationship between density and immune response applies to the study of the Influenza B Antigen (B-Phuket HA).
- a product conjugated in accordance with any of multiple embodiments and alternatives described herein may be utilized as a vaccine by delivering the purified antigen via a purified virus, such as but not limited to the virus-antigen conjugates described in Examples 7, 9, 10, 11, and 12.
- embodiments of the present disclosure include any vaccine products packaged in any number of forms (e.g., vial) with appropriate buffers and additives, being manufactured from any virus-protein conjugate compositions, the conjugation of which is provided for herein.
- embodiments include those wherein such vaccine products are amenable to delivery in the form of unit doses provided to a subject, such as but not limited to administration by syringe or spray through routes that include, but are not limited to, subcutaneous, intramuscular, intradermal administration, and nasal, as well as administration orally by mouth and/or topically, to the extent clinically indicated.
- the size of TMV (typically 18 nm x 300 nm) and its rod-like shape promotes antigen uptake by antigen presenting cells (APCs), and thus serves to enhance immunity promoted by T cells (such as Th1 and Th2), including cellular responses, and to provide adjuvant activity to surface conjugated subunit proteins.
- APCs antigen presenting cells
- This activity is also stimulated through viral RNA/TLR7 interaction.
- Humoral immunity is typically balanced between IgG1 and IgG2 subclasses through subcutaneous and intranasal delivery.
- responses Upon mucosal vaccine delivery, responses also include substantial systemic and mucosal IgA.
- Cellular immunity is also very robust, inducing antigen-specific secretion, similar to a live virus infection response.
- Whole antigen fusions allow for native cytotoxic T lymphocyte (CTL) epitope processing, without concern for human leukocyte antigen (HLA) variance.
- CTL cytotoxic T lymphocyte
- HLA human leukocyte antigen
- the impact of these immune responses is that vaccines created via the multi-set platform, according to current embodiments, promotes highly protective responses as single dose vaccines and offers speed and safety not offered by other conventional vaccine platforms.
- the conjugation platform is shown to work on a wide array of viruses and proteins (including antigens), combined within a broad range of ratios and successfully administered at various doses, which again are indicative of the robustness of the system.
- Additional advantages of the multi-set platform for producing vaccines in current embodiments include: a proactive antigen-stimulating approach for systemic immune protection against pathogen challenge, the platform is highly adaptable to produce antigenic domains from disease pathogens (including virus glycoproteins or non-secreted pathogen antigens), and the platform serves as an efficacious vaccine platform for both virus and bacterial pathogens.
- plant virus particles purified via the multi-set platform according to current embodiments can be formulated for various drug delivery purposes.
- the multi-set platform could be utilized as a drug delivery tool by first causing the purified virus to swell by exposing it to a pH shift as discussed above.
- the virus in this condition would be incubated with a solution of concentrated chemotherapeutic agent, such as doxorubicin, and the pH is then reverted to neutral thereby causing the virus to return to its pre-swollen state and thereby entrapping the chemotherapeutic molecules.
- a delivery mechanism chosen from a group that includes, but is not necessarily limited to, injection for targeted treatment of tumors.
- the above descriptions offer multiple embodiments and a number of alternative approaches for (i) the plant-based manufacture and purification of viruses; (ii) the plant-based manufacture and purification of antigens; and (iii) the formation of virus-antigen conjugates outside the plant that are therapeutically beneficial as vaccines and antigen carriers; and (iv) the delivery of therapeutic vaccines comprising a purified virus and purified antigen.
- Example 13 – Vaccine Stability Under Refrigerated and Room Temperature Conditions [00241] Vaccines have dramatically improved human and animal health. For instance, in the 20 th Century alone, vaccines have eradicated smallpox, eliminated polio in the Americas, and controlled a variety of diseases throughout the world.
- influenza vaccines are highly unstable and very sensitive to changes in temperature. As discussed in F. Coenen et. al., Stability of influenza sub-unit vaccine. Does a couple of days outside the refrigerator matter? Vaccine 24 (2006), 525-531, influenza vaccines are generally unacceptable and inactive after five weeks at room temperature storage (i.e. ⁇ 25°C). Of all the influenza vaccines discussed in the F. Coenen article, only one vaccine exhibited stability for 12 weeks at room temperature storage. In many situations, this is a significant problem with other vaccine types too, as well as for individual specific components (e.g. intermediates) of vaccines.
- vaccines generally have had to be refrigerated during the entire supply chain from the moment of commercial production until administration, often referred to as the “cold chain.”
- cold chain While in a refrigerated environment, the majority of vaccines remain stable for the typical seventy-eight week goal of stability.
- the absolute requirement for cold chain is a global problem that has limited the availability of vaccines worldwide because it is often difficult to guarantee in developing countries and has led to widespread vaccine loss.
- Many efforts have been made to create room temperature stable vaccines, but as discussed in the literature, those efforts have been unsuccessful.
- the cold chain is very costly to maintain for manufacturers, as well as the doctors and organizations receiving, storing, and applying the vaccines to populations.
- the inventive purification and conjugation platform extends the stability of protein-virus conjugates under both refrigerated and room temperature conditions.
- antigen quality and vaccine stability There are several methods for determining antigen quality and vaccine stability including: (1) protein concentration as measured by BCA Protein assay (which is based on the principle that proteins can reduce Cu 2+ to Cu +1 in an alkaline solution which results in a purple color formation), (2) storage potency as measured by VaxArray ⁇ antibody array binding (which utilizes multiplexed sandwich immunoassays), (3) SDS-Page purity as measured in terms of a single migrating band, (4) pH as a measurement of the physical pollution properties, and when possible, (5) size exclusion chromatography to characterize the multimeric structure of the antigen.
- BCA Protein assay which is based on the principle that proteins can reduce Cu 2+ to Cu +1 in an alkaline solution which results in a purple color formation
- storage potency as measured by VaxArray ⁇ antibody array binding (which utilizes multiplexed sandwich immunoassays)
- SDS-Page purity as measured in terms of a single migrating band
- pH as a measurement of the physical pollution
- a bioburden test is also conducted to analyze the presence of bacteria or mold contamination (in the tables below “TAMC” is an abbreviation for Total Aerobic Microbial County and “TCYM” is an abbreviation for Total Combine Yeast/Mold Count).
- TAMC Bacillus AAAA
- TMC Total Aerobic Microbial County
- TYM Total Combine Yeast/Mold Count
- a vaccine is considered unacceptable for use if it fails the BCA Protein assay, the VaxArray ⁇ test, or the SDS-Page analysis. In other words, if a vaccine fails any one of these three tests, the vaccine is unacceptable for use and inactive.
- the VaxArray ® potency assay is used to assess with improved sensitivity a range of strains of different viruses and effects of vaccines in treating them, including pandemic strains of SARS-CoV2 and influenza.
- VaxArray ® assay relevant to influenza viruses and vaccines are described in Byrne-Nash, Rose T., et al., “VaxArray potency assay for rapid assessment of ‘pandemic’ influenza vaccines,” npj Vaccines 3, 43 (2016). With the occurrence of the SARS- CoV-2 pandemic in 2020, VaxArray ® potency assays are commercially available for the study of coronaviruses, vaccines, and vaccine intermediates.
- influenza HA antigens produced and purified in accordance with multiple embodiments and alternatives: H1NI (A/Michigan), H3N2 (A/Singapore), H1N1 (A/Brisbane), H3N2 (A/Kansas), B/Colorado, and B/Phuket.
- H1NI A/Michigan
- H3N2 A/Singapore
- H1N1 A/Brisbane
- H3N2 A/Kansas
- B/Colorado B/Phuket.
- the following tables provide the stability data and storage potency as measured at release and various times after filling into vials and stored under refrigerated conditions (2° to 8°C).
- an initial concentration or integrity refers to the concentration or integrity of a compound, conjugate mixture, pharmaceutical product, vaccine, or the like at its release date (i.e.
- Table 20 Stability of H1N1 (A/Brisbane) Under Refrigerated Conditions Table 21. Stability of H3N2 (A/Kansas) Under Refrigerated Conditions Table 22. Stability of B/Colorado Under Refrigerated Conditions Table 23. Stability of B/Phuket Under Refrigerated Conditions [00245] Tables 18-23 illustrate that the purified free antigens exhibit different patterns of stability. For instance, some antigens like H1NI (A/Michigan) and H3N2 (A/Singapore) appeared stable after 6 months with no significant deviations in measurements (as is typically observed).
- Fig.40 is a SDS-PAGE analysis of purified B/Phuket after 1 month under refrigerated conditions.
- the degradant bands of lower molecular weight below the intact band at ⁇ 60 kDA indicate that the purified B/Phuket antigen has degraded.
- the data in Tables 18-23 and Fig.40 indicate that different proteins exhibit different stabilities under refrigerated conditions.
- an inventive method enhances a measure of stability of a conjugated compound comprising a protein and virus particle, and includes activating the virus particle and then mixing the virus particle and the antigen in a conjugation reaction to form a conjugate mixture, resulting in enhanced stability when the conjugated compound is placed in an unrefrigerated environment and after a time period of at least 42 days following a release date.
- An exemplary storage temperature is at least 20 o C. The stability enhancement can be gauged by comparing the stability of the conjugate mixture to that of the antigen alone.
- a suitable measure is any one or more of antigen concentration, antigen integrity, or antigen potency.
- the measure of stability is antigen concentration, as measured by BCA or other appropriate methodology, a difference between concentration of the conjugated compound and concentration of the antigen alone of at least 10% is within the scope of present embodiments.
- the measure of stability is antigen integrity, as measured by SDS-PAGE, SEC- HPLC or other appropriate methodology, a difference between integrity of the conjugated compound and integrity of the antigen alone of at least 10% is within the scope of present embodiments.
- the measure of stability is antigen potency, as measured by antigen-antibody interaction based on ELISA results, or VaxArray ⁇ , surface plasmon resonance or other appropriate methodology, a difference between potency of the conjugated compound and potency of the antigen alone of at least 30% is within the scope of present embodiments.
- Table 24 Stability of the H1NI (A/Michigan) to TMV Conjugate Under Refrigerated Conditions
- Table 25 Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions
- Table 26 Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions
- Table 27 Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions
- Table 28A Stability of the H1NI (A/Michigan) to TMV Conjugate Under Refrigerated Conditions
- Table 28B Stability of the H1NI (A/Michigan) to TMV Conjugate Under Refrigerated Conditions
- Table 29A Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions
- Table 29B Stability of the H3N2 (A/Singapore) to TMV Conjugate Under Refrigerated Conditions
- Table 30A Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions
- Table 30B Stability of the B/Phuket to TMV Conjugate Under Refrigerated Conditions
- Table 31A Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions
- Table 31B Stability of the B/Colorado to TMV Conjugate Under Refrigerated Conditions
- Table 32 The following tables provide the stability data of several other monovalent formulations (at a TMV to antigen ratio of 8:1) at release and various times after filling into vials, and stored under refrigerated conditions (2° to 8°C) or under room temperature conditions (22° to 28°C): Table 32. Stability of the H1N1 (A/Brisbane) to TMV Conjugate Under Refrigerated Conditions Table 33. Stability of the H1N1 (A/Brisbane) to TMV Conjugate Under Room Temperature Conditions Table 34.
