EP3858503B1 - Rolling mill with material property dependent rolling - Google Patents
Rolling mill with material property dependent rolling Download PDFInfo
- Publication number
- EP3858503B1 EP3858503B1 EP20154128.1A EP20154128A EP3858503B1 EP 3858503 B1 EP3858503 B1 EP 3858503B1 EP 20154128 A EP20154128 A EP 20154128A EP 3858503 B1 EP3858503 B1 EP 3858503B1
- Authority
- EP
- European Patent Office
- Prior art keywords
- rolling
- sensor
- measured variable
- stand
- rolling mill
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 238000005096 rolling process Methods 0.000 title claims description 272
- 239000000463 material Substances 0.000 title claims description 39
- 230000001419 dependent effect Effects 0.000 title description 3
- 230000002093 peripheral effect Effects 0.000 claims description 25
- 230000005284 excitation Effects 0.000 claims description 24
- 238000005097 cold rolling Methods 0.000 claims description 10
- 230000005540 biological transmission Effects 0.000 claims description 7
- 229910052751 metal Inorganic materials 0.000 claims description 6
- 239000002184 metal Substances 0.000 claims description 6
- 230000009467 reduction Effects 0.000 claims description 5
- 230000005236 sound signal Effects 0.000 claims description 4
- 238000011144 upstream manufacturing Methods 0.000 claims description 4
- 230000004048 modification Effects 0.000 claims description 2
- 238000012986 modification Methods 0.000 claims description 2
- 238000002604 ultrasonography Methods 0.000 claims 1
- 238000013461 design Methods 0.000 description 10
- 230000004913 activation Effects 0.000 description 7
- 238000005098 hot rolling Methods 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 238000000034 method Methods 0.000 description 6
- 229910000831 Steel Inorganic materials 0.000 description 5
- 238000011156 evaluation Methods 0.000 description 5
- 239000010959 steel Substances 0.000 description 5
- 238000001816 cooling Methods 0.000 description 4
- 230000006978 adaptation Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000005507 spraying Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 238000000137 annealing Methods 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 229910000734 martensite Inorganic materials 0.000 description 2
- 238000007669 thermal treatment Methods 0.000 description 2
- 229910000976 Electrical steel Inorganic materials 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 239000000696 magnetic material Substances 0.000 description 1
- 230000005415 magnetization Effects 0.000 description 1
- 238000012821 model calculation Methods 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
Images
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B1/00—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations
- B21B1/22—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations for rolling plates, strips, bands or sheets of indefinite length
- B21B1/24—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations for rolling plates, strips, bands or sheets of indefinite length in a continuous or semi-continuous process
- B21B1/28—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations for rolling plates, strips, bands or sheets of indefinite length in a continuous or semi-continuous process by cold-rolling, e.g. Steckel cold mill
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B37/00—Control devices or methods specially adapted for metal-rolling mills or the work produced thereby
- B21B37/16—Control of thickness, width, diameter or other transverse dimensions
- B21B37/18—Automatic gauge control
- B21B37/20—Automatic gauge control in tandem mills
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B37/00—Control devices or methods specially adapted for metal-rolling mills or the work produced thereby
- B21B37/46—Roll speed or drive motor control
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B38/00—Methods or devices for measuring, detecting or monitoring specially adapted for metal-rolling mills, e.g. position detection, inspection of the product
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B1/00—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations
- B21B1/22—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations for rolling plates, strips, bands or sheets of indefinite length
- B21B2001/221—Metal-rolling methods or mills for making semi-finished products of solid or profiled cross-section; Sequence of operations in milling trains; Layout of rolling-mill plant, e.g. grouping of stands; Succession of passes or of sectional pass alternations for rolling plates, strips, bands or sheets of indefinite length by cold-rolling
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2261/00—Product parameters
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2261/00—Product parameters
- B21B2261/20—Temperature
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2261/00—Product parameters
- B21B2261/22—Hardness
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2265/00—Forming parameters
- B21B2265/12—Rolling load or rolling pressure; roll force
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2265/00—Forming parameters
- B21B2265/24—Forming parameters asymmetric rolling
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B21—MECHANICAL METAL-WORKING WITHOUT ESSENTIALLY REMOVING MATERIAL; PUNCHING METAL
- B21B—ROLLING OF METAL
- B21B2275/00—Mill drive parameters
- B21B2275/02—Speed
- B21B2275/04—Roll speed
- B21B2275/05—Speed difference between top and bottom rolls
-
- C—CHEMISTRY; METALLURGY
- C21—METALLURGY OF IRON
- C21D—MODIFYING THE PHYSICAL STRUCTURE OF FERROUS METALS; GENERAL DEVICES FOR HEAT TREATMENT OF FERROUS OR NON-FERROUS METALS OR ALLOYS; MAKING METAL MALLEABLE, e.g. BY DECARBURISATION OR TEMPERING
- C21D8/00—Modifying the physical properties by deformation combined with, or followed by, heat treatment
- C21D8/02—Modifying the physical properties by deformation combined with, or followed by, heat treatment during manufacturing of plates or strips
- C21D8/0221—Modifying the physical properties by deformation combined with, or followed by, heat treatment during manufacturing of plates or strips characterised by the working steps
- C21D8/0236—Cold rolling
Definitions
- first rolling stand does not mean that the rolling mill necessarily has a plurality of rolling stands and the first rolling stand is the foremost rolling stand through which the flat rolling stock passes first. Rather, the case should first be included that the rolling mill has only the first roll stand. In this case, only the first roll stand is present. Furthermore, even if the rolling mill has a plurality of rolling stands, the term “first rolling stand” only serves to distinguish it from the other rolling stands of the rolling mill. However, no order should be implied. In this case, too, the first roll stand can be arranged at any point in the sequence of roll stands of the rolling mill.
- the first roll stand can be any one of the roll stands A to D, while the other rolling stands are second rolling stands.
- the aim is to set the geometric properties of the flat rolled stock, ie in particular its width and its thickness, with the greatest possible precision. The same applies to the profile or the contour. Flatness should also be maintained.
- material properties of the flat rolling stock should also be adjusted. Material properties are properties that the flat rolling stock should have when it is later used, for example a certain yield point, a certain material hardness or a certain magnetizability. Material properties are properties that the material exhibits independently of its specific current state (such as temperature) and also independently of its geometric properties. The reason for certain material properties is - in addition to the material as such - the grain structure of the metal.
- Material properties can be adjusted—at least partially—during the rolling of the flat rolling stock.
- AHSS advanced high strength steel
- the rolling stock can be cooled in a suitable manner in a cooling zone, for example after hot rolling, or treated in an annealing machine as part of the cold rolling, in order to set material properties. This treatment can be alternative after cold rolling or between two cold rolling steps.
- asymmetrical rolling can be advantageous for setting a texture of the rolling stock that is favorable for magnetization.
- the peripheral speeds of an upper and a lower work roll of a rolling mill differ from each other.
- shear forces act on the flat rolling stock in the transport direction. Due to the shear forces, a rearrangement of the crystal orientation is brought about.
- a rolling mill of the type mentioned is for example from WO 2017/157692 A1 known.
- the reduction thickness or the rolling force is set by the control value.
- the object of the present invention is to create possibilities by means of which a material property of the flat rolling stock can be adjusted in a targeted manner in a simple and reliable manner.
- the control device in a rolling mill of the type mentioned at the outset, is designed in such a way that the control value determined taking into account the measured variable is a ratio of an upper peripheral speed at which the upper work roll rotates to a lower peripheral speed at which the lower work roll rotates.
- the wording "at the time of the measurement” is not intended to imply that the material property also automatically changes over time due to the change in the condition of the flat rolling stock, such as its temperature.
- the material property can be adjusted to a different value at a later point in time by appropriate treatment of the rolling stock, for example by rolling in the first roll stand or by rolling in another roll stand or by thermal treatment.
- the rolling mill has only said first roll stand and consequently only a single roll stand.
- the sensor device is arranged all by itself directly in front of or directly behind the roll stand.
- the rolling mill it is also possible for the rolling mill to have at least one second rolling stand in addition to the first rolling stand. In this case, several different configurations are possible.
- the second roll stands are not arranged between the sensor device and the first roll stand.
- This configuration is implemented, for example, when the sensor device is arranged in front of the foremost rolling stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on the front rolling stand or, conversely, the sensor arrangement is arranged behind the last rolling stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, on the last roll stand works.
- This configuration is also realized, for example, when the sensor arrangement is arranged between two roll stands of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on one of these two roll stands, or the control device determines two such control values, one of which is applied to each one of these two roll stands acts.
- At least one of the second roll stands is arranged between the sensor device and the first roll stand.
- This configuration is implemented, for example, when the sensor device is arranged in front of the frontmost roll stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on a roll stand other than the frontmost roll stand, or, conversely, the sensor arrangement is arranged behind the last roll stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on a roll stand other than the last one.
- the senor device can be arranged in front of the foremost roll stand of the multi-stand rolling train and several control values can also be determined by the control device, taking into account the measured variable, of which one acts on the front roll stand and another on another roll stand.
- the sensor arrangement can also be arranged behind the last roll stand of the multi-stand rolling train and the control device can also determine several control values, taking into account the measured variable, of which one acts on the last roll stand and another on another roll stand.
- the first rolling mill has an upper work roll and a lower work roll.
- the control device is designed such that the under Taking into account the measured variable, the control value determined is a ratio of an upper peripheral speed, at which the upper work roll rotates, to a lower peripheral speed, at which the lower work roll rotates.
- This procedure can be advantageous, for example, for adjusting electrical or magnetic properties of the flat rolling stock. However, it can also be used to adjust the mechanical properties of the flat rolling stock.
- the control device is preferably designed in such a way that it determines the ratio of the upper peripheral speed to the lower peripheral speed in such a way that it is between 0.5 and 2.0, in particular between 0.9 and 1.1. This means that all cases relevant in practice can be covered.
- the upper work roll In order to be able to realize peripheral speeds that differ from one another, it is possible for the upper work roll to be driven by an upper drive and for the lower work roll to be driven by a lower drive that is different from the upper drive. In this case, the different peripheral speeds can easily be implemented by appropriately setting the two drives to different speeds.
- the upper work roll and the lower work roll can be driven by a common drive.
- a gear is arranged between the common drive on the one hand and the upper work roll and the lower work roll on the other side, by means of which a ratio of a speed of an upper output shaft of the gear, which is non-rotatably connected to the upper work roll, to a speed of a the lower work roll non-rotatably connected lower output shaft of the transmission is continuously adjustable.
- control device Alternatively or in addition to setting a ratio of the peripheral speeds to one another, it is possible for the control device to be designed in such a way that the control value determined taking into account the measured variable influences the temperature of the upper work roll and/or the lower work roll of the first roll stand and/or the flat rolling stock before rolling in the first rolling stand.
- cooling can be effected by spraying on water, or heating can be effected by induction heating.
- the control device is preferably designed in such a way that it outputs the control value determined taking into account the measured variable, taking into account a path tracking of the flat rolling stock from the sensor device to the first roll stand to the first roll stand.