- the purity, pH, protein concentration, and storage potency is maintained through at least six months of storage, and for others at least 12 months of storage, under refrigerated conditions. Further, the polydiversity is also consistent over this timeframe. Polydiversity refers to the variability of particle size in a complex product, and generally the lower the polydiversity than the better the product. Likewise, the purification and conjugation platform, according to multiple embodiments and alternatives, successfully maintained the stability and potency of a variety of antigens and utilized a variety of conjugation ratios, illustrating its versatility.
- the following quadrivalent conjugate produced according to multiple embodiments and alternatives at a 1:1 TMV to antigen ratio exhibits strong stability under both refrigerated (2° to 8°C) and room temperature (22° to 28°C) conditions: Table 40A. Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Refrigerated Conditions
- Table 40B Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Refrigerated Conditions Table 41A. Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Room Temperature Conditions Table 41B. Stability of the Quadrivalent Conjugate (at a 1:1 Ratio) Under Room Temperature Conditions [00252]
- the following quadrivalent conjugate produced according to multiple embodiments and alternatives at a 8:1 TMV to antigen ratio, exhibited strong stability under both refrigerated (2° to 8°C) and room temperature (22° to 28°C) conditions.
- Fig.41A is a graph of the QIV stability at refrigerated temperatures of 2-8 o C from Tables 42A and 42B (referred to as Routine Stability in the figure).
- Fig.41(B) is a graph of QIV stability at a higher temperature range of 22-28 o C from Tables 43A and 43 B (referred to as Accelerated Stability in the figure). As shown in Figs.
- the following quadrivalent utilized four different HA conjugated to a modified TMV NtK carrier, which included the following antigens: H1 (Brisbane), H3 (Kansas), B/Y (Phuket), B/V (Colorado).
- Table 44 Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Refrigerated Conditions
- Table 45 Stability of the Quadrivalent Conjugate (at a 8:1 Ratio) Under Room Temperature Conditions
- Table 46 provides the percent change in the storage potency of the various antigens described in Tables 41A and 41B by comparing the initial potency to the storage potency at the particular time. Table 46.
- the storage potency at the end of 30 days was at least 70% of the initial potency of the conjugate mixture within the first day post-conjugation.
- the storage potency of the conjugate mixture stored in the unrefrigerated environment was at least 68% of the initial potency, and the storage potency of the conjugate mixture was at least 75% at the end of at least 180 days.
- the stability of the conjugate is also shown in terms of antigen concentration.
- Tables 31-34 the purification and conjugation processes, according to multiple embodiments and alternatives, stabilized the antigen’s physical properties, antigenic reactivity and other quantitative stability features.
- Tables 41A to 45, and Figure 41B illustrate that the quadrivalent conjugate, produced according to multiple embodiments and alternatives, exhibits strong stability measures for at least six months, or twenty-four weeks, at room temperature storage (22° to 28°C). Compared to conventional vaccines which exhibit an average stability of ⁇ 5 weeks at room temperature (as discussed in the F.
- the vaccines according to multiple embodiments and alternatives exhibit stability for at least 5x greater than conventional influenza vaccines and several times longer than purified antigens. Accordingly, the formulation and conjugation processes according to multiple embodiments and alternatives stabilize extremely unstable antigens – such as B/Colorado – and extend the stability of other antigens – such as H3N2 (A/Singapore), H1NI (A/Michigan), and B/Phuket – far beyond the stability limits of free-antigens and conventional vaccines.
- Example 14(a) to 14(h) – Quadrivalent Influenza Vaccine Studies [00261]
- QIV vaccine quadrivalent seasonal vaccine candidate
- the subject QIV vaccine contained the following influenza HA antigens from the 2018/2019 North America seasonal influenza vaccine strains recommended by the World Health Organization, the Centers for Disease Control and Prevention, and the FDA’s Vaccines and Related Biological Products Advisory Committee (VRBPAC), (A/Michigan/45/2015(H1N1)pdm09, A/Singapore/INFIMH-16-0019/2017 (H3N2), B/Phuket/3073/2013 (B Yamagata lineage), and B/Colorado/06/2017 (B Victoria lineage), conjugated to inactivated TMV NtK.
- VRBPAC Vaccines and Related Biological Products Advisory Committee
- the four vaccine antigen conjugates in a phosphate buffer solution with 0.01% thimerosal as a preservative (as a non- limiting example), are blended together to create a single injectable, quadrivalent vaccine formulation.
- a phosphate buffer solution with 0.01% thimerosal as a preservative as a non- limiting example
- these studies demonstrated that the embodiments disclosed herein augment the immunogenicity of recombinant hemagglutinin protein antigens. This was determined by various measures and analyses, including hemagglutination inhibition and neutralizing antibody titers.
- the studies described in this example indicate the QIV seasonal vaccine is immunogenic, as it provided a level of protection in all mammalian disease models tested to date from challenge with viral strains homologous to the vaccine strain HA antigens.
- GLP refers to Good Laboratory Practices, such as the CPMP Note for Guidance on Preclinical Pharmacological and Toxicological Testing of Vaccines (CPMP/SWP/465/95) and the World Health Organization Guidelines on Non- Clinical Evaluation of Vaccines (WHO Technical Report Series, No. 927), with the full contents of both being incorporated by reference herein. Additional discussion of various aspects of the studies follows the table. Table 51. Overview of QIV Non-Clinical Studies for Example 14(a) to 14(h)
- Table 53 (below) provides the number of animals that generated detectable HAI titers, the titer range from positive animals, and the geometric mean titer (GMT).
- HAI titers were detectable at antigen doses as low as 1.5 ⁇ g in a few animals with the majority of animals generating antibody titers at 7.5 ⁇ g per HA antigen. No detectable titer was produced by the mice that had been vaccinated with the monovalent vaccine to the other three strains tested. While less pronounced, the QIV vaccine also induced HAI titers in a subsect of mice against B/Colorado/06/2017.
- the monovalent formulation vaccine induced a detectable humoral immune response to the H3N2 virus.
- the QIV formulation induced a detectable humoral immune response against three of the four antigens.
- the induced immune response against influenza H1N1 and H3N2 antigens seen in mice vaccinated with the monovalent and QIV vaccine formulations was dose dependent. As shown in Table 37, the H1N1 GMT ranged from 20 to 279 (increasing with the increasing dose) and the H3N2 GMT ranged from 20 to 52.
- Fig. 42 shows the QIV vaccine induction of H1N1 and H3N2 hemagglutination inhibition (HAI) titers in the mice over time.
- the data includes the geometric mean titer (GMT) of BALB/c mice dosed with 15 ⁇ g per HA of QIV vaccine.
- the mice with a titer value ⁇ 10 were assigned a titer value of 5 for GMT calculation, in accordance with the previously mentioned Armitage and Berry.
- HAI titers were only observed in animals receiving the QIV vaccine (referred to in Fig. 42 as “KBP-VP H1NI” and KBP-VP H3N2”) and only to the H1N1 and H3N3 antigens. There was no detectable immune response generated to the unconjugated antigens. Titers were below detectable levels until Day 21 against A/Michigan/45/2015 (H1N1) and A/Singapore/INFIMH-16-0019/2017 (H3N2). HAI titers remained detectable on Day 28 and Day 42 and were highest on Day 90.
- Quadrivalent vaccine antigens (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2017 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) alone, not conjugated to TMV NtK Carrier d.
- QIV Vaccine (A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16-0019/2017 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) conjugated 1:1 TMV NtK:HA Antigen Table 56.
- A/Michigan/45/2015 H1N1
- A/Singapore/INFIMH-16-0019/2017 H3N2
- Quadrivalent vaccine antigens A/Michigan/45/2015 (H1N1pdm09); A/Singapore/INFIMH-16- 0019/2017 (H3N2); B/Colorado/06/2017 (Vict); B/Phuket/3073/2013 (Yam) alone, not conjugated to TMV NtK Carrier d.
- mice were also monitored for clinical signs and injection site reactions. At necropsy, organ weights were measured and gross necropsy and histopathology on tissues was performed. There were no test article-related gross findings for any animals necropsied on Day 21 or Day 90.
- PFU plaque forming units
- Virus Neutralization (VN) titers were detected against all viruses, with order of descending response: A/Michigan/45/2015 (H1N1)pdm09, A/Singapore/INFIMH-16-0019/2017 (H3N2), B/Phuket and B/Colorado/06/2017 showing lowest response.
- A/Michigan/45/2015 H1N1pdm09
- A/Singapore/INFIMH-16-0019/2017 H3N2
- B/Phuket B/Colorado/06/2017 showing lowest response.
- Fig. 44 illustrates the nasal wash titers following the H1N1 challenge (log10 TCID 50 /mL), wherein the QIV vaccine is referred to as “QIV”.
- Fig.44 there were no statistical differences in viral titers at Day 2 post-challenge, however, an increase in average body temperature of 1.0° C was only observed in placebo controls.
- all three vaccine groups yielded statistically reduced viral titers with the QIV vaccine showing dose-dependent log reductions (2.3 and 1.9 log10 TCID50/mL) that were statistically greater than Fluzone ® (0.83 log10 TCID50/mL).
- the p value is less than 0.05 for the Fluzone ® value compared to the placebo, and the p value is less than 0.001 for the QIV value compared to Fluzone ® .
- Fig. 45 illustrates the nasal wash titers following the H3N2 challenge (log10 TCID 50 /mL), wherein the QIV vaccine is referred to as “QIV”. As shown in Fig.45, following challenge with A/Singapore/INFIMH-16-0019 (H3N2), virus was detected in the nasal washes of all challenged ferrets on Days 2 and 4 post-challenge.
- the QIV vaccine of the present example induced a detectable humoral immune response against the four antigens tested in HI and VN assays.
- a strong VN response corresponded with a reduction in nasal wash viral titers observed on Day 4 post challenge in vaccinated ferrets challenged with A/Michigan/45/2015 (H1N1)pdm09.
- the log reduction in viral titers observed on Day 4 in the QIV vaccinated ferrets was 1.1 to 1.5 log greater when compared to Fluzone ® .
- H3N2 a strong HI response was observed in all three groups of vaccinated ferrets.
- FIG. 46 illustrates the immunogenicity of the monovalent vaccine produced at varying ratios of TMV NtK: HA antigen.
- the relative IgG titers are expressed as ng IgG per mL of serum.
- IgG titers induced by the monovalent vaccines prepared with increasing TMV-NtK: HA antigen conjugation ratios continued to show a significant improvement compared to the benchmark 1:1 ratio group.
- the 8:1 and 16:1 vaccine formulations induced the highest mean response that was stable over time.
- the study used a RT-qPCR methodology that was developed and qualified to measure the TMV NtK viral RNA extracted from tissue or blood, and the study compared two different QIV vaccine formulations prepared with differing amounts of the TMV NtK carrier.
- the analyzed tissues included blood, skeletal muscle (injection site), lymph nodes, spleen, thymus, heart, liver, lung, kidney and tested.
- Fig.47 shows the comparative distribution of the TMV vRNA in tissues over time as measured by RT-qPCR following a single injection of two different QIV formulations, incorporating either 45 ⁇ g (1:1 formulation monovalent vaccine) or 1440 ⁇ g (8:1 formulation quadrivalent vaccine) of the TMV NtK carrier in a 0.5 mL dose (as non-limiting examples).
- Fig.48 shows the biodistribution of the TMV vRNA in tissues by organ and dose group eight days after a single injection.
- “LOQ” refers to the limit of quantitation
- LOD refers to the limit of detection.
- Figs. 47 and 48 the highest levels of the QIV were quantifiable from injection site skeletal muscle tissue through the study duration with amounts decreasing over time with both formulations. After skeletal muscle, the QIV was most abundant and detected throughout the study in spleen and draining lymph nodes, indicating that QIV traffics to these tissues post-immunization. Transient levels were detected in liver, heart, and testes at the 24 hour-post dosing time point and then below the LOQ with both formulations thereafter.
- the 8:1 formulation had low, transient signal detected in blood, lung, and thymus tissues 24 hours post-immunization that were below the limit of quantitation (LOQ) by Day 3 post-immunization, which is likely due to the 32-fold higher amounts of TMV NtK included in that formulation. No quantifiable QIV residuals were detected in brain or kidney tissue with either QIV formulation. [00296] Accordingly, in all formulations the vaccine was observed to traffic from the injection site to immune organs and no accumulation was observed in non-target organs. Likewise, the TMV-specific Q-RT-PCR signal was observed to be dose dependent when measured at site of injection with rapid clearance from all non-target organs.
- the QIV vaccine was administered as a single intramuscular injection on an annual basis.
- N+1 a strategy of the number of human doses plus 1 (N+1) was used with the second dose administered 28 days following the first dose.
- Test articles included the intended human high dose of the QIV vaccine at each conjugation level of the TMV NtK carrier molecule (1:1 and 8:1 formulations) and the high dose of the TMV NtK carrier alone.
- Example 14(g) - 1:1 QIV formulation 7 [00300]
- the test articles were administered by intramuscular (IM) injection on study Days 1 and 29.
- animals in each group received 0.5 mL of the control article (Group 1), low dose vaccine (Group 2), or high dose vaccine (Group 3) using a 25-gauge needle attached to a plastic, 1-mL syringe (as non-limiting examples).
- the administration site was the relatively large muscle mass on the posterior aspect of the hind limb and was shaved or re- shaved (as appropriate).
- the administration site was wiped with alcohol and allowed to dry thoroughly for a minimum of 10 minutes prior to dosing.
- the IM administration site alternated between hind limbs with the right hind limb receiving the first dose.
- Five rabbits/sex/group were euthanized on Study Day 31 (two days after the last dose), while the remaining study animals (4/sex/group) continued to be observed and were euthanized on study day 57 (28 days after the last dose).
- Fibrinogen levels were increased (p ⁇ 0.05 or ⁇ 0.01) in the vaccine treatment groups usually at two days post dose. The increase in fibrinogen in these groups was considered to be related to vaccine treatment, but was considered an expected (inflammatory) response following treatment with an immunogenic substance. Fibrinogen was no longer increased (p > 0.05) at the end of the 28-day recovery period (reversible effect).
- Mixed cell infiltration in the left sciatic nerve and injection site was a common microscopic finding seen in the intramuscularly dosed vaccine toxicology studies. This lesion was recoverable in the sciatic nerve, but not fully recovered in the injection site at the end of the 28-day recovery period.
- Example 14(h) - 1:1 QIV formulation The test articles were administered by IM injection on Study Days 1 and 29. At each injection, animals in each group received 0.5 mL of the control article (Group 1), low dose vaccine (Group 2), or high dose vaccine (Group 3) using a 25-gauge needle attached to a plastic, 1-mL syringe (as non-limiting examples). The administration site was the relatively large muscle mass on the posterior aspect of the hind limb and was shaved or re-shaved (as appropriate). On each day of injection, the administration site was wiped with alcohol and allowed to dry thoroughly for a minimum of 10 minutes prior to dosing.
- the IM administration site alternated between hind limbs with the right hind limb receiving the first dose.
- Four rabbits/sex/group were euthanized on study day 31 (two days after the last dose), while the remaining study animals (4/sex/group) continued to be observed and were euthanized on study day 57 (28 days after the last dose).
- Fibrinogen levels were increased (p ⁇ 0.01) in the treated groups usually at two days post dose. The increase in fibrinogen in these groups was considered to be related to treatment, but was considered an expected (inflammatory) response following treatment with immunogenic substances. Fibrinogen was no longer increased (p > 0.05) during the recovery period (reversible effect).
- IM administration of the QIV vaccine candidate, or inactivated TMV NtK at doses of either 45 ⁇ g of each HA antigen (180 ⁇ g total HA + 180 ⁇ g TMV NtK) or 1440 ⁇ g of each HA antigen, respectively, once every four weeks for two injections (Study Days 1 and 29) was well tolerated.
- the findings in these GLP toxicological studies did not result in any adverse or limiting toxicity, were considered to be of minimal toxicological significance (e.g., noted in only one sex, reversible, transient, no alteration in organ function, etc.), and/or were anticipated findings (such as fibrinogen increases) following administration of immunogenic substances.
- Fig. 49 illustrates the total anti-HA IgG ELISA analysis from rabbit serum samples following QIV vaccine immunizations on Day 1 and Day 29. As shown in Fig.
- HAI titers were detected in most animals on study days 42, 49, and 57 against A/Michigan/45/2015(H1N1), A/Singapore/INFIMH-16-0019/2019 (H3N2) and B/Colorado/06/2017 viruses (as non-limiting examples).
- HAI titers against the B/Phuket/3073/2013 virus were generally seen in 4 or fewer animals on Study Days 42, 49, and 57 Table 62.
- Percentage of Animals with Detectable HAI Titers on Study Day 49 of the GLP Toxicology Studies [00314] Fig.
- the primary measure of immunity was the generation of HAI antibody titers, the recognized serum biomarker of protection for influenza infection.
- the humoral immune response was predominantly detected following a second (booster) immunization.
- Immunogenicity to the vaccine hemagglutinin antigens was dependent upon conjugation to the TMV NtK carrier.
- the QIV vaccine prepared at a ratio of 8:1 TMV NtK carrier-to-recombinant HA antigen was shown to be desirable.
- immunization of ferrets with QIV significantly reduced viral loads in animals subsequently challenged with homologous H1N1 and H3N2 strains as assessed from nasal wash samples.
- a Covid-19 vaccine was produced by forming an antigen through the expression of a recombinant version of the RBD SARS-2 spike protein fused to the Fc domain of a human IgG1 in Nicotiana benthemiana (Nb) plants (as a non-limiting example). Before conjugation, the formed antigen was then purified according to an antigen purification platform as described herein, in accordance with multiple embodiments and alternatives, and the TMV virus particles were purified and inactivated according to a virus purification platform described herein, in accordance with multiple embodiments and alternatives.
- the purified recombinant RBD-Fc antigen was then conjugated to the purified and inactivated TMV virus particle in accordance with the teachings of multiple embodiments and alternatives herein.
- the RBD-Fc to TMV conjugate Upon delivery to a mammalian subject (e.g., human or animal), the RBD-Fc to TMV conjugate presents the SARS-2 spike glycoprotein RBD fused to the human IgG1 Fc domain via the chemical conjugation to the TMV virus particles.
- the presentation of the RBD-Fc fusion in this embodiment has been demonstrated to enhance Th1 and Th2 responses in all mammalian disease models tested to date.
- the antigen for the Covid-19 vaccine was selected by targeting the RBD domain of the SARS-2 spike glycoprotein because it serves as the binding site for the human ACE-2 receptor and the binding site overlaps with characterized neutralizing antibodies.
- the SARS-2 spike glycoprotein is found in the S1 subunit at the amino acids numbered approximately 320 to 520.
- the SARS-2 spike trimer is shown in space- filling model with RBD circled in lateral and vertical views.
- Fig.51(B) shows the RBD domain fused to a human 171 allotype IgG1 Fc domain, expressed and purified from plants according to multiple embodiments and alternatives.
- SARS- 2 RBD is a binding site for neutralizing antibodies.
- CR 3022 is a human mAb isolated from a SARS patient that binds a domain in the SARS-2 RBD domain. CR 3022 binding can neutralize both SARS-1 and SARS-2 CoV.
- the SARS-2 RBD also presents the ACE-2 (angiotensin II) binding domain.
- multigenic constructs were designed and built to contain genes encoding the proteins necessary to synthesize a Covid-19 antigen targeting the RBD domain of SARS-2.
- the following antigen sequence (collectively referred to herein as the “RBD-Fc 121 Construct”) was used for the synthesis of a Covid-19 antigen: 1.
- (SEQ ID NO: 2) SARS-2 virus Spike amino acids numbered 331-632: NITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKL NDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSK VGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNG VGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKK FLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVN CTEVPVAIHADQLTPT 3.
- FIG. 52 shows an assembled TRBO expression plasmid for a SARS-CoV2 RBD-Fc fusion peptide (i.e., antigen) for production in Nb plants. Successful infiltration and plant incubation were followed by extraction and purification of the antigen as described herein.
- SARS-CoV2 RBD-Fc fusion peptide i.e., antigen
- a fusion peptide was formed having a first peptide which comprises a receptor binding domain (RBD) of a pathogen (specifically, a coronavirus and namely the SARS-CoV-2 spike (S) glycoprotein RBD), fused to a second peptide which comprises a fragment crystallizable (Fc) region of an antibody (containing a sequence of amino acids as set forth in SEQ ID NO: 4, human IgG1 Fc domain), and a hinge portion linking the first peptide and second peptide (containing a sequence of amino acids as set forth in SEQ ID NO: 3).