- the control device therefore takes into account the transport time that elapses between the detection of the measured variable for a specific section of the flat rolled stock and the rolling of the same section of the flat rolled stock in the first roll stand.
- the control device preferably includes a model, by means of which the control device determines the control value for the first roll stand, taking into account the measured variable, and also determines an expected value for the material property of the flat rolling stock after rolling in the first roll stand, taking into account the control value determined taking the measured variable into account.
- a further sensor device is preferably arranged behind the first roll stand, by means of which at least one further measured variable characteristic of the material property of the flat rolling stock after rolling in the first roll stand can be detected.
- the additional sensor device is connected to the control device in order to transmit the recorded additional measured variable.
- control device is preferably designed such that it further Measured variable for a point in time that is determined by the control device, taking into account a path tracking of the flat rolling stock from the first roll stand to the further sensor device, and the model is adapted based on a comparison of the further measured variable and the expected value of the material property. With this procedure, the model can gradually be better adapted to the actual behavior of the flat rolling stock.
- the control device is preferably designed in such a way that, when determining the control value, it also measures the temperature of the flat rolling stock prior to rolling of the flat rolling stock in the first rolling stand and/or the rolling force during rolling of the flat rolling stock in the first rolling stand and/or the measured variable that is transmitted. or the reduction in the rolling of the flat rolled stock in the first roll stand is taken into account. As a result, the desired material properties can be set with greater accuracy.
- the required dependencies can be stored in the control device, for example in the form of characteristic curve fields.
- the sensor device includes an excitation element and a first sensor element.
- a base signal is excited in the flat rolling stock by means of the excitation element.
- a first sensor signal based on the excited base signal is detected by means of the first sensor element. It is possible for the sensor device to determine the transmitted measurement variable taking into account the first sensor signal. Alternatively, it is possible for the measured variable transmitted to include the first sensor signal.
- the sensor device also includes a number of second sensor elements.
- the respective second sensor element is arranged in front of or behind the first sensor element and/or laterally offset.
- a respective second sensor signal which is based on the excited base signal and is similar to the first sensor signal, is detected.
- the sensor device determines the transmitted measured variable, also taking into account the respective second sensor signal. For example, the difference or the quotient of the corresponding sensor signals can be formed.
- the transmitted measured variable also includes the respective second sensor signal. In this case, similar evaluations can be carried out by the control device.
- the base signal can be an eddy current, for example.
- the base signal can be a sound signal, in particular an ultrasonic signal.
- a connecting line from the excitation element to the first sensor element preferably runs parallel to the transport direction. This results in a particularly reliable evaluation.
- the material property can be an electromagnetic property or a mechanical property of the rolling stock.
- hot rolling can take place.
- cold rolling takes place.
- the rolling mill is thus usually a cold rolling mill.
- FIG 1 has a rolling mill--like any rolling mill--at least a first roll stand 1.
- the first roll stand 1 is used for rolling a flat rolling stock 2 made of metal, in particular a strip.
- the metal from which the flat rolling stock 2 is made can, in particular, be steel or aluminum.
- the flat rolling stock can in particular be an electrical steel sheet with a relatively high proportion of silicon (usually between 2% and 4%).
- the rolling can be hot rolling.
- the rolling mill is a hot rolling mill. As a rule, however, it is cold rolling. In this case, the rolling mill is a cold rolling mill.
- the first roll stand 1 From the first roll stand 1 are in FIG 1 and only the upper work roll 3 and the lower work roll 4 are shown in the other figures.
- the first roll stand 1 also has other rolls, for example in a four-high stand in addition to the work rolls 3, 4 back-up rolls and in a six-high stand in addition to the work rolls 3, 4 and the back-up rolls intermediate rolls between the work rolls 3, 4 and the back-up rolls.
- Other configurations are also possible, for example as a so-called 20-roll rolling stand.
- the upper work roll 3 rotates at an upper peripheral speed vO
- the lower work roll 4 rotates at a lower peripheral speed vU. Both the upper and the lower peripheral speeds vO, vU are greater than 0.
- the rolling mill is designed as a reversing rolling mill. It therefore has a coiler 5 in front of and behind the first roll stand 1 for rolling the flat rolling stock 2 .
- the terms “in front of” and “behind” are always to be seen in connection with the transport direction x, with which the flat rolling stock 2 is rolled in the first roll stand 1.
- the terms "before” and “after” are therefore only defined during a respective rolling pass and are reversed at the respective next rolling pass.
- a sensor device 6 is arranged behind the first roll stand 1 .
- a measured variable M can be detected by means of the sensor device 6 .
- the recorded measurement variable M is characteristic of a material property of the flat rolling stock 2 .
- materials property are the electrical conductivity, the permeability number and the magnetic saturation or generally an electromagnetic property of the rolling stock 2.
- Further examples of material properties are the yield point, the yield point, the elongation at break or generally a mechanical property of the rolling stock 2.
- the variables mentioned can alternatively be direction-independent (i.e. isotropic) or direction-dependent (i.e. anisotropic). They are all based on the grain structure and possibly also the alignment of the grains of the metal from which the rolling stock 2 is made.
- the sensor device 6 includes an excitation element 7.
- a base signal can be excited in the flat rolling stock 2.
- the excitation element 7 as shown in FIGS 3 and 4 be designed as a coil, which is intermittently supplied with an excitation current IA and thereby generates an eddy current IW in the rolling stock 2 as a base signal.
- 3 shows the sensor device 4 at a point in time when the excitation element 7 is acted upon by the excitation current IA.
- the sensor device 6 also includes a first sensor element 8a.
- a first sensor signal Ia is detected by means of the first sensor element 8a.
- the first sensor signal Ia is detected after the base signal has been excited, ie at a different, later point in time. As a rule, no base signal is excited at this later point in time. However, a previously excited base signal has not yet completely decayed.
- the first sensor signal Ia is based on the excited base signal.
- the first sensor element 8a as shown in FIGS 3 and 4 be designed as a coil, so that a current is induced in the first sensor element 8a due to the eddy current IW, which forms the first sensor signal Ia.
- the first sensor element 8a is in the 2 to 4 shown as a different element from the excitation element 7 .
- This configuration represents the normal case.
- the first sensor element 8a is arranged behind the excitation element 7 as viewed in the transport direction x of the rolling stock 2 .
- a connecting line from the excitation element 7 to the first sensor element 8a preferably runs parallel to the transport direction x.
- the first sensor element 8a can also be identical to the excitation element 7 . This refinement can then be possible in particular be when a period of time between the excitation of the base signal and the detection of the excited base signal is sufficiently small.
- the sensor device 6 is according to FIG 1 connected to a control device 9 for the rolling mill. Due to the connection of the sensor device 6 to the control device 9 , the detected measured variable M can in particular be transmitted to the control device 9 . It is possible for the transmitted measurement variable M to include the first sensor signal Ia. If the transmitted measured variable M does not contain any further components, the transmitted measured variable M can also be identical to the first sensor signal Ia. Alternatively, it is possible for the sensor device 6 to first evaluate the first sensor signal Ia (and optionally other signals) to determine the measured variable M and for the result of this evaluation to be the measured variable M. For example, the sensor device 6 can set the first sensor signal Ia in relation to the excitation signal IA and thereby determine the measured variable M.
- the sensor device 6 In addition to the first sensor element 8a, the sensor device 6 often includes a number of second sensor elements 8b to 8d.
- the second sensor elements 8b to 8d are different from the first sensor element 8a (and usually also from the excitation element 7). Seen from the excitation element 7, the second sensor elements 8b to 8d are generally arranged behind the excitation element 7, even if this can be deviated from in individual cases.
- Second sensor signals Ib to Id can be detected by means of the second sensor elements 8b to 8d.
- the second sensor signals Ib to Id are also based on the excited base signal IW and are similar to the first sensor signal Ia.
- the second sensor signals Ib to Id are generally recorded simultaneously with the first sensor signal Ia.
- the sensor device 6 can be used as a measured variable M For example, transmit the sensor signals Ia to Id as a whole, i.e. both the first sensor signal Ia and the second sensor signals Ib to Id. In this case, the sensor signals Ia to Id are evaluated accordingly by the control device 9. Alternatively, an evaluation of the sensor signals Ia to Id (Fully or partially) are already carried out by the sensor device 6 and the result of this evaluation is transmitted as the measured variable M.
- the sensor device 6 can have a second sensor element 8b, 8c, which is arranged laterally offset from the first sensor element 8a in the transport direction x.
- the sensor device 6 can set the first sensor signal Ia in relation to the second sensor signal Ib, Ic and thereby determine the measured variable M.
- the measured variable M can be determined in particular using the difference or the quotient of the sensor signals Ia, Ib, Ic. If, as in FIG 2 shown, a second sensor element 8b, 8c is arranged on both sides of the first sensor element 8a, the sensor device 6 can set the first sensor signal Ia in relation to the mean value of these two second sensor signals Ib, Ic.
- the sensor device 6 can have a second sensor element 8d, which is arranged in front of or behind the first sensor element 8a, viewed from the first sensor element 8a in the transport direction x.
- an arrangement behind the first sensor element 8a is the norm.
- the sensor device 6 can set the first sensor signal Ia in relation to the second sensor signal 8d and thus the measured variable M detect.
- the measurand M can also in this case, in particular based on the difference or the quotient of the sensor signals Ia, Id.
- the controller 9 takes according to 5 in a step S1, the measured variable M transmitted to them.
- the control device 9 determines a control value A for the first roll stand 1.
- the control device 9 takes into account at least the transmitted measured variable M when determining the control value A.
- the control device 9 often also takes into account other variable data such as, for example, the temperature T of the flat rolling stock 2 before rolling in the first roll stand 1 and/or or the rolling force F when rolling the flat rolling stock 2 in the first rolling stand 1 and/or the reduction in thickness when rolling the flat rolling stock 2 in the first rolling stand 1.
- the temperature T and the rolling force F can be detected by means of appropriate sensors, which are generally known to those skilled in the art are.
- the pass reduction i.e. the ratio of the exit-side thickness d2 of the flat rolling stock 2 to the entry-side thickness d1 of the flat rolling stock 2 (see FIG 1 )
- the control device 9 can be known, for example, on the basis of a pass schedule. Furthermore, the control device 9 can take into account the speed of the flat rolling stock 2 in the area of the sensor device 6, in particular when evaluating the measured variable M. If necessary, the positions of the excitation element 7 and/or the sensor elements 8a to 8d can also be taken into account. In a step S3, the control device 9 controls the first roll stand 1 according to the control value A determined.
- the control device 9 iteratively carries out the steps S1 to S3 again and again.
- a time constant with which the repetition takes place is usually in the range between 0.1 s and 1.0 s, in particular between 0.2 s and 0.5 s.
- the control device 9 is designed in such a way that it takes the procedure from 5 executes
- the controller 9 is still as shown in FIG 1 usually designed as a software-programmable control device.
- the control device 9 is programmed with a control program 10 .
- the control program 10 includes program code 11 which can be processed by the control device 9 .