- RBD receptor binding domain
- Fc fragment crystallizable
- Example 15 the RBD contained a sequence of amino acids as set forth in SEQ ID NO: 2, and in Example 17, the RBD contained a sequence of amino acids as set forth in SEQ ID NO: 8.
- the reference to codons in the plasmid of Fig.52 includes both the RBD and Fc region as well as the hinge portion.
- the sequences encoding the RBD-Fc antigen were optimized for efficient plant expression.
- donor plasmids containing the referenced nucleic acid sequences for the fusion peptide were synthesized.
- the antigen donor plasmid and TRBO expression plasmid were digested using suitable restriction enzymes.
- the antigen was ligated into the TRBO expression plasmid and subsequent colonies were screened to confirm clones. Assembled expression plasmids (Fig. 52) from successful ligations were amplified in E. coli and DNA purified. The vector DNA-confirmed clones of the antigen in the TRBO expression plasmid were used to transform Agrobacterium tumefaciens in preparation for infiltration into Nb plants. Individual colonies were transferred in a sterile manner, incubated, and 20% glycerol stocks from culture were produced and retained as antigen Master Cell Banks.
- the exemplary construct included a cauliflower mosaic virus (CaMV) 35S promoter, which is a DNA dependent RNA promoter set to transcribe the TMV expression vector with an accurate 5’ end.
- the TMV replicase is composed of the 126 kDa and 183 kDa replication associated proteins.
- the “30k” refers to a movement protein produced from a sub-genomic promoter in the 3’ end of the 183 kDa protein coding region.
- the antigen gene is transcribed from a sub-genomic promoter in the 3’ end of the 30 kDa protein coding region and the 3’ untranslated region has a ribozyme to insure termination of the transcript near the authentic 3’ end.
- E. coli origin for replication and border regions for the TI plasmid and other elements for efficient replication in Agrobacterium and insertion into plant cells.
- a plasmid providing a construct for an antigen which is conjugable with a virus can be manufactured in accordance with multiple embodiments and alternatives herein.
- Such a construct may comprise first and second coding regions that encode a fusion peptide.
- the first coding region contains a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 2 above, or by way of further example SEQ ID NO: 8 below.
- the first peptide may comprise or substantially comprise a receptor binding domain of a pathogen, such as a virus, non-limiting examples of which include coronaviruses and influenza viruses as discussed further herein.
- the second coding region contains a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 4 above.
- the second peptide may be a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor.
- the first peptide and the second peptide are linked by a hinge portion coded by a third coding region.
- the third coding region may contain a nucleic acid sequence encoding an amino acid sequence as set forth in SEQ ID NO: 3 above.
- the hinge portion is a portion of the Fc region.
- one or more nucleic acid sequences identified herein will be part of a heterologous expression system.
- physicochemical properties of the antigen intermediate include a pH between about 7.0 ⁇ 0.4, an osmolality between about 250- 350 mOsm/kg H 2 0, a bioburden less than 10 CFU/mL, and residual host cell proteins less than 100 ng/mg.
- an antigen purification platform As shown in Figs. 54 - 55, an antigen purification platform according to multiple embodiments and alternatives successfully purified the RBD-Fc 121 antigen resulting in high yields (> 400 mg of RBD-Fc protein) with pure, stable antigen as RBD-Fc monomer in a manner that is compliant with GLP regulations.
- Fig. 53 taken from the conclusion of the purification platform applied to this antigen, contains a SDS page gel indicating purity for the RBD-Fc 121 antigen, wherein lane 1 shows the marker and lane 2 shows the purified RBD-Fc 121 protein.
- the RBD-Fc 121 antigen product is highly pure.
- the protein migration shown in Fig.53 is consistent with the SEC-HPLC report of the free, purified RBD-Fc 121 shown in Fig 53.
- the SEC-HPLC report of the free RBD-Fc 121 antigen produced the signal data detailed in Table 64 below.
- Table 64. SEC-HPLC Data of free, purified RBD-Fc 121 Antigen [00326] Table 64 and Fig.54 illustrate that > 90% of the purified RBD-Fc 121 antigen is in monomeric form. Likewise, low impurities were present in the batches at less than 0.442 EU/mg.
- Fig.55 contains a SDS Page gel of the purified RBD-Fc 121 antigen 5 weeks after purification.
- the lanes include: lane 1 – marker, lane 2 – blank, lane 3 – blank, and lanes 4-6 – RBD-Fc 121 antigen 5 weeks after purification.
- the clear and visible bands in Fig.55 indicate the purified RBD-Fc 121 antigen is highly stable.
- the purified RBD-Fc 121 antigen maintained its potency for at least 5 weeks following purification based on ELISA results.
- Table 65 Potency of Purified RBD-Fc 121 Antigen as Measured by ELISA Conjugation and Preparation – Example 15(a)
- the purified RBD-Fc 121 antigen was then conjugated with a TMV NtK carrier.
- the TMV NtK virions with surface lysine residues for efficient conjugation were manufactured in Nb plants (again, as a non-limiting example).
- the TMV NtK carrier was purified according to a virus purification platform described herein (for example, as illustrated at Table 1 and Figure 1).
- TMV NtK was subject to micron filtration (e.g. 0.45) and treated with UV inactivation (as discussed in Example 8 herein).
- the purified and inactive TMV NtK was then chemically conjugated to the RBD-Fc 121 antigen to produce a Covid-19 vaccine, in accordance with multiple embodiments and alternatives herein (for example, as illustrated at Table 3).
- an exemplary conjugation procedure may include at least the following steps: [00330] Purified RBD-Fc 121 antigen was diafiltered into a 50 mM MES buffered salt (50 mM NaCl) solution, concentrated to a target concentration appropriate for conjugation, and subjected to 0.2 micron filtration. [00331] Purified RBD-Fc 121 antigen was conjugated to the purified TMV NtK particles using EDC and Sulfo-NHS chemistries within a 1-hour mixing reaction. [00332] As previously indicated, conjugation may occur at a range of TMV NtK:antigen (mg:mg) ratios, including without limitation 8:1, 4:1, and 1:1.
- the RBD-Fc 121 antigen and TMV NtK underwent a conjugation reaction performed at a pH of about 6.0, in EDC (4mM) and Sulfo NHS (5 mM).
- the pH of the conjugation reaction and the pH of the purification step need not be the same.
- the conjugation reaction was quenched with free amine (Tris Base), optionally using a 30 kDa UF membrane to remove residual EDC, Sulfo NHS, and Tris Base.
- the conjugated drug substance was diafiltered and formulated.
- the TMV NtK:RBD-Fc conjugate will be (and in the case of Example 15, was) ready for drug substance filling and drug product filling.
- a suitable delivery mechanism of the vaccine would include a liquid vial or lyophilized material to be reconstituted with physiologic buffering for project injection, with administration of the vaccine according to optional methods described herein.
- the SV was measured using an AUC.
- Fig.57 shows the normalized sedimentation coefficient for sample 4 (in which the TMV:RBD-Fc conjugate was diluted by a factor of 28), and Fig. 58 shows the normalized sedimentation coefficient for another sample (where the TMV:RBD-Fc conjugate was diluted by a factor of 10).
- Fig.57 shows 100% total virus associated material (i.e. virus-antigen conjugates) and Fig. 58 shows 99.7% total virus associated material (i.e.
- Figs. 57 and 58 indicate virtually complete engagement of the RBD-Fc products in TMV-conjugation events.
- the successful conjugation between the TMV NtK and the RBD-Fc 121 antigen was confirmed by SDS-Page analysis.
- Fig.59 contains a SDS Page gel of the TMV NtK:RBD-Fc conjugate at different time periods post-conjugation.
- Fig. 60 contains a SDS Page gel of the TMV NtK:RBD-Fc conjugate at different time periods post-conjugation.
- the lanes include: lane 1 – marker, lane 2 – the conjugate mixture at 0 min, lane 3 – the conjugate mixture at 5 min post- conjugation, lane 4 – the conjugate mixture at 15 min post-conjugation, lane 5 – the conjugate mixture at 30 min post-conjugation, lane 6 – the conjugate mixture at 45 min post-conjugation, lane 7 – the conjugate mixture at 60 min post-conjugation, lane 8 – the final conjugate mixture after mixing, lane 9 – a TMV:HA conjugate as a control, lane 10 – the conjugate mixture 0 min, lane 11 – the conjugate mixture at 5 min post-conjugation, lane 12 – the conjugate mixture at 15 min post-conjugation, lane 13 – the conjugate mixture at 30 min post-conjugation, lane 14 – the conjugate mixture at 45 min post-conjugation, lane 15 – the conjugate mixture at 60 min post
- the data indicates the RBD-Fc antigen that was conjugated to TMV NtK, bound successfully to the human ACE-2 receptor.
- Table 51 the initial immune responses stimulated after one vaccine dose with the TMV NtK:RBD-Fc conjugate supported this observation.
- mAb human neutralizing monoclonal antibody
- Fig. 60 illustrates the CR 3022 ELISA data by showing the conservation of RBD conformation among the free antigen and the TMV:RBD- Fc conjugate formulated at a 8:1 and 4:1 (TMV NtK:antigen) ratio, respectively.
- Fig.60(A) the ELISA standard curve illustrates the sensitivity and linearity for binding of SARS-2 Spike antigen to the CR 3022 antibody.
- TMV:RBD-Fc conjugate is referred to as “TMV:RBD-Fc.”
- Fig. 60(B) shows strong, dose-dependent binding of CR 3022 to both the RBD-Fc 121 antigen and formulated TMV to RBD-Fc 121 conjugate. Accordingly, Fig. 60 indicates the RBD-Fc 121 antigen shows greater than five times the reactivity to CR 3022 as compared to commercially sourced control SARS Spike and RBD reagents.
- ACE-2 functions as a cell surface receptor for the spike protein of SARS-CoV2 during the invasion of respiratory epithelial cells.
- Vero cells are derived from the kidney of an African green monkey and are commonly used in cellular research. The Vero e6 cells are a subclone of Vero76, exhibiting a range of virus susceptibility.
- the binding ability of the native agonist, angiotensin II was compared with the RBD-Fc binding by analyzing the concentration dependent ability to block binding of an ACE-2 specific antibody (ab15348, a homolog of angiotensin II) to the receptor on living Vero e6 cells.
- an ACE-2 specific antibody ab15348, a homolog of angiotensin II
- plant-produced recombinant H7 strain influenza HA protein was used as a control.
- Multiple concentrations of each antigen- antibody complex ranging from 0.04 ⁇ g/ml to 10 ⁇ g/ml were incubated with Vero e6 cells and compared with angiotensin II, the native ligand of ACE-2, for their ability to bind the receptor.
- angiotensin II refers to ab15348.
- the RBD-Fc 121 antigen bound to Vero e6 cells in a concentration-dependent manner with 2.58-fold increase at a concentration of 10 ug/ml (n 10 analyses).
- Fig.61 visually illustrates ligand co-localization and competitive binding with Vero e6 cells between angiotensin II and the RBD-Fc 121 antigen as discussed with Fig.62(A).
- the images in Fig.61 were obtained with confocal microscopy at the following ACE-2 specific antibody concentrations: 10 ug/ml, 3.3 ug/ml, 1.1 ug/ml, and 0.12 ug/ml, wherein the scale bars are equal to 15 ⁇ m.
- the red color shows binding of angiotensin II with the Vero e6 cells
- the green color shows co-localized binding of the RBD-Fc 121 antigen with these cells.
- the binding of the RBD-Fc 121 antigen to the Vero e6 cells occurred in a concentration-dependent manner with a 2.58-fold increase over the H7 HA control. Accordingly, increased binding of the RBD-Fc antigen (green) was observed to correlate with decreased detection of angiotension II binding (red).
- Fig. 62(B) illustrates that adding a co-localization control reduces all specific binding, demonstrating a reduction in ACE-2 antibody binding in the presence of both angiotensin II and the RBD-Fc 121 antigen. It will be noted that the binding of H7 HA did not impact the detection of ACE-2 by monoclonal antibody at any concentration.
- FIGS. 60 - 62 illustrate that the RBD-Fc 121 antigen maintains functional conformation and activity through the binding of CR 3022 and ACE-2.
- the binding to ACE-2 shows similar affinity and specificity as the native agonist, angiotensin II, suggesting that the conformation of the spike protein RBD in the recombinant RBD-Fc 121 fusion peptide complex is comparable to that observed with native SARS-2 Spike protein.
- CPE neutralization assay begins with titrating dilutions of heat-inactivated serum samples, mixing with 100 TCID50 of SARS-CoV-2 in duplicate and incubation for 1 hour. The serum/virus mixture was then added to Vero e6 cells and allowed to incubate for 3 days at 37°C and 5% CO 2 . Following incubation, the cell monolayers were fixed and stained with crystal violet to evaluate for the presence of virus-induced CPE.
- the virus neutralization titer for each sample is reported as the reciprocal of the highest dilution that prevented CPM is 50% of the wells.
- the results obtained from the CPE-neutralization method of individual sera samples from all groups correlates well with the pooled sera results obtained with SARS-CoV2 plaque assay.
- Example 15(c) The TMV NtK:RBD-Fc 121 Covid-19 vaccine described above was evaluated for immunogenicity in two parallel evaluations using female C57BL/6 mice. As shown in Figs 65(A)-(D), the collected serum was tested for total IgG anti-RBD reactivity by ELISA, using recombinant COV2 RBD-His as capture antigen to compare immune response between groups. [00349] In the first evaluation, 10 animals were used per group wherein 5 animals per group were sacrificed at day 14 to have sufficient sera for broad testing.
- the terms “boost” or “booster” or other derivatives of these words refer to a second administration of the vaccine at the same dose as the first.
- 5 animals were used per group, each receiving prime and boost vaccinations on days 0 and 14 respectively, with blood draws at days 0, 12, 14, 28, and terminal from all animals.
- the trial endpoints include measurement of antigen-specific geometric mean antibody titers induced in mice, SARS-2 neutralizing titers, and antibody isotype analysis.
- the trials are outlined in Table 66 below, which included various dosages, different vaccines (including purified TMV NtK only, RBD- Fc only, and the TMV:RBD-Fc conjugate), and compared identical doses both with and without the use of CpG oligodeoxynucleotides (CpG) as an adjuvant.
- the CpG was added to the vaccine formulation such that the concentration of the antigen remains the same in a consistent 100 mcL injection as the neat (non-adjuvanted) vaccine formulation.
- monophosphoryl lipid A (MPLA) and/or SE-M were utilized as adjuvants for enhancing the immune response of the subject to the vaccine.
- SE-M is a type of stable emulsion, which typically uses a TRL4 Toll-Like Receptor agonist as the adjuvant.
- Table 66 TMV NtK:RBD-Fc Vaccine Immunogenicity Testing in Mice
- Fig.65(A) illustrates the immune response (ng/mL) stimulated by RBD-Fc antigen only at 12, 28, and 42 days post first vaccination.
- Fig.65(B) illustrates the immune response (ng/mL) stimulated by TMV:RBD-Fc conjugate at dosages of 15 mcg and 45 neat (unadjuvanted) at 12, 28 and 42 days post-first vaccination.
- Fig.65(C) illustrates the immune response (ng/mL) stimulated by adjuvanted TMV:RBD-Fc conjugate (15 mcg) and TMV:RBD-Fc conjugate (45 mcg + CpG) vaccines at 12, 28 and 42 days post-first vaccination.
- Fig.65(d) comparative IgG titers recognizing the RBD-Fc antigen (in black) and RBD-His (in gray) are shown from sera taken at day 42. The relative ratio of reaction to RBD-His is shown as a percentage of total, RBD-Fc response, above each stacked plot member.
- Baseline serum antibody levels were very low for RBD-His and RBD-121-Fc antigen, being ⁇ 100 ng/mL. Further, no significant response was measured for PBS vehicle control animals, and the unconjugated RBD-Fc antigen produced a limited antibody response demonstrating that conjugated to the TMV NtK carrier is needed to produce a robust immune response.
- the non-adjuvanted TMV:RBD-Fc conjugate groups showed similar quantitative titers than CpG adjuvanted vaccines with all sera analyzed simultaneously against a single capture protein.
- Fig. 65(D) the relative immune response to the SARS- 2 RBD was tested, as well as the human Fc portion of the antigen to the immune response.
- Day 42 sera were analyzed by ELISA using either the SARS- 2 RBD-His or the RBD-121-Fc proteins as capture agents.
- ELISA data was measured after 1:100 dilutions of PBS/RBD-121-Fc antigen immune groups, and 1:1000 for TMV:RBD-Fc conjugate groups.
- Fig.66(A) illustrates the Th1 response (IgG2a and IgG2c)
- Fig.66(B) illustrates the Th2 response (IgG1)
- Fig.66(C) is a stack plot comparison of relative IgG2 versus IgG1 antibody by ELISA.
- Fig.66(A) illustrates the Th1 response (IgG2a and IgG2c)
- Fig.66(B) illustrates the Th2 response (IgG1)
- Fig.66(C) is a stack plot comparison of relative IgG2 versus IgG1 antibody by ELISA.
- the “*” indicates a p ⁇ 0.05 compared to other groups.
- the PBS and RBD--Fc antigen groups showed low overall IgG2 antibody responses, compared with all TMV:RBD-Fc conjugate groups. All TMV:RBD-Fc conjugate groups were different from each other, with significantly improved IgG2 titers by dose and by addition of adjuvant. The IgG1 titers were significantly higher in non-adjuvanted TMV:RBD-Fc conjugate groups, compared with all other groups, with the CpG adjuvanted group significantly lower and equivalent to RBD-Fc alone group.
- the ratio of IgG1 to G2 isotype varied across groups, with primarily IgG1 isotype titer in the RBD-121-Fc group, an IgG1 to G2 ratio greater than 1 for non-adjuvanted TMV:RBD-Fc conjugate groups, and a IgG1 to G2 ratio less than 0.1 for TMV:RBD-Fc conjugate + CpG adjuvant groups.
- the CpG adjuvant strongly skewed the isotype response to TMV:RBD-Fc conjugate vaccine to the Th1 type, with non-adjuvanted TMV:RBD-Fc conjugate showing a more balanced mix of Th1/Th2 response.
- Fig.67 shows the mean cell viability after co-incubation of SARS-2 virus with murine sera, wherein the average cell viability as percentage of total cells is plotted against the serum dilution.
- the data shown in Fig. 67 illustrate significantly increased viability observed in TMV:RBD-Fc 121 vaccine groups (45 mcg alone, 15 and 45 mcg + CpG) compared with the control groups – vehicle alone and antigen alone.
- the geometric mean neutralization titers were calculated for each group and are shown in Table 51. Table 67.
- FIG.69 is a graph indicating serum neutralization activity based on titers following vaccination of mice against SARS CoV-2.
- the data depicted in Figure 69 represents log(2) transformed end-point serum dilutions that inhibited CPE by 50%. Dotted and dashed line represent the starting dilution used for the post-prime and post-boost assays, respectively.
- TMV:RBD-Fc vaccines including without limitation TMV:RBD-Fc 121 vaccine
- TMV:RBD-Fc 121 vaccine can induce measurable neutralization titers post a single vaccine with and without adjuvant. After a second vaccine boost, these titers grow significantly for both 15 and 45 ⁇ g concentrations.
- exemplary TMV:RBD-Fc vaccines confer protection to organisms following exposure to SARS-CoV2.
- Survival (Fig. 71(A)), clinical presentation (Fig. 71(B)), and post-challenge weight (Fig.71(C)) were evaluated and graphed.
- a recombinant RBD protein (6-His fusion) was used as the capture protein and antigen specific antibodies were measured and expressed as ng IgG bound/mL of pooled group sera.
- Fig. 68 illustrates the measured response titers following vaccine 1 (prime; day 12) and vaccine 2 (boost, day 28) induced in mice by TMV:RBD-Fc 121 vaccines. The samples represent analysis of pooled sera from 5 animals in each group and the capture antigen is a recombinant RBD-6-His protein.
- measurable responses were observed at day 12 (following vaccine 1 – prime vaccination) for the TMV:RBD-Fc 121 vaccine at 45 mcg neat or mixed with CpG adjuvant.
- vaccination 2 indicated by “boost” in Fig.67
- similar titers were present for TMV:RBD-Fc 121 vaccine at 45 mcg neat or mixed with CpG antigen group sear.
- these titers appear significantly greater than that induced by TMV:RBD-Fc 121 vaccine at 15 mcg neat or mixed with CpG antigen.
- TMV:RBD-Fc 121 groups are significantly higher than the immune response induced by RBD-Fc antigen alone. These trials show dose dependency of the TMV:RBD-Fc 121 vaccine and reveal that adjuvant does not make a significant contribution to enhanced immune responses to the RBD-Fc 121 antigen when conjugated to inactivated TMV particles. Moreover, as shown in Fig. 68, the TMV:RBD-Fc 121 vaccine induced a level of response greater than 600 mcg/mL when provided at the 45 mcg dose.
- mice were immunized by subcutaneous dosing once at day 1 and day 14, with either 15 ⁇ g or 45 ⁇ g antigen dose, with or without CpG, in 50 mcL total volume (PBS comprising buffer).