- the control device 9 processes the program code 11 during operation.
- the processing of the program code 11 by the control device 9 causes the control device 9 to be designed accordingly.
- the 6 to 8 point to the 2 to 4 completely analogous configurations.
- the 6 to 8 the excitation element 7 emits a sound signal, in particular an ultrasonic signal.
- the sensor elements 8a to 8d are also designed to detect a corresponding sound signal. Otherwise, the comments on the 2 to 4 applicable in an analogous way.
- control device 9 shows a modification of the rolling mill of FIG 1 .
- the difference is that when designing the rolling mill according to 9 the sensor device 6 is now no longer arranged behind the first roll stand 1, but in front of the first roll stand 1. Otherwise, the statements are to FIG 1 and also the explanations based on it 2 to 8 -
- the design of the control device 9 as software-programmable - still applicable.
- the control device 9 outputs the control value A, which it determines taking into account the measured variable M, taking into account a path tracking of the flat rolling stock 2 from the sensor device 6 to the first rolling stand 1 to the first rolling stand 1 .
- the details of this are explained in connection with a further embodiment, which is described below in connection with 10 is explained.
- the sensor device 6 goes from 9 . Same as with 9 is therefore in accordance with the design 10 the sensor device 6 is arranged in front of the first roll stand 1 .
- the control device 9 includes--for example due to the execution of the program code 11--a model 12.
- a further sensor device 13 is arranged behind the first roll stand 1.
- At least one further measured variable M′ can be detected by means of the further sensor device 13 .
- the further measured variable M′ recorded is characteristic of the material property of the flat rolling stock 2 as it is present after rolling in the first roll stand 1 .
- the other measured variable M' is therefore characteristic of the same material property as the measured variable M and is therefore similar to the measured variable M.
- the difference is that the measured variable ⁇ e M for the material property of the flat rolling stock 2 before rolling in the first roll stand 1 is characteristic, while the measured variable M' is characteristic of the material property of the flat rolling stock 2 after rolling in the first roll stand 1.
- the additional sensor device 13 is also connected to the control device 9 for the rolling mill. Due to the connection of the additional sensor device 13 to the control device 9 , the recorded additional measured variable M′ can in particular be transmitted to the control device 9 .
- the operation of the rolling mill from 10 is hereinafter referred to in connection with 11 explained.
- 11 shows 11 also the operation of the rolling mill of 9 .
- a step S11 the control device 9 receives the measured variable M transmitted to it.
- Step S11 corresponds 1:1 to step S1 of FIG FIG 2 .
- the control device 9 determines the control value A for the first roll stand 1.
- the core of the step S12 corresponds to the step S2 of FIG FIG 2 .
- the difference is that the control device 9 determines the activation value A using the model 12 in step S12.
- a model parameter k is included in the determination of the control value A.
- control device 9 determines an expected value E for the material property of the flat rolling stock 2 after rolling in the first roll stand 1, taking into account this control value A - i.e. the control value A determined in step S12. This determination is also made using the model 12 .
- the control device 9 waits for a first waiting time t1.
- the first waiting time t1 corresponds to the time that a specific section of the flat rolling stock 2 needs to reach the first roll stand 1 starting from the sensor device 6 .
- the control device 9 thus essentially implements a path tracking of the flat rolling stock 2 from the sensor device 6 to the first roll stand 1.
- the first waiting time corresponds to t1—see FIG 10 - the distance a1 from the sensor device 6 to the first roll stand 1, divided by the transport speed v1 of the flat rolling stock 2 in front of the first roll stand 1.
- the first waiting time t1 may have to end an addition of several times can be determined, each time being characteristic of a specific section and characterized by the Transport speed of the flat rolling stock 2 in each section and the length of each section results.
- Step S15 essentially corresponds to step S3 of FIG FIG 2 .
- the control device 9 outputs the control value A to the first rolling stand 1 , taking into account the tracking of the flat rolling stock 2 from the sensor device 6 to the first rolling stand 1 .
- the control device 9 then waits for a second waiting time t2.
- the second waiting time t2 corresponds to the time that a specific section of the flat rolling stock 2 requires in order to reach the further sensor device 13 starting from the first roll stand 1 .
- the control device 9 thus essentially implements a path tracking of the flat rolling stock 2 from the first roll stand 1 to the further sensor device 13.
- t1 see again 10 - the second waiting time t2 corresponds to the distance a2 from the first rolling stand 1 to the further sensor device 13, divided by the transport speed v2 of the flat rolling stock 2 behind the first rolling stand 1.
- the second waiting time t2 must be determined by adding several times, each time being characteristic of a specific section and resulting from the transport speed of the flat rolling stock 2 in the respective section and the length of the respective section.
- the control device 9 receives from the further sensor device 13 that further measured variable M′ which is detected by the further sensor device 13 at this point in time.
- the controller performs 9 calculates the model parameter k based on a comparison of the further measured variable M' and the expected value E of the material property E and thereby adapts the model 12.
- the control device 9 evaluates the further measured variable M' as part of the adaptation of the model 12 for a point in time which the control device 9 has determined taking into account the tracking of the flat rolling stock 2 from the first roll stand 1 to the further sensor device 13 .
- the control device 9 carries out the steps S11 to S18 iteratively again and again, analogously to the steps S1 to S3.
- the above explanations for steps S1 to S3 can be applied analogously.
- steps S11 to S18 and their sequence are implemented slightly differently in practice.
- steps S11 to S18 can be instantiated multiple times. It is also possible to divide the sequence of steps S11 to S18 into two parts, which are executed in parallel. In this case, the first part comprises steps S11 to S15, and the second part comprises steps S16 to S18.
- steps S14 and S16 it is also possible to omit steps S14 and S16 as such.
- a direct, unsynchronized execution of the remaining steps S11 to S13, S15, S17 and S18 can take place.
- the respective control value A determined in step S12 and the respective expected value E determined in step S13 can be temporarily buffered in a buffer (not shown).
- the respective further measurement variable M′ recorded in step S17 can also be temporarily buffered in the intermediate memory.
- the respective control value A is assigned an execution time when it is stored.
- a realization time is assigned to the respective expected value E in an analogous manner.
- a detection time can also be assigned to the respective further measured variable M′ will.
- step S15 when step S15 is executed, that stored control value A whose execution time has just been reached is output.
- step S18 that stored expected value E is used whose time of use coincides with the current time. If necessary, stored control values A and stored expected values E can be interpolated in this context. If the further measured variables M' and their acquisition times are also stored, this also applies in an analogous manner to the further measured variables M'.
- the type of drive value A can be determined as needed. What is decisive is that the activation of the first roll stand 1 with the activation value A influences the material properties of the flat rolling stock 2 . For example, it is as shown in the 12 and 13 It is possible for the control device 9 to determine a ratio of the upper peripheral speed vO to the lower peripheral speed vU as the control value A. In this case, therefore, asymmetrical rolling takes place, in which the two work rolls 3, 4 rotate at peripheral speeds vO, vU that differ from one another.
- the control value A can, for example, as shown in FIGS 12 and 13 as a factor by which the lower peripheral speed vU (or its target value vU*) must be multiplied when determining the upper peripheral speed vO (or its target value vO*).
- the ratio of the upper peripheral speed vO to the lower peripheral speed vU is between 0.5 and 2.0, in particular between 0.9 and 1.1. Furthermore, in generally irrelevant which of the two work rolls 3, 4 rotates faster than the other work roll 4, 3.
- the upper work roll 3 is driven by an upper drive 14, while the lower work roll 4 is driven by a lower drive 15.
- the lower drive 15 is in accordance with the design 12 a different drive from the upper drive 14 . In this case, only the upper drive 14 and the lower drive 15 have to be given the corresponding desired values vO*, vU*.
- the upper work roll 3 and the lower work roll 4 in the embodiment of FIG 13 driven by a common drive 16.
- a gear 17 is arranged between the common drive 16 on the one hand and the upper work roll 3 and the lower work roll 4 on the other side.
- the transmission has an input shaft 18 on the one hand and an upper output shaft 19 and a lower output shaft 20 on the other.
- the input shaft 18 is non-rotatably connected to the common drive 16 .
- the upper output shaft 19 is non-rotatably connected to the upper work roll 3, the lower output shaft 20 to the lower work roll 4.
- the input shaft 18 acts both on the upper output shaft 19 and on the lower output shaft 20.
- the gear 17 is designed in such a way that a ratio of a speed of the upper output shaft 19 to a speed of the lower output shaft 20 can be continuously adjusted by means of the gear 17 .
- the transmission 17 can have a distribution block 21 on the one hand, in which the drive train is divided between the upper and lower work rolls 3, 4. Between the distribution block 21 and the upper work roll 3 can then be arranged an intermediate gear 22, by means of which a stepless variation the output-side speed relative to the input-side speed of the intermediate gear 22 is possible.
- Such intermediate gears 22 are well known to those skilled in the art. Examples are a planetary gear and a differential gear.
- an intermediate gear (not shown) can also be arranged between the dividing block 21 and the lower working roll 4.
- the control value A can be a temperature influencing of the upper work roll 3, which acts on the upper work roll 3 via a corresponding influencing device 23.
- the upper work roll 3 can be cooled by spraying water on it.
- the control value A can be a temperature influence on the lower work roll 4 .
- the lower work roll 4 can be cooled by spraying on water via a corresponding influencing device 23'.
- the control value A can be a temperature influencing of the flat rolling stock 2 before rolling in the first roll stand 1 .
- the flat rolling stock 2 can be heated, in particular inductively, via a corresponding influencing device 23′′.
- the rolling mill has a plurality of roll stands 1, 24 through which the rolling stock 2 passes sequentially one after the other.
- the rolling mill is designed as a multi-stand rolling train.
- the number of five rolling stands 1, 24 arranged one behind the other that is shown in each case is only purely exemplary.
- the second roll stands 24 are in the 15 to 20 only the work rolls shown.
- the rolling stock 2 and the sensor device 6 and optionally the further sensor device 13 are shown.
- the other components of the rolling mill - in particular the control device 9 - are available.
- the control device 9 usually acts on all roll stands 1, 24 of the rolling mill, even if in the 15 to 20 only the activation of the first roll stand 1 with the activation value A is shown.
- the configurations of 15 to 20 are largely the same. However, they differ in the arrangement of the sensor device 6, in the arrangement of the second roll stands 24 relative to the sensor device 6 and to the first roll stand 1 and the presence or absence of the further sensor device 13.
- the sensor device 6 is arranged behind the last rolling stand 1, 24 of the rolling train.
- the actuation value A that is, the actuation value A determined taking into account the measured variable M—acts on the last roll stand 1 of the rolling train.
- the second roll stands 24 are not arranged between the sensor device 6 and the first roll stand 1 .
- the control value A - i.e. the control value A determined taking into account the measured variable M - acts on another roll stand 1 of the rolling train, for example the penultimate rolling stand of the rolling train arranged immediately upstream of the last rolling stand 24 of the rolling train.
- at least one of the second roll stands 24 - specifically at least the last roll stand 24 of the rolling train - is arranged between the sensor device 6 and the first roll stand 1 .
- the sensor device 6 is arranged in front of the foremost roll stand 1, 24 of the rolling train.
- the actuation value A that is, the actuation value A determined taking into account the measured variable M—acts on the foremost roll stand 1 of the rolling train.
- the second roll stands 24 are not arranged between the sensor device 6 and the first roll stand 1 .
- the control value A - i.e. the control value A determined taking into account the measured variable M - acts on another rolling stand 1 of the rolling train, for example on the rolling stand 1 immediately downstream of the foremost rolling stand 24 in the rolling train.
- at least one of the second rolling stands 24 - concretely at least the foremost rolling stand 24 of the rolling train - arranged between the sensor device 6 and the first rolling stand 1 .
- the further sensor device 13 is also arranged behind the last rolling stand 1, 24 of the rolling train, so that the corresponding adaptation of the model 12 can take place. In the designs of 17 and 18 however, the further sensor device 13 is not present.
- the configurations of 15 to 20 are not the only possible configurations of a multi-stand rolling train.
- several second roll stands 24 to be arranged between the first roll stand 1 and the sensor device 6 .
- the sensor device 6 behind the last roll stand 24 of the rolling train be arranged and act on the foremost rolling stand 1 of the rolling train or, conversely, be arranged in front of the foremost rolling stand 24 of the rolling train and act on the last rolling stand 1 of the rolling train.
- control device 9 determines a plurality of control values A on the basis of the measured variable M of an individual sensor device, each of which is based on a different one first roll stand 1 act. It is up to the person skilled in the art to decide which configuration is specifically adopted.
- the present invention has many advantages.
- a simple integration of the procedure according to the invention into the ongoing operation of the rolling mill is possible.
- an annealing treatment after cold rolling or between two cold rolling steps is often no longer necessary or only necessary to a limited extent.
- the discontinuity of material properties caused by cooling in the cooling section of the hot rolling mill can be reduced or eliminated. If the action on the flat rolling stock 2 can be spatially resolved by means of the control value A in the width direction of the flat rolling stock 2 (this is the case in particular with a thermal influence), under Circumstances, several sensor devices 6 can also be arranged next to one another.
Description
Die vorliegende Erfindung geht aus von einem Walzwerk mit einem ersten Walzgerüst zum Walzen eines flachen Walzguts aus Metall,
- wobei vor und/oder hinter dem ersten Walzgerüst eine Sensoreinrichtung angeordnet ist,
- wobei die Sensoreinrichtung zum Übermitteln der erfassten Messgröße mit einer Steuereinrichtung für das Walzwerk verbunden ist,
- wobei die Steuereinrichtung derart ausgebildet ist, dass sie die übermittelte Messgröße im Rahmen der Ermittlung eines Ansteuerwertes für das erste Walzgerüst berücksichtigt,
- wobei das Ansteuern des ersten Walzgerüsts mit dem Ansteuerwert die Werkstoffeigenschaft des flachen Walzguts beeinflusst,
- wobei das erste Walzgerüst eine obere Arbeitswalze und eine untere Arbeitswalze aufweist.
- a sensor device being arranged in front of and/or behind the first roll stand,
- wherein the sensor device is connected to a control device for the rolling mill in order to transmit the measured variable,
- wherein the control device is designed in such a way that it takes the transmitted measured variable into account when determining a control value for the first roll stand,
- the activation of the first roll stand with the activation value influencing the material property of the flat rolling stock,
- wherein the first rolling mill has an upper work roll and a lower work roll.
Der Begriff "erstes Walzgerüst" ist im Rahmen der vorliegenden Erfindung nicht derart gemeint, dass das Walzwerk zwangsweise mehrere Walzgerüste aufweist und das erste Walzgerüst das vorderste, von dem flachen Walzgut zuerst durchlaufene Walzgerüst ist. Vielmehr soll zunächst der Fall mit umfasst sein, dass das Walzwerk nur das erste Walzgerüst aufweist. In diesem Fall ist ausschließlich das erste Walzgerüst vorhanden. Weiterhin dient auch in dem Fall, dass das Walzwerk mehrere Walzgerüste aufweist, der Begriff "erstes Walzgerüst" lediglich der Unterscheidung von den anderen Walzgerüsten des Walzwerks. Hingegen soll keine Reihenfolge impliziert sein. Das erste Walzgerüst kann also auch in diesem Fall in der Abfolge von Walzgerüsten des Walzwerks an beliebiger Stelle angeordnet sein. Wenn also - rein beispielhaft - das flache Walzgut zuerst ein Walzgerüst A, dann ein Walzgerüst B, dann ein Walzgerüst C und schließlich ein Walzgerüst D durchläuft, kann das erste Walzgerüst ein beliebiges der Walzgerüste A bis D sein, während die anderen Walzgerüste zweite Walzgerüste sind.In the context of the present invention, the term “first rolling stand” does not mean that the rolling mill necessarily has a plurality of rolling stands and the first rolling stand is the foremost rolling stand through which the flat rolling stock passes first. Rather, the case should first be included that the rolling mill has only the first roll stand. In this case, only the first roll stand is present. Furthermore, even if the rolling mill has a plurality of rolling stands, the term “first rolling stand” only serves to distinguish it from the other rolling stands of the rolling mill. However, no order should be implied. In this case, too, the first roll stand can be arranged at any point in the sequence of roll stands of the rolling mill. So if - purely by way of example - the flat rolling stock first runs through a roll stand A, then a roll stand B, then a roll stand C and finally a roll stand D, the first roll stand can be any one of the roll stands A to D, while the other rolling stands are second rolling stands.
Bei der Herstellung eines flachen Walzguts ist man bestrebt, die geometrischen Eigenschaften des flachen Walzguts, also insbesondere dessen Breite und dessen Dicke, mit möglichst hoher Präzision einzustellen. Gleiches gilt auch für das Profil bzw. die Kontur. Auch die Planheit soll eingehalten werden. Zusätzlich zu diesen und gegebenenfalls auch anderen geometrischen Eigenschaften sollen weiterhin auch Werkstoffeigenschaften des flachen Walzguts eingestellt werden. Werkstoffeigenschaften sind Eigenschaften, die das flache Walzgut beim späteren Einsatz aufweisen soll, beispielsweise eine bestimmte Streckgrenze, eine bestimmte Materialhärte oder eine bestimmte Magnetisierbarkeit. Werkstoffeigenschaften sind also Eigenschaften, die das Material unabhängig von seinem konkreten aktuellen Zustand (wie beispielsweise der Temperatur) und auch unabhängig von seinen geometrischen Eigenschaften aufweist. Ursache für bestimmte Werkstoffeigenschaften ist - neben dem Werkstoff als solchem - die Kornstruktur des Metalls.When producing a flat rolled stock, the aim is to set the geometric properties of the flat rolled stock, ie in particular its width and its thickness, with the greatest possible precision. The same applies to the profile or the contour. Flatness should also be maintained. In addition to these and possibly also other geometric properties, material properties of the flat rolling stock should also be adjusted. Material properties are properties that the flat rolling stock should have when it is later used, for example a certain yield point, a certain material hardness or a certain magnetizability. Material properties are properties that the material exhibits independently of its specific current state (such as temperature) and also independently of its geometric properties. The reason for certain material properties is - in addition to the material as such - the grain structure of the metal.
Das Einstellen von Werkstoffeigenschaften kann - zumindest teilweise - beim Walzen des flachen Walzguts erfolgen. Oftmals verbleibt jedoch eine Differenz des tatsächlichen Wertes einer Werkstoffeigenschaft von einem gewünschten Zielwert. In diesem Fall ist es erforderlich, das flache Walzgut nach dem Warmwalzen thermisch zu behandeln. Dies gilt ganz besonders, wenn bei dem Walzgut eine bestimmte sogenannte Goss-Textur eingestellt werden soll. Ähnliche Probleme stellen sich aber auch bei bestimmten Stählen, insbesondere bei AHSS (= advanced high strength steel) sowie martensitischen und bainitischen Güten. Im Falle einer thermischen Behandlung kann das Walzgut zum Einstellen von Werkstoffeigenschaften beispielsweise nach einem Warmwalzen in einer Kühlstrecke in geeigneter Weise gekühlt werden oder im Rahmen des Kaltwalzens in einer Glühe behandelt werden. Diese Behandlung kann alternativ nach dem Kaltwalzen oder zwischen zwei Kaltwalzschritten erfolgen.Material properties can be adjusted—at least partially—during the rolling of the flat rolling stock. However, there often remains a difference in the actual value of a material property from a desired target value. In this case, it is necessary to thermally treat the flat rolled stock after hot rolling. This applies in particular if a certain so-called Goss texture is to be set for the rolling stock. However, similar problems also arise with certain steels, in particular with AHSS (= advanced high strength steel) as well as martensitic and bainitic grades. In the case of a thermal treatment, the rolling stock can be cooled in a suitable manner in a cooling zone, for example after hot rolling, or treated in an annealing machine as part of the cold rolling, in order to set material properties. This treatment can be alternative after cold rolling or between two cold rolling steps.
Aus dem Fachaufsatz "
Ein Walzwerk der eingangs genannten Art ist beispielsweise aus der
Die Aufgabe der vorliegenden Erfindung besteht darin, Möglichkeiten zu schaffen, mittels derer auf einfache und zuverlässige Weise eine Werkstoffeigenschaft des flachen Walzguts gezielt eingestellt werden kann.The object of the present invention is to create possibilities by means of which a material property of the flat rolling stock can be adjusted in a targeted manner in a simple and reliable manner.
Die Aufgabe wird durch ein Walzwerk mit den Merkmalen des Anspruchs 1 gelöst. Vorteilhafte Ausgestaltungen des Walzwerks sind Gegenstand der abhängigen Ansprüche 2 bis 16.The object is achieved by a rolling mill having the features of
Erfindungsgemäß ist bei einem Walzwerk der eingangs genannten Art die Steuereinrichtung derart ausgebildet ist, dass der unter Berücksichtigung der Messgröße ermittelte Ansteuerwert ein Verhältnis einer oberen Umfangsgeschwindigkeit, mit welcher die obere Arbeitswalze rotiert, zu einer unteren Umfangsgeschwindigkeit ist, mit welcher die untere Arbeitswalze rotiert.According to the invention, in a rolling mill of the type mentioned at the outset, the control device is designed in such a way that the control value determined taking into account the measured variable is a ratio of an upper peripheral speed at which the upper work roll rotates to a lower peripheral speed at which the lower work roll rotates.
Es wird also eine Messgröße erfasst, anhand derer direkt die entsprechende Werkstoffeigenschaft des flachen Walzguts zum Zeitpunkt der Messung ermittelt werden kann. Es gibt also einen direkten funktionalen Zusammenhang zwischen der Messgröße einerseits und der Werkstoffeigenschaft andererseits. Hingegen ist es nicht erforderlich, komplizierte Modellrechnungen durchzuführen, mittels derer beispielsweise eine zeitliche Entwicklung modelliert wird.So a measured variable is recorded, which can be used to directly determine the corresponding material property of the flat rolling stock Time of measurement can be determined. There is therefore a direct functional relationship between the measured variable on the one hand and the material property on the other. On the other hand, it is not necessary to carry out complicated model calculations, by means of which, for example, a development over time is modeled.