- PBS total volume
- On days 0, 12, 18 and 42 sera were collected, and the magnitude of the antibody response to the vaccine antigen was assessed as total titers against the target antigen and compared with PBS immune sera or pre-immune sera.
- Unconjugated protein RBD-Fc was used as the target for IgG assessment as well as RBD-HIS to assess response to total antigen and RBD (spike S1 domain) component of antigen.
- mice were euthanized and terminal sera collected, and spleens harvested for IFN ⁇ ELISpot analysis. An overview of the study is shown in Table 69. Table 69. Overview of Matrix Study
- Fig.70 illustrates the IFN ⁇ ELISpot analysis for vehicle and RBD-Fc only
- Fig.70(B) illustrates the IFN ⁇ ELISpot analysis for unadjuvanted TMV:RBD-Fc vaccine
- Fig. 70(C) illustrates the IFN ⁇ ELISpot analysis for TMV:RBD-Fc vaccine with the CpG adjuvant.
- nCoV antigen (i) is full SARS-CoV2 spike protein, (ii) is the S1 (RBD) domain, SARS(i) is full SARS-1 spike as is MERS(i) and HKU1(i), each produced in mammalian systems.
- the relative titer is represented as fold enhancement of signal over controls reported. Strong reactivity was noted to both SARS-2 antigens and apparent cross reactivity to SARS-1 antigen.
- Fig. 72 As shown in Fig. 72, no binding was observed to divergent MERS or HKU1 spike proteins. Accordingly, the results in Fig. 72 indicate that anti-sera from mice with neutralization titers recognized heterologously produced (mammalian cell) SARS-2 Spike proteins, RBD, and SARS-1 Spike Proteins (i.e. exhibit cross reactivity). [00365] The specificity and relative titer of sera from terminal bleed (day 42) were analyzed by VaxArray ⁇ .
- SARS-CoV2 vaccine components including: SARS-CoV2 Spike (produced in insect cells); SARS-CoV2 Spike (produced in mammalian cells); RBD (S1)-human Fc produced in plants (homologous antigen); SARS-CoV2 RBD (S1) (produced in mammalian cells); SARS-CoV2 S2 domain (produced in insect cells); SARS-CoV2 S1-sheep Fc (produced in mammalian cells); SARS-CoV1 S1-Rabbit Fc (produced in insect cells); MERS Spike (produced in mammalian cells); and HKU1 Spike (produced in mammalian cells).
- SARS-CoV2 Spike produced in insect cells
- SARS-CoV2 Spike produced in mammalian cells
- RBD S1-human Fc produced in plants (homologous antigen)
- SARS-CoV2 RBD (S1) produced in mammalian cells
- SARS-CoV2 S2 domain produced in insect
- the VaxArray ® assay was conducted with individual sera from each group and read at 100, 350 and 700 ms exposures. Reactivity to each antigen by each group of sera is shown in Figs.73(A) and 73(B). Fig.73(A) shows reactivity as measured to each capture antigen. Fig.73(B) shows comparative reactivity among each study group to specific capture antigens.
- the 100 ms exposure resulted in reactivity of vaccine sera to all capture antigens except the SARS-CoV2 S2 domain, MERS and HKU1 spike proteins. However, meaningful reaction was observed for SARS-COV1 S1 domain. Different overall reactivity was observed with full and S1 capture antigens from SARS-CoV2 origin.
- Fig. 74 provides further concordance when correlating the individual animal responses measured by CPE seen in Table 52 with plaque group microneutralization titers measured by VaxArray®.
- the lower titers noted with CoV2 RBD-Fc immunized animals 1 and 3 TAP 15 ⁇ g animal 2, or 15 mcg+CpG animal 3 all show lower titrating titers and lower neutralization titers.
- TMV:H7 antigen vaccine either with or without a CpG adjuvant.
- Subjects receiving adjuvant had a 100% survival rate to day 14.
- Fig.79(B) provides information about the results of the ferret challenge study. Again this was conducted with a TMV-H7 conjugate with and without CpG adjuvant. Based on virus titers collected from nasal turbinates, the results showed that the vaccine improves the rate of recovery with lower titers in the adjuvant groups compared to non-adjuvanted.
- the murine testing also studied a murine macrophage line (Raw 264.7) lacking ACE-2 binding domains, which found that anti-spike RBD neutralizes viral killing and does not promote antibody-dependent enhancement of infection in murine macrophages.
- ACE-2 functions as a cell surface receptor for the spike protein of SARS-CoV2 during the invasion of respiratory epithelial cells.
- mice and other organisms neutralizing antibodies against the receptor binding domain of this spike protein have been found in patients that have recovered from SARS-CoV and are believed to be protective against infection with SARS-CoV2.
- TMV:RBD-Fc 121 vaccines induce measurable and statistically significant SARS-2 neutralizing antibody titers over controls.
- the TMV:RBD-Fc 121 vaccine of the present example shows a strong, vigorous, and promising immune response.
- IgM Immunoglobulin M
- IgM levels can be evaluated by ELISA and neutralizing antibody titers.
- IgM antibody levels are predicted to rise following vaccine administration, typically for a period of time on the order of weeks, e.g., two weeks approximately. Accordingly, while other time periods could be used, testing by ELISA or neutralizing antibody titers, or both, at day 0, day 7, day 14, and day 28 can be performed following administration of a Covid-19 vaccine in accordance with the present embodiments. Such testing following such administration is predicted to confirm the production of IgM, and increase in its levels between day 0 and day 14, serving as an indicator of immunogenic response to vaccine administration.
- Fig.80 The data graphed in Fig.80 represents the animals received vaccine one (Day 0) and vaccine two (Day 14) with study terminating on Day 28. All subjects increased in weight as shown in Fig.80.
- Fig.81A New Zealand White Rabbits were administered an exemplary vaccine at different ratios, with and without adjuvant, and assessed against a control group with respect to post-challenge weight (Fig.81A) and survival (Fig.81(B). Results were recorded over 12 days with the vaccine groups faring markedly better over placebo in both categories, as shown in these figures.
- a conjugable antigen can be manufactured, suitable for conjugation with a carrier.
- an antigen may be a recombinant antigen, and generally comprises a fusion peptide having a first peptide which comprises a receptor binding domain of a pathogen, a non-limiting example being a coronavirus, and a second peptide which comprises a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor.
- the first peptide and the second peptide are linked by a hinge portion.
- this hinge portion may be a portion of the Fc region.
- the hinge portion contains an amino acid sequence as set forth in SEQ ID NO: 3.
- exemplary coronaviruses from which a receptor binding domain may be obtained include without limitation SARS-CoV-1, SARS-CoV-2, and MERS.
- an exemplary receptor binding domain of a SARS-CoV-2 the receptor binding domain is contained in a S-1 subunit of a spike protein of the coronavirus, and it comprises contact residues which are located in a range from about position 289 to about position 662.
- the second peptide may comprise an Fc domain of an IgG1 antibody, with such domain containing as noted herein an amino acid sequence as set forth in SEQ ID NO: 4.
- a vaccine comprising at least one conjugable antigen, as described according to the multiple embodiments and alternatives of this disclosure, and a carrier comprising a virus particle.
- a virus particle is a virus, for example TMV.
- the first peptide of the conjugable antigen may contain an amino acid sequence as set forth in SEQ ID NO: 2, alternatively the amino acid sequence may be as set forth in SEQ ID NO: 8.
- the first peptide may contain contact residues located in a range from about position 289 to about position 662 of a S-1 subunit of a spike protein of the coronavirus, which will contact an ACE- 2 receptor on a cell of a mammalian subject to whom such a vaccine is administered, after the antigen is released from the virus particle carrier following administration.
- the contact residues may be located in a range from about position 301 to about position 662 of the S-1 subunit.
- the first peptide lacks an amino acid sequence as set forth in SEQ ID NO: 5, while the first peptide of RBD-Fc 139 antigen does contain this sequence.
- the conjugable antigen of the vaccine when released in a mammalian subject, having cells that include one or more ACE-2 receptors, the at least one conjugable antigen binds to the one or more ACE-2 receptors.
- a virus particle used in the manufacture of such a vaccine has surface lysine residues, which chemically associate with the fusion peptide, more specifically the first peptide, resulting from the conjugation reaction.
- a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type A influenza virus and at least one conjugable antigen having a receptor binding domain of a coronavirus.
- Other possible combinations are within the scope of present embodiments, and the combinations provided herein are illustrative and non-limiting.
- a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type B influenza virus and at least one conjugable antigen having a receptor binding domain of a coronavirus.
- a vaccine in accordance with teachings herein is multivalent and comprises at least one conjugable antigen having a receptor binding domain of a type A influenza virus, at least one conjugable antigen having a receptor binding domain of a type B influenza virus, and at least one conjugable antigen having a receptor binding domain of a coronavirus.
- Various ratios may be selected and expressed as follows, virus particle:antigen by wt (i.e., ratio of the virus particle and the at least one conjugable antigen by weight). As desired, this ratio may be in a range between about 1:1 and about 8:1, more specifically 8:1.
- CpG may be included with a vaccine in accordance with the teachings herein as an adjuvant for enhancing the immune response of the mammalian subject to the vaccine.
- Example 16 Stability Under Refrigerated and Room Temperature Conditions for the Coronavirus Vaccine
- TMV:RBD-Fc 121 vaccine Similar to the stability of the QIV vaccine discussed in Example 13, both the RBD- Fc 121 antigen and the TMV:RBD-Fc 121 vaccine exhibited consistency and stability under refrigerated and room temperature conditions for at least six months. In this example, the stability of the RBD-Fc 121 antigen was measured, as well as the stability of the TMV:RBD- Fc 121 vaccine, using the tests discussed in Example 13.
- the RBD-Fc 121 antigen was purified and produced according to multiple embodiments.
- the stability of the purified RBD-Fc 121 antigen was then analyzed.
- the following table provides the stability data and storage potency for purified RBD-Fc 121 antigen as measured at release and various times after filling into vials and stored under refrigerated conditions (2° to 8°C) and at room temperature (22° to 28°C).
- HMW is an abbreviation for high molecular weight.
- Table 70 Stability of Purified RBD-Fc 121 Antigen Under Refrigerated Conditions
- Table 71 Stability of Purified RBD-Fc 121 Antigen Under Room Temperature Conditions
- the following table provides the stability data of the TMV:RBD-Fc 121 vaccine (at a TMV to antigen ratio of 8:1) at release and various times after filling into vials and stored under refrigerated conditions (2° to 8°C): Table 72 - Stability of TMV:RBD-Fc 121 Vaccine Under Refrigerated Conditions
- Tables 72 and 73 illustrate that the TMV:RBD-Fc 121 vaccine exhibited strong stability measures for at least six months under refrigerated conditions.