Die Formulierung "zum Zeitpunkt der Messung" soll hierbei nicht implizieren, dass sich die Werkstoffeigenschaft im Laufe der Zeit aufgrund der Änderung des Zustands des flachen Walzguts wie beispielsweise dessen Temperatur automatisch laufend ebenfalls ändert. Die Werkstoffeigenschaft kann aber durch eine entsprechende Behandlung des Walzguts - beispielsweise durch das Walzen im ersten Walzgerüst oder ein Walzen in einem anderen Walzgerüst oder durch eine thermische Behandlung zu einem späteren Zeitpunkt auf einen anderen Wert eingestellt werden.The wording "at the time of the measurement" is not intended to imply that the material property also automatically changes over time due to the change in the condition of the flat rolling stock, such as its temperature. However, the material property can be adjusted to a different value at a later point in time by appropriate treatment of the rolling stock, for example by rolling in the first roll stand or by rolling in another roll stand or by thermal treatment.
Es ist möglich, dass das Walzwerk ausschließlich das genannte erste Walzgerüst und demzufolge nur ein einziges Walzgerüst aufweist. In diesem Fall ist die Sensoreinrichtung ganz von selbst unmittelbar vor oder unmittelbar hinter dem Walzgerüst angeordnet. Es ist jedoch ebenso möglich, dass das Walzwerk zusätzlich zum ersten Walzgerüst auch mindestens ein zweites Walzgerüst aufweist. In diesem Fall sind mehrere verschiedene Ausgestaltungen möglich.It is possible that the rolling mill has only said first roll stand and consequently only a single roll stand. In this case, the sensor device is arranged all by itself directly in front of or directly behind the roll stand. However, it is also possible for the rolling mill to have at least one second rolling stand in addition to the first rolling stand. In this case, several different configurations are possible.
So ist es beispielsweise möglich, dass die zweiten Walzgerüste nicht zwischen der Sensoreinrichtung und dem ersten Walzgerüst angeordnet sind. Diese Ausgestaltung ist beispielsweise dann realisiert, wenn die Sensoreinrichtung vor dem vordersten Walzgerüst einer mehrgerüstigen Walzstraße angeordnet ist und der von der Steuereinrichtung unter Berücksichtigung der Messgröße ermittelte Ansteuerwert auf das vorderste Walzgerüst wirkt oder umgekehrt die Sensoranordnung hinter dem letzten Walzgerüst einer mehrgerüstigen Walzstraße angeordnet ist und der von der Steuereinrichtung unter Berücksichtigung der Messgröße ermittelte Ansteuerwert auf das letzte Walzgerüst wirkt. Ebenso ist diese Ausgestaltung beispielsweise dann realisiert, wenn die Sensoranordnung zwischen zwei Walzgerüsten einer mehrgerüstigen Walzstraße angeordnet ist und der von der Steuereinrichtung unter Berücksichtigung der Messgröße ermittelte Ansteuerwert auf eines dieser beiden Walzgerüste wirkt oder die Steuereinrichtung zwei derartige Ansteuerwerte ermittelt, von denen je einer auf je eines dieser beiden Walzgerüste wirkt.For example, it is possible that the second roll stands are not arranged between the sensor device and the first roll stand. This configuration is implemented, for example, when the sensor device is arranged in front of the foremost rolling stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on the front rolling stand or, conversely, the sensor arrangement is arranged behind the last rolling stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, on the last roll stand works. This configuration is also realized, for example, when the sensor arrangement is arranged between two roll stands of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on one of these two roll stands, or the control device determines two such control values, one of which is applied to each one of these two roll stands acts.
Alternativ ist es möglich, dass mindestens eines der zweiten Walzgerüste zwischen der Sensoreinrichtung und dem ersten Walzgerüst angeordnet ist. Diese Ausgestaltung ist beispielsweise dann realisiert, wenn die Sensoreinrichtung vor dem vordersten Walzgerüst einer mehrgerüstigen Walzstraße angeordnet ist und der von der Steuereinrichtung unter Berücksichtigung der Messgröße ermittelte Ansteuerwert auf ein anderes als das vorderste Walzgerüst wirkt oder umgekehrt die Sensoranordnung hinter dem letzten Walzgerüst einer mehrgerüstigen Walzstraße angeordnet ist und der von der Steuereinrichtung unter Berücksichtigung der Messgröße ermittelte Ansteuerwert auf ein anderes als das letzte Walzgerüst wirkt.Alternatively, it is possible for at least one of the second roll stands to be arranged between the sensor device and the first roll stand. This configuration is implemented, for example, when the sensor device is arranged in front of the frontmost roll stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on a roll stand other than the frontmost roll stand, or, conversely, the sensor arrangement is arranged behind the last roll stand of a multi-stand rolling train and the control value determined by the control device, taking into account the measured variable, acts on a roll stand other than the last one.
Natürlich sind auch Kombinationen dieser Vorgehensweisen möglich. So kann beispielsweise die Sensoreinrichtung vor dem vordersten Walzgerüst der mehrgerüstigen Walzstraße angeordnet sein und können weiterhin von der Steuereinrichtung unter Berücksichtigung der Messgröße mehrere Ansteuerwerte ermittelt werden, von denen einer auf das vorderste Walzgerüst und ein anderer auf ein anderes Walzgerüst wirkt. Ebenso kann umgekehrt die Sensoranordnung hinter dem letzten Walzgerüst der mehrgerüstigen Walzstraße angeordnet sein und können weiterhin von der Steuereinrichtung unter Berücksichtigung der Messgröße mehrere Ansteuerwerte ermittelt werden, von denen einer auf das letzte Walzgerüst und ein anderer auf ein anderes Walzgerüst wirkt.Of course, combinations of these procedures are also possible. For example, the sensor device can be arranged in front of the foremost roll stand of the multi-stand rolling train and several control values can also be determined by the control device, taking into account the measured variable, of which one acts on the front roll stand and another on another roll stand. Conversely, the sensor arrangement can also be arranged behind the last roll stand of the multi-stand rolling train and the control device can also determine several control values, taking into account the measured variable, of which one acts on the last roll stand and another on another roll stand.
Das erste Walzgerüst weist eine obere Arbeitswalze und eine untere Arbeitswalze auf. Die Steuereinrichtung ist derart ausgebildet, dass der unter Berücksichtigung der Messgröße ermittelte Ansteuerwert ein Verhältnis einer oberen Umfangsgeschwindigkeit, mit welcher die obere Arbeitswalze rotiert, zu einer unteren Umfangsgeschwindigkeit ist, mit welcher die untere Arbeitswalze rotiert. Diese Vorgehensweise kann beispielsweise zum Einstellen elektrischer oder magnetischer Eigenschaften des flachen Walzguts von Vorteil sein. Sie kann aber auch zum Einstellen mechanischer Eigenschaften des flachen Walzguts genutzt werden.The first rolling mill has an upper work roll and a lower work roll. The control device is designed such that the under Taking into account the measured variable, the control value determined is a ratio of an upper peripheral speed, at which the upper work roll rotates, to a lower peripheral speed, at which the lower work roll rotates. This procedure can be advantageous, for example, for adjusting electrical or magnetic properties of the flat rolling stock. However, it can also be used to adjust the mechanical properties of the flat rolling stock.
Vorzugsweise ist die Steuereinrichtung derart ausgebildet, dass sie das Verhältnis der oberen Umfangsgeschwindigkeit zur unteren Umfangsgeschwindigkeit derart ermittelt, dass es zwischen 0,5 und 2,0 liegt, insbesondere zwischen 0,9 und 1,1. Dadurch können alle in der Praxis relevanten Fälle abgedeckt werden.The control device is preferably designed in such a way that it determines the ratio of the upper peripheral speed to the lower peripheral speed in such a way that it is between 0.5 and 2.0, in particular between 0.9 and 1.1. This means that all cases relevant in practice can be covered.
Um voneinander verschiedene Umfangsgeschwindigkeiten realisieren zu können, ist es möglich, dass die obere Arbeitswalze von einem oberen Antrieb angetrieben wird und die untere Arbeitswalze von einem vom oberen Antrieb verschiedenen unteren Antrieb angetrieben wird. In diesem Fall können die unterschiedlichen Umfangsgeschwindigkeiten einfach durch eine entsprechende Einstellung der beiden Antriebe auf unterschiedliche Drehzahlen realisiert werden.In order to be able to realize peripheral speeds that differ from one another, it is possible for the upper work roll to be driven by an upper drive and for the lower work roll to be driven by a lower drive that is different from the upper drive. In this case, the different peripheral speeds can easily be implemented by appropriately setting the two drives to different speeds.
Alternativ ist es möglich, dass die obere Arbeitswalze und die untere Arbeitswalze von einem gemeinsamen Antrieb angetrieben werden. In diesem Fall ist zwischen dem gemeinsamen Antrieb auf der einen Seite und der oberen Arbeitswalze und der unteren Arbeitswalze auf der anderen Seite ein Getriebe angeordnet, mittels dessen ein Verhältnis einer Drehzahl einer mit der oberen Arbeitswalze drehfest verbundenen oberen Ausgangswelle des Getriebes gegenüber einer Drehzahl einer mit der unteren Arbeitswalze drehfest verbundenen unteren Ausgangswelle des Getriebes stufenlos einstellbar ist.Alternatively, it is possible for the upper work roll and the lower work roll to be driven by a common drive. In this case, a gear is arranged between the common drive on the one hand and the upper work roll and the lower work roll on the other side, by means of which a ratio of a speed of an upper output shaft of the gear, which is non-rotatably connected to the upper work roll, to a speed of a the lower work roll non-rotatably connected lower output shaft of the transmission is continuously adjustable.
Alternativ oder zusätzlich zu einem Einstellen eines Verhältnisses der Umfangsgeschwindigkeiten zueinander ist es möglich, dass die Steuereinrichtung derart ausgebildet ist, dass der unter Berücksichtigung der Messgröße ermittelte Ansteuerwert eine Temperaturbeeinflussung der oberen Arbeitswalze und/oder der unteren Arbeitswalze des ersten Walzgerüsts und/oder des flachen Walzguts vor dem Walzen in dem ersten Walzgerüst ist. Beispielsweise kann durch Aufspritzen von Wasser eine Kühlung oder durch eine Induktionsheizung eine Erwärmung bewirkt werden.Alternatively or in addition to setting a ratio of the peripheral speeds to one another, it is possible for the control device to be designed in such a way that the control value determined taking into account the measured variable influences the temperature of the upper work roll and/or the lower work roll of the first roll stand and/or the flat rolling stock before rolling in the first rolling stand. For example, cooling can be effected by spraying on water, or heating can be effected by induction heating.
Sofern die Sensoreinrichtung vor dem ersten Walzgerüst angeordnet ist, ist die Steuereinrichtung vorzugsweise derart ausgebildet, dass sie den unter Berücksichtigung der Messgrö-βe ermittelten Ansteuerwert unter Berücksichtigung einer Wegverfolgung des flachen Walzguts von der Sensoreinrichtung zum ersten Walzgerüst an das erste Walzgerüst ausgibt. Die Steuereinrichtung berücksichtigt also beim Ansteuern des ersten Walzgerüsts die Transportzeit, die zwischen dem Erfassen der Messgröße für einen bestimmten Abschnitt des flachen Walzguts und dem Walzen desselben Abschnitts des flachen Walzguts im ersten Walzgerüst vergeht.If the sensor device is arranged in front of the first roll stand, the control device is preferably designed in such a way that it outputs the control value determined taking into account the measured variable, taking into account a path tracking of the flat rolling stock from the sensor device to the first roll stand to the first roll stand. When activating the first roll stand, the control device therefore takes into account the transport time that elapses between the detection of the measured variable for a specific section of the flat rolled stock and the rolling of the same section of the flat rolled stock in the first roll stand.
Vorzugsweise umfasst die Steuereinrichtung ein Modell, mittels dessen die Steuereinrichtung unter Berücksichtigung der Messgröße den Ansteuerwert für das erste Walzgerüst ermittelt und weiterhin unter Berücksichtigung des unter Berücksichtigung der Messgröße ermittelten Ansteuerwertes einen Erwartungswert für die Werkstoffeigenschaft des flachen Walzguts nach dem Walzen in dem ersten Walzgerüst ermittelt. Weiterhin ist vorzugsweise hinter dem ersten Walzgerüst eine weitere Sensoreinrichtung angeordnet, mittels derer mindestens eine für die Werkstoffeigenschaft des flachen Walzguts nach dem Walzen in dem ersten Walzgerüst charakteristische weitere Messgröße erfassbar ist. Die weitere Sensoreinrichtung ist zum Übermitteln der erfassten weiteren Messgröße mit der Steuereinrichtung verbunden. Schließlich ist die Steuereinrichtung vorzugsweise derart ausgebildet, dass sie die weitere Messgröße für einen Zeitpunkt verwertet, den die Steuereinrichtung unter Berücksichtigung einer Wegverfolgung des flachen Walzguts von dem ersten Walzgerüst zur weiteren Sensoreinrichtung ermittelt, und das Modell anhand eines Vergleichs der weiteren Messgröße und des Erwartungswertes der Werkstoffeigenschaft adaptiert. Durch diese Vorgehensweise kann das Modell nach und nach immer besser an das tatsächliche Verhalten des flachen Walzguts angepasst werden.The control device preferably includes a model, by means of which the control device determines the control value for the first roll stand, taking into account the measured variable, and also determines an expected value for the material property of the flat rolling stock after rolling in the first roll stand, taking into account the control value determined taking the measured variable into account. Furthermore, a further sensor device is preferably arranged behind the first roll stand, by means of which at least one further measured variable characteristic of the material property of the flat rolling stock after rolling in the first roll stand can be detected. The additional sensor device is connected to the control device in order to transmit the recorded additional measured variable. Finally, the control device is preferably designed such that it further Measured variable for a point in time that is determined by the control device, taking into account a path tracking of the flat rolling stock from the first roll stand to the further sensor device, and the model is adapted based on a comparison of the further measured variable and the expected value of the material property. With this procedure, the model can gradually be better adapted to the actual behavior of the flat rolling stock.
Vorzugsweise ist die Steuereinrichtung derart ausgebildet, dass sie bei der Ermittlung des Ansteuerwertes zusätzlich zu der übermittelten Messgröße die Temperatur des flachen Walzguts vor dem Walzen des flachen Walzguts in dem ersten Walzgerüst und/oder die Walzkraft beim Walzen des flachen Walzguts in dem ersten Walzgerüst und/oder die Stichabnahme beim Walzen des flachen Walzguts in dem ersten Walzgerüst berücksichtigt. Dadurch kann die gewünschte Werkstoffeigenschaft mit höherer Genauigkeit eingestellt werden. Die erforderlichen Abhängigkeiten können beispielsweise in Form von Kennlinienfeldern in der Steuereinrichtung hinterlegt sein.The control device is preferably designed in such a way that, when determining the control value, it also measures the temperature of the flat rolling stock prior to rolling of the flat rolling stock in the first rolling stand and/or the rolling force during rolling of the flat rolling stock in the first rolling stand and/or the measured variable that is transmitted. or the reduction in the rolling of the flat rolled stock in the first roll stand is taken into account. As a result, the desired material properties can be set with greater accuracy. The required dependencies can be stored in the control device, for example in the form of characteristic curve fields.
In einer bevorzugten Ausgestaltung umfasst die Sensoreinrichtung ein Anregungselement und ein erstes Sensorelement. Mittels des Anregungselements wird in dem flachen Walzgut ein Basissignal angeregt. Mittels des ersten Sensorelements wird ein auf dem angeregten Basissignal basierendes erstes Sensorsignal erfasst. Es ist möglich, dass die Sensoreinrichtung die übermittelte Messgröße unter Berücksichtigung des ersten Sensorsignals ermittelt. Alternativ ist es möglich, dass die übermittelte Messgröße das erste Sensorsignal umfasst.In a preferred embodiment, the sensor device includes an excitation element and a first sensor element. A base signal is excited in the flat rolling stock by means of the excitation element. A first sensor signal based on the excited base signal is detected by means of the first sensor element. It is possible for the sensor device to determine the transmitted measurement variable taking into account the first sensor signal. Alternatively, it is possible for the measured variable transmitted to include the first sensor signal.
In Einzelfällen kann es möglich sein, dass ausschließlich das erste Sensorsignal erfasst wird. In der Regel umfasst die Sensoreinrichtung jedoch zusätzlich eine Anzahl von zweiten Sensorelementen. In diesem Fall ist vom ersten Sensorelement aus in Transportrichtung gesehen das jeweilige zweite Sensorelement vor oder hinter dem ersten Sensorelement und/oder seitlich versetzt angeordnet. Mittels des jeweiligen zweiten Sensorelements wird ein jeweiliges auf dem angeregten Basissignal basierendes, zum ersten Sensorsignal gleichartiges zweites Sensorsignal erfasst. Es ist möglich, dass die Sensoreinrichtung die übermittelte Messgröße unter Berücksichtigung auch des jeweiligen zweiten Sensorsignals ermittelt. Beispielsweise können die Differenz oder der Quotient der entsprechenden Sensorsignale gebildet werden. Alternativ ist es möglich, dass die übermittelte Messgröße auch das jeweilige zweite Sensorsignal umfasst. In diesem Fall können gleichartige Auswertungen durch die Steuereinrichtung erfolgen.In individual cases it can be possible that only the first sensor signal is detected. As a rule, however, the sensor device also includes a number of second sensor elements. In this case, viewed from the first sensor element in the transport direction, the respective second sensor element is arranged in front of or behind the first sensor element and/or laterally offset. By means of the respective second Sensor element, a respective second sensor signal, which is based on the excited base signal and is similar to the first sensor signal, is detected. It is possible for the sensor device to determine the transmitted measured variable, also taking into account the respective second sensor signal. For example, the difference or the quotient of the corresponding sensor signals can be formed. Alternatively, it is possible that the transmitted measured variable also includes the respective second sensor signal. In this case, similar evaluations can be carried out by the control device.
Das Basissignal kann beispielsweise ein Wirbelstrom sein. Alternativ kann das Basissignal ein Schallsignal sein, insbesondere ein Ultraschallsignal.The base signal can be an eddy current, for example. Alternatively, the base signal can be a sound signal, in particular an ultrasonic signal.
Vorzugsweise verläuft eine Verbindungslinie vom Anregungselement zum ersten Sensorelement parallel zur Transportrichtung. Dadurch ergibt sich eine besonders zuverlässige Auswertung.A connecting line from the excitation element to the first sensor element preferably runs parallel to the transport direction. This results in a particularly reliable evaluation.
Die Werkstoffeigenschaft kann, wie bereits erwähnt, eine elektromagnetische Eigenschaft oder eine mechanische Eigenschaft des Walzguts sein.As already mentioned, the material property can be an electromagnetic property or a mechanical property of the rolling stock.
In Einzelfällen kann ein Warmwalzen erfolgen. In der Regel erfolgt jedoch ein Kaltwalzen. Damit ist das Walzwerk in der Regel ein Kaltwalzwerk.In individual cases, hot rolling can take place. As a rule, however, cold rolling takes place. The rolling mill is thus usually a cold rolling mill.
Die oben beschriebenen Eigenschaften, Merkmale und Vorteile dieser Erfindung sowie die Art und Weise, wie diese erreicht werden, werden klarer und deutlicher verständlich im Zusammenhang mit der folgenden Beschreibung der Ausführungsbeispiele, die in Verbindung mit den Zeichnungen näher erläutert werden. Hierbei zeigen in schematischer Darstellung:
- FIG 1
- ein Walzwerk mit einem ersten Walzgerüst,
- FIG 2
- eine Draufsicht auf einen Teil des Walzwerks von
FIG 1 , - FIG 3
und 4 - Seitenansichten von
FIG 3 zu zwei Zeitpunkten, - FIG 5
- ein Ablaufdiagramm,
- FIG 6
- eine Draufsicht auf einen Teil des Walzwerks von
FIG 1 , - FIG 7
und 8 - Seitenansichten von
FIG 6 zu zwei Zeitpunkten, - FIG 9
und 10 - jeweils ein weiteres Walzwerk mit einem ersten Walzgerüst,
- FIG 11
- ein Ablaufdiagramm,
- FIG 12
und 13 - Antriebsstrukturen für Arbeitswalzen,
- FIG 14
- ein Walzgerüst und Temperaturbeeinflussungen und
- FIG 15
bis 20 - verschiedene Ausgestaltungen von Walzstraßen.
- FIG 1
- a rolling mill with a first roll stand,
- FIG 2
- a plan view of part of the rolling mill of FIG
FIG 1 , - 3 and 4
- side views of
3 at two times, - 5
- a flowchart,
- 6
- a plan view of part of the rolling mill of FIG
FIG 1 , - 7 and 8
- side views of
6 at two times, - 9 and 10
- one further rolling mill each with a first roll stand,
- 11
- a flowchart,
- 12 and 13
- drive structures for work rolls,
- 14
- a roll stand and temperature influences and
- 15 to 20
- various configurations of rolling mills.
Gemäß
Das Walzen kann ein Warmwalzen sein. In diesem Fall ist das Walzwerk ein Warmwalzwerk. Im Regelfall handelt es sich jedoch um ein Kaltwalzen. In diesem Fall ist das Walzwerk ein Kaltwalzwerk.The rolling can be hot rolling. In this case, the rolling mill is a hot rolling mill. As a rule, however, it is cold rolling. In this case, the rolling mill is a cold rolling mill.