- Table 74 illustrates that the TMV:RBD-Fc 121 vaccine, produced according to multiple embodiments and alternatives, exhibited strong stability measures for at least six months at room temperature storage (22° to 28°C). This is in contrast to the conventional SARS-2 vaccines which in most situations require storage in an ultra-cold freezer (e.g. -20°C to -70°C) or, under refrigerated conditions, or at most offer but a few hours of stability at room temperature.
- an ultra-cold freezer e.g. -20°C to -70°C
- the purification and formulation processes according to multiple embodiments and alternatives stabilizes the RBD-Fc 121 antigen by itself – far beyond the stability limits of conventional approaches.
- SARS-2 SARS-2
- any type of virus antigen including other Covid-19 antigens, may be purified and conjugated to inactivated TMV for use as an effective vaccine candidate according to multiple embodiments and alternatives.
- the following antigen sequence (referred to herein as “RBD-Fc 139 Construct”) is used for the synthesis of a Covid-19 antigen: 1.
- SEQ ID NO: 1 Signal Peptide: MGKMASLFATFLVVLVSLSLASESSA 2.
- SEQ ID NO: 5 SARS-2 virus Spike amino acids numbered 319-330: RVQPTESIVRFP 3.
- the RBD-Fc 139 construct was ligated into the TRBO vector (as a non-limiting example) and subsequent colonies were screened to confirm clones.
- the RBD-Fc 139 antigen is expressed in plants and purified using an antigen purification platform described herein.
- the antigen purification platform As shown in Figs.76 – 77, the antigen purification platform, according to multiple embodiments and alternatives, successfully purified RBD-Fc 139 resulting in high yields with pure, stable antigen as RBD-Fc monomer in a manner that is compliant with GLP regulations.
- Fig. 76 taken from the conclusion of the antigen purification platform, contains a SDS page gel indicating purity and successful purification for the RBD-Fc 139 antigen in both reducing and non-reducing conditions.
- the lanes include: lane 1 – 11.8 ug of purified antigen in reducing conditions, lane 2 – blank, lanes 3-5 : 1.5 ug of purified antigen in reducing conditions, lane 6 – blank, lane 7 – marker, lane 8 – blank, lanes 9-11 – 1.5 ug of purified antigen in non- reducing conditions, lane 12 – blank, and lane 13, 11.8 ug of purified antigen in non-reducing conditions.
- the clear and visible bands indicate the RBD-Fc 139 antigen product is highly pure.
- Fig. 77 is the SEC-HPLC report of the free RBD-Fc 139 antigen, which produced the signal detailed in Table 75 below.
- the TMV NtK is subject to micron filtration and immediately treated with UV inactivation.
- the RBD-Fc 139 antigen is then conjugated to the inactivated TMV via the surface exposed lysine residues utilizing the conjugation of recombinant antigen embodiments described herein.
- a TMV:RBD-Fc 139 conjugate is currently being studied as a vaccine candidate for Covid-19 Disease.
- the TMV:RBD-Fc 139 conjugate is also expected to be a viable Covid-19 vaccine.
- a fusion peptide is formed of a first peptide which comprises a receptor binding domain of a pathogen, and a second peptide which comprises a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor.
- the antigen further comprises a hinge portion linking the first peptide and the second peptide.
- the hinge portion may contain an amino acid sequence as set forth in SEQ ID NO: 3.
- the pathogen is a coronavirus having a receptor binding domain, and more specifically as referred to herein as embodiment E, the coronavirus is chosen from the group consisting of SARS-CoV- 1 and SARS-CoV-2.
- the receptor binding domain of the coronavirus comprises contact residues are located in a range from about position 289 to about position 662 of a S-1 subunit of a spike protein of the coronavirus, wherein the contact residues contact an ACE-2 receptor on a cell of a mammalian subject, or alternatively, in an embodiment referred to herein as embodiment G, the contact residues are located in a range from about position 301 to about position 662 of the S-1 subunit.
- the receptor binding domain of the coronavirus lacks an amino acid sequence as set forth in SEQ ID NO: 5.
- the coronavirus is a Middle East respiratory syndrome coronavirus.
- the second peptide is an Fc domain of an IgG1 antibody and more specifically as referred to herein as embodiment K, the Fc domain contains an amino acid sequence as set forth in SEQ ID NO: 4 and the first peptide contains an amino acid sequence as set forth in either SEQ ID NO: 2 or SEQ ID NO: 8. Accordingly, an antigen may be practiced (i.e., made, formed, designed, used, and so forth) in accordance with embodiment A as more fully described herein.
- an antigen as described herein may be practiced by incorporating with embodiment A any one or more of embodiments B, C, D, E, F, G, H, I, or J, and embodiments may be directed to compounds, methods, and genetic constructs in the practice of any one or more of these alternative embodiments.
- embodiments may be directed to a vaccine comprising an antigen, a method of forming an antigen, or a genetic construct useful in forming an antigen, as recited in embodiment A, B, C, D, E, F, G, H, I, or J, and further comprising in combination with any aforementioned embodiment, a carrier comprising a virus particle, wherein the virus in some embodiments is a virus, and more particularly a tobacco mosaic virus, and wherein the fusion peptide chemically associates with lysine residues on a surface of the carrier.
- a vaccine comprises an influenza hemagglutinin antigen (HA) and a carrier comprising a virus particle having surface lysine residues, wherein the HA chemically associates with the surface lysine residues.
- the virus particle releases the at least one antigen in a mammalian subject having cells that include one or more ACE-2 receptors, the at least one antigen binds to the one or more ACE-2 receptor.
- the virus particle is a virus, or more specifically as referred to herein as embodiment N, the virus is a tobacco mosaic virus.
- the vaccine is multivalent, and the HA is chosen from the group consisting of type A HA and type B HA, and the vaccine further comprises at least one antigen having a receptor binding domain of a coronavirus, wherein the at least one antigen having a receptor binding domain of a coronavirus chemically associates with the surface lysine residues.
- the HA comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs.
- HAs hemagglutinin antigens
- embodiment Q additional features found in any one or more of embodiments A, B, C, D, E, F, G, H, I, or J are incorporated with the coronavirus element of the vaccine.
- a ratio of virus particle and at least one antigen is in a range between 1:1 and 8:1 and, more particularly in an embodiment referred to as embodiment S that range is 8:1.
- the vaccine is multivalent
- the influenza hemagglutinin antigen (HA) is referred to as a first antigen
- the multivalent vaccine comprises a second antigen which chemically associates with the surface lysine residues.
- the second antigen is an influenza HA other than the first antigen.
- the multivalent vaccine comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs.
- the second antigen comprises a receptor binding domain of a coronavirus.
- the coronavirus is chosen from the group SARS-CoV01 and SARS-CoV-2.
- the multivalent vaccine comprises two or more type A hemagglutinin antigens (HAs) and two or more type B HAs.
- the virus particle is a tobacco mosaic virus.
- a ratio of virus particle and at least one antigen is in a range between 1:1 and 8:1 and, more particularly in an embodiment referred to as embodiment CC that range is 8:1.
- embodiment DD directed to a virus-antigen conjugate, comprising a virus and at least one antigen, wherein the at least one antigen comprises a fusion peptide having a first peptide which comprises a receptor binding domain of a pathogen, and a second peptide wherein the fusion peptide is conjugable with the virus.
- the conjugate is multivalent, and further comprises at least one influenza hemagglutinin antigen (HA) chosen from the group consisting of type A HA and type B HA.
- HA hemagglutinin antigen
- the conjugate is multivalent, and the second peptide is a fragment crystallizable (Fc) region of an antibody capable of binding to a Fc receptor and the Fc region is an Fc domain of an IgG1 antibody.
- the conjugate further comprises a hinge portion linking the first peptide and the second peptide, wherein the hinge portion contains an amino acid sequence as set forth in SEQ ID NO: 3, and the pathogen is a coronavirus having said receptor binding domain.
- the first peptide contains an amino acid sequence as set forth in either of SEQ ID NO: 2 or SEQ ID NO: 8.
- the virus is a tobacco mosaic virus which comprises a N-terminal lysine residue.
- the pathogen is a coronavirus having said receptor binding domain, and wherein the receptor binding domain of the coronavirus is located on a S-1 subunit of a spike protein of the coronavirus and comprises contact residues, located in a range from about position 289 to about position 662.
- a strategy similar to Examples 14, 15, and 16 can be employed to derive candidate vaccines from other human-infecting coronaviruses, including acute respiratory syndrome coronavirus (SARS-1) and Middle East respiratory syndrome coronavirus (MERS).
- SARS-1 acute respiratory syndrome coronavirus
- MERS Middle East respiratory syndrome coronavirus
- Fig.78 domains of homology can be identified into functional regions in the Spike S1 domain which correlated with receptor binding and other essential activities.
- Fig. 78 shows the Receptor Binding Domain of the spike protein sequence alignment of SARS-CoV-2 and other related Coronaviruses. Shown here is a sequence alignment for the interacting (i.e.
- SARS-CoV-2 MN938384
- Bat-CoV MN996532 and MG772933
- SARS-CoV NC004718.
- Lines (-) same amino acid
- dots (.) deletion).
- Fig.78 is from Ortega JT, Serrano ML, Pujol FH, Rangel HR. Role of changes in SARS-CoV-2 spike protein in the interaction with the human ACE-2 receptor: An in silico analysis. EXCLI J. 2020;19:410–417. Published 2020 Mar 18. Doi:10.17179/excli2020-1167.
- the core elements of functionality extend from the “RVQPT” motif for the RBD-Fc 139 Construct to the “CGPKK” domain for both the RBD-Fc 121 and RBD-Fc 139 Constructs. Looking more closely at the RBD-Fc 121 Constructs, there extends beyond the core domain a more extended protein domain which facilitates appropriate folding. Indeed, this strategy is expected to extend to any type of coronovirus antigen, through the processes of: [00400] 1. Protein homology analysis – shown in Fig.78, [00401] 2.
- Such a vaccine can be formed to contain a number of different and diverse antigens, and used to prevent an identified coronavirus pathogen such as SARS-1 or MERS, or formulated with either the RBD-Fc 121 or 139 antigen into a multivalent vaccine to prevent SARS-1, SARS-2, and MERS, as non-limiting examples.
- multivalent TMV conjugate vaccines can be mixed as equal or proportional quantities of each TMV-antigen conjugate and applied in a single immunization.