Von dem ersten Walzgerüst 1 sind in
Entsprechend der Darstellung in
Hinter dem ersten Walzgerüst 1 ist eine Sensoreinrichtung 6 angeordnet. Mittels der Sensoreinrichtung 6 kann eine Messgröße M erfasst werden. Die erfasste Messgröße M ist für eine Werkstoffeigenschaft des flachen Walzguts 2 charakteristisch. Beispiele derartiger Eigenschaften sind die elektrische Leitfähigkeit, die Permeabilitätszahl und die magnetische Sättigung bzw. allgemein eine elektromagnetische Eigenschaft des Walzguts 2. Weitere Beispiele von Werkstoffeigenschaften sind die Dehngrenze, die Streckgrenze, die Bruchdehnung bzw. allgemein eine mechanische Eigenschaft des Walzguts 2. Die genannten Größen können alternativ richtungsunabhängig (also isotrop) oder richtungsabhängig (also anisotrop) sein. Sie basieren alle auf der Kornstruktur und gegebenenfalls auch Ausrichtung der Körner des Metalls, aus dem das Walzgut 2 besteht.A
Nachstehend wird in Verbindung mit den
Gemäß den
Die Sensoreinrichtung 6 umfasst weiterhin ein erstes Sensorelement 8a. Mittels des ersten Sensorelements 8a wird ein erstes Sensorsignal Ia erfasst. Das Erfassen des ersten Sensorsignals Ia erfolgt nach dem Anregen des Basissignals, also zu einem anderen, späteren Zeitpunkt. Zu diesem späteren Zeitpunkt wird in der Regel kein Basissignal angeregt. Ein zuvor angeregtes Basissignal ist aber noch nicht vollständig abgeklungen. Das erste Sensorsignal Ia basiert auf dem angeregten Basissignal. Beispielsweise kann das erste Sensorelement 8a entsprechend der Darstellung in den
Das erste Sensorelement 8a ist in den
Die Sensoreinrichtung 6 ist gemäß
Oftmals umfasst die Sensoreinrichtung 6 zusätzlich zum ersten Sensorelement 8a eine Anzahl von zweiten Sensorelementen 8b bis 8d. Die zweiten Sensorelemente 8b bis 8d sind vom ersten Sensorelement 8a (und in der Regel auch vom Anregungselement 7) verschiedene Elemente. Vom Anregungselement 7 aus gesehen sind die zweiten Sensorelemente 8b bis 8d in der Regel hinter dem Anregungselement 7 angeordnet, auch wenn hiervon in Einzelfällen abgewichen werden kann. Mittels der zweiten Sensorelemente 8b bis 8d können zweite Sensorsignale Ib bis Id erfasst werden. Die zweiten Sensorsignale Ib bis Id basieren ebenfalls auf dem angeregten Basissignal IW und sind gleichartig zum ersten Sensorsignal Ia. Die zweiten Sensorsignale Ib bis Id werden in der Regel gleichzeitig mit dem ersten Sensorsignal Ia erfasst.In addition to the
Wenn zusätzlich auch die zweiten Sensorelemente 8b bis 8d vorhanden ist, kann die Sensoreinrichtung 6 als Messgröße M beispielsweise die Sensorsignale Ia bis Id insgesamt übermitteln, also sowohl das erste Sensorsignal Ia als auch die zweiten Sensorsignale Ib bis Id. Eine entsprechende Auswertung der Sensorsignale Ia bis Id erfolgt in diesem Fall durch die Steuereinrichtung 9. Alternativ kann eine Auswertung der Sensorsignale Ia bis Id (vollständig oder teilweise) bereits durch die Sensoreinrichtung 6 vorgenommen werden und als Messgröße M das Ergebnis dieser Auswertung übermittelt werden.If the
Bezüglich der Anordnung der zweiten Sensorelemente 8b bis 8d relativ zum ersten Sensorelement 8a sind verschiedene Anordnungen und Ausgestaltungen möglich.With regard to the arrangement of the
Beispielsweise kann die Sensoreinrichtung 6 ein zweites Sensorelement 8b, 8c aufweisen, das vom ersten Sensorelement 8a aus in Transportrichtung x gesehen seitlich versetzt angeordnet ist. In diesem Fall kann die Sensoreinrichtung 6 das erste Sensorsignal Ia in Relation zum zweiten Sensorsignal Ib, Ic setzen und dadurch die Messgröße M ermitteln. Die Messgrö-βe M kann in diesem Fall insbesondere anhand der Differenz oder des Quotienten der Sensorsignale Ia, Ib, Ic ermittelt werden. Wenn, wie in
Alternativ oder zusätzlich ist es möglich, dass die Sensoreinrichtung 6 ein zweites Sensorelement 8d aufweist, das vom ersten Sensorelement 8a aus in Transportrichtung x gesehen vor oder hinter dem ersten Sensorelement 8a angeordnet ist. Eine Anordnung hinter dem ersten Sensorelement 8a stellt in diesem Fall den Regelfall dar. Auch bei einer Anordnung des zweiten Sensorelements 8d vor oder hinter dem ersten Sensorelement 8a kann die Sensoreinrichtung 6 das erste Sensorsignal Ia in Relation zum zweiten Sensorsignal 8d setzen und dadurch die Messgröße M ermitteln. Die Messgröße M kann auch in diesem Fall insbesondere anhand der Differenz oder des Quotienten der Sensorsignale Ia, Id ermittelt werden.Alternatively or additionally, it is possible for the
Die Steuereinrichtung 9 nimmt gemäß
Die Steuereinrichtung 9 führt die Schritte S1 bis S3 iterativ immer wieder aus. Eine Zeitkonstante, mit der die Wiederholung erfolgt, liegt meist im Bereich zwischen 0,1 s und 1,0 s, insbesondere zwischen 0,2 s und 0,5 s.The
Die Steuereinrichtung 9 ist derart ausgebildet, dass sie die Vorgehensweise von
Obenstehend wurden in Verbindung mit den
Nachstehend wird in Verbindung mit den
Die weitere Sensoreinrichtung 13 ist ebenfalls mit der Steuereinrichtung 9 für das Walzwerk verbunden. Aufgrund der Verbindung der weiteren Sensoreinrichtung 13 mit der Steuereinrichtung 9 kann insbesondere eine Übermittlung der erfassten weiteren Messgröße M' an die Steuereinrichtung 9 erfolgen.The
Die Betriebsweise des Walzwerks von
Gemäß
In einem Schritt S13 ermittelt die Steuereinrichtung 9 unter Berücksichtigung dieses Ansteuerwertes A - also des im Schritt S12 ermittelten Ansteuerwertes A - einen Erwartungswert E für die Werkstoffeigenschaft des flachen Walzguts 2 nach dem Walzen in dem ersten Walzgerüst 1. Auch diese Ermittlung erfolgt mittels des Modells 12.In a step S13, the
In einem Schritt S14 wartet die Steuereinrichtung 9 eine erste Wartezeit t1 ab. Die erste Wartezeit t1 entspricht derjenigen Zeit, die ein bestimmter Abschnitt des flachen Walzguts 2 benötigt, um ausgehend von der Sensoreinrichtung 6 das erste Walzgerüst 1 zu erreichen. Im wesentlichen implementiert die Steuereinrichtung 9 somit eine Wegverfolgung des flachen Walzguts 2 von der Sensoreinrichtung 6 zum ersten Walzgerüst 1. Im einfachsten Fall entspricht die erste Wartezeit t1 - siehe
In einem Schritt S15 und damit nach Ablauf der ersten Wartezeit t1 steuert die Steuereinrichtung 9 das erste Walzgerüst 1 entsprechend dem ermittelten Ansteuerwert A an. Der Schritt S15 korrespondiert im wesentlichen mit dem Schritt S3 von
In einem Schritt S16 wartet die Steuereinrichtung 9 sodann eine zweite Wartezeit t2 ab. Die zweite Wartezeit t2 entspricht derjenigen Zeit, die ein bestimmter Abschnitt des flachen Walzguts 2 benötigt, um ausgehend von dem ersten Walzgerüst 1 die weitere Sensoreinrichtung 13 zu erreichen. Im wesentlichen implementiert die Steuereinrichtung 9 somit eine Wegverfolgung des flachen Walzguts 2 von dem ersten Walzgerüst 1 zur weiteren Sensoreinrichtung 13. Im einfachsten Fall t1 - siehe wieder
In einem Schritt S17 und damit nach Ablauf der zweiten Wartezeit t2 nimmt die Steuereinrichtung 9 von der weiteren Sensoreinrichtung 13 diejenige weitere Messgröße M' entgegen, die von der weiteren Sensoreinrichtung 13 zu diesem Zeitpunkt erfasst wird. In einem Schritt S18 führt die Steuereinrichtung 9 den Modellparameter k anhand eines Vergleichs der weiteren Messgröße M' und des Erwartungswertes E der Werkstoffeigenschaft E nach und adaptiert dadurch das Modell 12. Im Ergebnis verwertet die Steuereinrichtung 9 somit im Rahmen der Adaptierung des Modells 12 die weitere Messgröße M' für einen Zeitpunkt, den die Steuereinrichtung 9 unter Berücksichtigung der Wegverfolgung des flachen Walzguts 2 von dem ersten Walzgerüst 1 zur weiteren Sensoreinrichtung 13 ermittelt hat.In a step S17 and thus after the second waiting time t2 has elapsed, the
Die Steuereinrichtung 9 führt die Schritte S11 bis S18 - analog zu den Schritten S1 bis S3 - iterativ immer wieder aus. Die obigen Ausführungen zu den Schritten S1 bis S3 sind analog anwendbar.The
Weiterhin sind die Schritte S11 bis S18 und deren Abfolge in der Praxis geringfügig anders implementiert. Beispielsweise können die Schritte S11 bis S18 mehrfach instanziiert ausgeführt werden. Auch ist es möglich, die Abfolge der Schritte S11 bis S18 in zwei Teile aufzuteilen, die parallel ausgeführt werden. Der erste Teil umfasst in diesem Fall die Schritte S11 bis S15, der zweite Teil die Schritte S16 bis S18.Furthermore, steps S11 to S18 and their sequence are implemented slightly differently in practice. For example, steps S11 to S18 can be instantiated multiple times. It is also possible to divide the sequence of steps S11 to S18 into two parts, which are executed in parallel. In this case, the first part comprises steps S11 to S15, and the second part comprises steps S16 to S18.