- multivalent TMV-conjugate vaccines do not show immune dominance of one antigen preventing response to a second or third or fourth. Indeed, both HAI and neutralizing antibodies were generated against all strains in animals immunized with a quadrivalent TMV influenza vaccine, as seen with Example 14. Using this quadrivalent vaccine, protection can be measured against more than one individual influenza vaccine. [00408] Thus, it is anticipated that the approaches described herein, in accordance with multiple embodiments and alternatives, are likely to provide a wide and varied range of antigens upon a single virus particle carrier.
- a multivalent vaccine comprising two, three, four, five, or more different antigens against various viruses and other pathogens.
- At least one antigen may neutralize or stimulate an immune response against one type of virus (e.g., influenza), while at least one other antigen may do the same against another type of virus (e.g., a pandemic virus like coronavirus or HA7).
- An antigen occupying a position on the carrier could be comprised of a fusion protein modeled after the receptor binding domain of a virus, combined with a fusion partner, such as the Fc domain of an antibody from the tail region of an IgG1 molecule.
- the influenza portion of the at least one antigen on a single vaccine may comprise both type A and type B influenza.
- an approach may provide at least one antigen directed against one or more coronaviruses.
- the flexibility of the approaches herein and wide scope of combinable antigen-virus conjugates contemplated herein promote the ability to manufacture broad spectrum vaccines at a large scale in a compressed time period, often measuring weeks as opposed to many months.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Virology (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Organic Chemistry (AREA)
- Microbiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Molecular Biology (AREA)
- Pulmonology (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Abstract
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202063013284P | 2020-04-21 | 2020-04-21 | |
US202063047629P | 2020-07-02 | 2020-07-02 | |
US16/919,943 US11696948B2 (en) | 2018-06-12 | 2020-07-02 | Vaccines formed by virus and antigen conjugation |
US17/186,941 US11690907B2 (en) | 2018-06-12 | 2021-02-26 | Vaccines formed by virus and antigen conjugation |
PCT/US2021/021087 WO2021216205A1 (fr) | 2020-04-21 | 2021-03-05 | Vaccins formés par conjugaison de virus et d'antigène |
Publications (2)
Publication Number | Publication Date |
---|---|
EP4121105A1 true EP4121105A1 (fr) | 2023-01-25 |
EP4121105A4 EP4121105A4 (fr) | 2024-05-15 |
Family
ID=78270938
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP21793816.6A Pending EP4121105A4 (fr) | 2020-04-21 | 2021-03-05 | Vaccins formés par conjugaison de virus et d'antigène |
Country Status (4)
Country | Link |
---|---|
EP (1) | EP4121105A4 (fr) |
JP (1) | JP2023523716A (fr) |
CN (1) | CN115996750A (fr) |
WO (1) | WO2021216205A1 (fr) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN116789847B (zh) * | 2023-01-13 | 2024-04-16 | 广州医科大学附属第一医院(广州呼吸中心) | 融合蛋白、病毒样颗粒以及疫苗 |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006097851A2 (fr) * | 2005-03-17 | 2006-09-21 | Novartis Vaccines And Diagnostics Srl | Vaccins combines a antigenes de coqueluche a cellules entieres |
Family Cites Families (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101353375A (zh) * | 1995-05-26 | 2009-01-28 | Mg-Pmc有限公司 | 生产流感血凝素多价疫苗的方法 |
SK782002A3 (en) * | 1999-07-21 | 2003-08-05 | Lexigen Pharm Corp | FC fusion proteins for enhancing the immunogenicity of protein and peptide antigens |
WO2005091753A2 (fr) * | 2004-03-25 | 2005-10-06 | Large Scale Biology Corporation | Ensemble vaccin modulable et plate-forme d'administration de vaccins |
WO2007038145A2 (fr) * | 2005-09-08 | 2007-04-05 | Large Scale Biology Corporation | Particules virus mosaique du tabac modifiees utilisees comme supports pour la disposition d'antigenes proteiques pour des applications de vaccins |
US20130280298A1 (en) * | 2006-11-15 | 2013-10-24 | Folia Biotech Inc. | Immunogenic Affinity-Conjugated Antigen Systems Based on Papaya Mosaic Virus and Uses Thereof |
WO2014134439A1 (fr) * | 2013-03-01 | 2014-09-04 | New York Blood Center, Inc. | Composition immunogène pour infection de coronavirus de syndrome respiratoire du moyen orient (mers-cov) |
US20160362473A1 (en) * | 2015-06-12 | 2016-12-15 | Ubi Pharma Inc | Immunoglobulin fusion proteins and uses thereof |
KR102231217B1 (ko) * | 2015-09-24 | 2021-03-24 | 한미약품 주식회사 | 면역글로불린 단편의 특정 위치를 연결 부위로 이용한 단백질 결합체 |
CN106046176B (zh) * | 2016-08-16 | 2019-09-10 | 中国药科大学 | 一种高活性长效降糖融合蛋白及其制备方法与医药用途 |
EP3541419B1 (fr) * | 2016-11-18 | 2022-01-05 | New York Blood Center, Inc. | Composition immunogène pour l'infection par le coronavirus mers |
BR112020025250A2 (pt) * | 2018-06-12 | 2021-03-09 | Kentucky Bioprocessing, Inc. | Purificação e conjugação de vírus e antígeno |
US11529413B2 (en) * | 2018-06-12 | 2022-12-20 | Kbio Holdings Limited | Virus and antigen purification and conjugation |
KR102076917B1 (ko) * | 2018-10-25 | 2020-02-13 | 연세대학교 산학협력단 | 자가조립 나노 입자를 제조하기 위한 유전자 재조합 발현 벡터 시스템 및 이를 이용하는 방법 |
-
2021
- 2021-03-05 CN CN202180044012.2A patent/CN115996750A/zh active Pending
- 2021-03-05 EP EP21793816.6A patent/EP4121105A4/fr active Pending
- 2021-03-05 JP JP2022563927A patent/JP2023523716A/ja active Pending
- 2021-03-05 WO PCT/US2021/021087 patent/WO2021216205A1/fr unknown
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2006097851A2 (fr) * | 2005-03-17 | 2006-09-21 | Novartis Vaccines And Diagnostics Srl | Vaccins combines a antigenes de coqueluche a cellules entieres |
Non-Patent Citations (6)
Title |
---|
GASANOVA T V ET AL: "Chimeric particles of tobacco mosaic virus as a platform for the development of next-generation nanovaccines", NANOTECHNOLOGIES IN RUSSIA, MAIK NAUKA - INTERPERIODICA, RU, vol. 11, no. 3-4, 1 March 2016 (2016-03-01), pages 227 - 236, XP037125224, ISSN: 1995-0780, [retrieved on 20160513], DOI: 10.1134/S1995078016020051 * |
GASANOVA T V ET AL: "Complexes Formed via Bioconjugation of Genetically Modified TMV Particles with Conserved Influenza Antigen: Synthesis and Characterization", BIOCHEMISTRY (MOSCOW), PLEIADES PUBLISHING, MOSCOW, vol. 85, no. 2, 1 February 2020 (2020-02-01), pages 224 - 233, XP037023469, ISSN: 0006-2979, [retrieved on 20200217], DOI: 10.1134/S0006297920020091 * |
PETUKHOVA NATALIA ET AL: "High-Level Systemic Expression of Conserved Influenza Epitope in Plants on the Surface of Rod-Shaped Chimeric Particles", VIRUSES, vol. 6, no. 4, 21 April 2014 (2014-04-21), CH, pages 1789 - 1800, XP093142307, ISSN: 1999-4915, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4014720/pdf/viruses-06-01789.pdf> DOI: 10.3390/v6041789 * |
PETUKHOVA NATALIA ET AL: "Immunogenicity and Protective Efficacy of Candidate Universal Influenza A Nanovaccines Produced in Plants by Tobacco Mosaic Virus-based Vectors", CURRENT PHARMACEUTICAL DESIGN, vol. 19, no. 31, 1 August 2013 (2013-08-01), NL, pages 5587 - 5600, XP093142312, ISSN: 1381-6128, DOI: 10.2174/13816128113199990337 * |
See also references of WO2021216205A1 * |
SMITH M L ET AL: "Modified Tobacco mosaic virus particles as scaffolds for display of protein antigens for vaccine applications", VIROLOGY, ELSEVIER, AMSTERDAM, NL, vol. 348, no. 2, 10 May 2006 (2006-05-10), pages 475 - 488, XP024896651, ISSN: 0042-6822, [retrieved on 20060510], DOI: 10.1016/J.VIROL.2005.12.039 * |
Also Published As
Publication number | Publication date |
---|---|
EP4121105A4 (fr) | 2024-05-15 |
WO2021216205A1 (fr) | 2021-10-28 |
CN115996750A (zh) | 2023-04-21 |
JP2023523716A (ja) | 2023-06-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11696948B2 (en) | Vaccines formed by virus and antigen conjugation | |
US11655461B2 (en) | Antigen purification | |
EP2476432B1 (fr) | Compositions incluant de l'hémagglutinine, procédés pour leur fabrication et leurs méthodes d'utilisation | |
EP2280991B1 (fr) | Mutants par délétion de la flagelline et procédés d'utilisation | |
US11529413B2 (en) | Virus and antigen purification and conjugation | |
JP6877143B2 (ja) | インフルエンザワクチンおよび治療 | |
US20180340181A1 (en) | Vaccines against zika virus based on zika structure proteins | |
US11690907B2 (en) | Vaccines formed by virus and antigen conjugation | |
US20170258886A1 (en) | Production of an Immunogen Using a Plant Virus | |
WO2021216205A1 (fr) | Vaccins formés par conjugaison de virus et d'antigène | |
US20230149532A1 (en) | Vaccines formed by virus and antigen conjugation | |
US12097256B2 (en) | Virus and antigen purification and conjugation | |
US20240316188A1 (en) | Virus and antigen purification and conjugation | |
JP7534408B2 (ja) | ウイルス及び抗原精製及びコンジュゲーション | |
WO2014074509A1 (fr) | Production d'un immunogène à l'aide d'un virus de plante |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20221018 |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
P01 | Opt-out of the competence of the unified patent court (upc) registered |
Effective date: 20230505 |
|
DAV | Request for validation of the european patent (deleted) | ||
DAX | Request for extension of the european patent (deleted) | ||
P02 | Opt-out of the competence of the unified patent court (upc) changed |
Effective date: 20230620 |
|
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 40085914 Country of ref document: HK |
|
A4 | Supplementary search report drawn up and despatched |
Effective date: 20240412 |
|
RIC1 | Information provided on ipc code assigned before grant |
Ipc: A61K 39/00 20060101ALI20240408BHEP Ipc: A61P 31/16 20060101ALI20240408BHEP Ipc: A61K 39/12 20060101ALI20240408BHEP Ipc: A61K 39/145 20060101AFI20240408BHEP |