Auch ist es möglich, die Schritte S14 und S16 als solche entfallen zu lassen. In diesem Fall kann eine direkte, unsynchronisierte Ausführung der verbleibenden Schritte S11 bis S13, S15, S17 und S18 erfolgen. In diesem Fall können beispielsweise der im Schritt S12 ermittelte jeweilige Ansteuerwert A und der im Schritt S13 ermittelte jeweilige Erwartungswert E in einem Zwischenspeicher (nicht dargestellt) temporär gepuffert werden. Gegebenenfalls kann auch die im Schritt S17 erfasste jeweilige weitere Messgröße M' in dem Zwischenspeicher temporär gepuffert werden. Dem jeweiligen Ansteuerwert A wird in diesem Fall bei der Speicherung ein Ausführungszeitpunkt zugeordnet. In analoger Weise wird in diesem Fall dem jeweiligen Erwartungswert E ein Verwertungszeitpunkt zugeordnet. Gegebenenfalls kann weiterhin auch der jeweiligen weiteren Messgröße M' ein Erfassungszeitpunkt zugeordnet werden. In diesem Fall wird bei der jeweiligen Ausführung des Schrittes S15 derjenige gespeicherte Ansteuerwert A ausgegeben, dessen Ausführungszeitpunkt gerade erreicht ist. In analoger Weise wird bei der jeweiligen Ausführung des Schrittes S18 derjenige gespeicherte Erwartungswert E verwertet, dessen Verwertungszeitpunkt mit der aktuellen Zeit übereinstimmt. Soweit erforderlich, kann in diesem Zusammenhang eine Interpolation von gespeicherten Ansteuerwerten A und von gespeicherten Erwartungswerten E erfolgen. Falls auch die weiteren Messgrößen M' und deren Erfassungszeitpunkte gespeichert werden, gilt dies in analoger Weise auch für die weiteren Messgrößen M'.It is also possible to omit steps S14 and S16 as such. In this case, a direct, unsynchronized execution of the remaining steps S11 to S13, S15, S17 and S18 can take place. In this case, for example, the respective control value A determined in step S12 and the respective expected value E determined in step S13 can be temporarily buffered in a buffer (not shown). If necessary, the respective further measurement variable M′ recorded in step S17 can also be temporarily buffered in the intermediate memory. In this case, the respective control value A is assigned an execution time when it is stored. In this case, a realization time is assigned to the respective expected value E in an analogous manner. If necessary, a detection time can also be assigned to the respective further measured variable M′ will. In this case, when step S15 is executed, that stored control value A whose execution time has just been reached is output. In an analogous manner, when step S18 is executed, that stored expected value E is used whose time of use coincides with the current time. If necessary, stored control values A and stored expected values E can be interpolated in this context. If the further measured variables M' and their acquisition times are also stored, this also applies in an analogous manner to the further measured variables M'.
Unabhängig von der konkreten Implementierung kommt es aber darauf an, dass die Adaptierung des Modells 12 des Schrittes S18 auf alle zeitlich nachfolgenden Ausführungen der Schritte S12 und S13 wirkt.Irrespective of the specific implementation, however, it is important that the adaptation of the
Die Art des Ansteuerwertes A kann nach Bedarf bestimmt sein. Entscheidend ist, dass das Ansteuern des ersten Walzgerüsts 1 mit dem Ansteuerwert A die Werkstoffeigenschaft des flachen Walzguts 2 beeinflusst. Beispielsweise ist es entsprechend der Darstellung in den
In der Regel liegt das Verhältnis der oberen Umfangsgeschwindigkeit vO zur unteren Umfangsgeschwindigkeit vU zwischen 0,5 und 2,0, insbesondere zwischen 0,9 und 1,1. Weiterhin ist in der Regel irrelevant, welche der beiden Arbeitswalzen 3, 4 schneller als die andere Arbeitswalze 4, 3 rotiert.As a rule, the ratio of the upper peripheral speed vO to the lower peripheral speed vU is between 0.5 and 2.0, in particular between 0.9 and 1.1. Furthermore, in generally irrelevant which of the two work rolls 3, 4 rotates faster than the
Im Gegensatz hierzu werden die obere Arbeitswalze 3 und die untere Arbeitswalze 4 in der Ausgestaltung von
Das Getriebe 17 ist derart ausgestaltet, dass mittels des Getriebes 17 ein Verhältnis einer Drehzahl der oberen Ausgangswelle 19 gegenüber einer Drehzahl der unteren Ausgangswelle 20 stufenlos einstellbar ist. Beispielsweise kann das Getriebe 17 einerseits einen Aufteilungsblock 21 aufweisen, in dem eine Aufteilung des Antriebsstrangs auf die obere und die untere Arbeitswalze 3, 4 erfolgt. Zwischen dem Aufteilungsblock 21 und der oberen Arbeitswalze 3 kann sodann ein Zwischengetriebe 22 angeordnet sein, mittels dessen ein stufenloses Variieren der ausgangsseitigen Drehzahl relativ zur eingangsseitigen Drehzahl des Zwischengetriebes 22 möglich ist. Derartige Zwischengetriebe 22 sind Fachleuten allgemein bekannt. Beispiele sind ein Planetengetriebe und ein Differenzialgetriebe. Alternativ oder zusätzlich zu einer Anordnung zwischen dem Aufteilungsblock 21 und der oberen Arbeitswalze 3 kann auch zwischen dem Aufteilungsblock 21 und der unteren Arbeitswalze 4 ein Zwischengetriebe (nicht dargestellt) angeordnet sein.The
Vorstehend wurden in Verbindung mit den
So ist es beispielsweise entsprechend der Darstellung in den
Die Ausgestaltungen der
Konkret ist bei den Ausgestaltungen der
Bei den Ausgestaltungen der
Bei den Ausgestaltungen der
Die Ausgestaltungen der
Unabhängig davon welche Ausgestaltung konkret ergriffen wird, ist die Betriebsweise des jeweiligen Walzwerks der
Die vorliegende Erfindung weist viele Vorteile auf. Insbesondere ist eine einfache Integration der erfindungsgemäßen Vorgehensweise in den laufenden Betrieb des Walzwerks möglich. Bei Elektroblechen und auch bei anderen Stahlsorten ist eine Glühbehandlung nach dem Kaltwalzen oder zwischen zwei Kaltwalzschritten oftmals nicht mehr erforderlich oder nur noch in eingeschränktem Umfang erforderlich. Bei AHSS und bei martensitischen und bainitischen Güten kann die Zeiligkeit von Werkstoffeigenschaften, die ihre Ursache in der Kühlung in der Kühlstrecke der Warmwalzstraße hat, verringert oder beseitigt werden. Sofern die Einwirkung auf das flache Walzgut 2 mittels des Ansteuerwertes A in Breitenrichtung des flachen Walzguts 2 ortsaufgelöst erfolgen kann (dies ist insbesondere bei einer thermischen Beeinflussung der Fall), können unter Umständen auch mehrere Sensoreinrichtungen 6 nebeneinander angeordnet sein.The present invention has many advantages. In particular, a simple integration of the procedure according to the invention into the ongoing operation of the rolling mill is possible. In the case of electrical sheets and also other types of steel, an annealing treatment after cold rolling or between two cold rolling steps is often no longer necessary or only necessary to a limited extent. In the case of AHSS and martensitic and bainitic grades, the discontinuity of material properties caused by cooling in the cooling section of the hot rolling mill can be reduced or eliminated. If the action on the
Obwohl die Erfindung im Detail durch das bevorzugte Ausführungsbeispiel näher illustriert und beschrieben wurde, so ist die Erfindung nicht durch die offenbarten Beispiele eingeschränkt und andere Varianten können vom Fachmann hieraus abgeleitet werden, ohne den durch die Ansprüche definierten Schutzumfang der Erfindung zu verlassen.Although the invention has been illustrated and described in detail by the preferred embodiment, the invention is not limited by the disclosed examples and other variants can be derived therefrom by a person skilled in the art without departing from the protective scope of the invention as defined by the claims.
- 1, 241, 24
- Walzgerüsteroll stands
- 22
- flaches Walzgutflat rolling stock
- 33
- obere Arbeitswalzeupper stripper
- 44
- untere Arbeitswalzelower stripper
- 55
- Haspelreel
- 6, 136, 13
- Sensoreinrichtungensensor devices
- 77
- Anregungselementexcitation element
- 8a bis 8d8a to 8d
- Sensorelementesensor elements
- 99
- Steuereinrichtungcontrol device
- 1010
- Steuerprogrammcontrol program
- 1111
- Programmcodeprogram code
- 1212
- Modellmodel
- 14 bis 1614 to 16
- Antriebedrives
- 1717
- Getriebetransmission
- 1818
- Eingangswelleinput shaft
- 19, 2019, 20
- Ausgangswellenoutput shafts
- 2121
- Aufteilungsblocksplit block
- 2222
- Zwischengetriebeintermediate gear
- 23, 23', 23"23, 23', 23"
- Beeinflussungseinrichtungeninfluencing devices
- AA
- Ansteuerwertcontrol value
- a1, a2a1, a2
- Abständedistances
- d1, d2d1, d2
- Dickenthick
- EE
- Erwartungswertexpected value
- Ff
- Walzkraftrolling force
- IA, IWIA, IW
- Strömestreams
- Ia bis IdIa to Id
- Sensorsignalesensor signals
- kk
- Modellparametermodel parameters
- M, M'M, M'
- Messgrößenmetrics
- S1 bis S18S1 to S18
- Schrittesteps
- t1, t2t1, t2
- Wartezeitenwaiting times
- TT
- Temperaturtemperature
- v, v1, v2v, v1, v2
- Transportgeschwindigkeitentransport speeds
- vO, vUvO, vU
- Umfangsgeschwindigkeitenperipheral speeds
- vO*, vU*vO*, vU*
- Sollwertesetpoints
- xx
- Transportrichtungtransport direction
Claims (16)
- Rolling mill having a first rolling stand (1) for rolling a flat rolled product (2) composed of metal,- wherein a sensor device (6), by means of which at least one measured variable (M) characteristic of a material property of the flat rolled product (2) can be detected, is arranged upstream and/or downstream of the first rolling stand (1),- wherein the sensor device (6) is connected to a control device (9) for the rolling mill in order to transfer the detected measured variable (M),- wherein the control device (9) is designed in such a way that it takes account of the transferred measured variable (M) in the context of determining a control value (A) for the first rolling stand (1),- wherein the control of the first rolling stand (1) with the control value (A) influences the material property of the flat rolled product (2),- wherein the first rolling stand (1) has an upper working roll (3) and a lower working roll (4),characterized
in that the control device (9) is designed in such a way that the control value (A) determined taking into account the measured variable (M) is a ratio of an upper peripheral speed (vO) at which the upper working roll (3) rotates to a lower peripheral speed (vU) at which the lower working roll (4) rotates. - Rolling mill according to Claim 1,
characterized
in that the rolling mill has at least one second rolling stand (24) and in that the second rolling stands (24) are not arranged between the sensor device (6) and the first rolling stand (1). - Rolling mill according to Claim 1,
characterized
in that the rolling mill has at least one second rolling stand (24) and in that at least one of the second rolling stands (24) is arranged between the sensor device (6) and the first rolling stand (1). - Rolling mill according to Claim 1,
characterized
in that the control device (9) is designed in such a way that it determines the ratio of the upper peripheral speed (vO) to the lower peripheral speed (vU) in such a way that it is between 0.5 and 2.0, in particular between 0.9 and 1.1. - Rolling mill according to Claim 1 or 4,
characterized
in that the upper working roll (3) is driven by an upper drive (14) and the lower working roll (4) is driven by a lower drive (15), which is different from the upper drive (14). - Rolling mill according to Claim 1 or 4,
characterized
in that the upper working roll (3) and the lower working roll (4) are driven by a common drive (16) and in that a transmission (17), by means of which a ratio of a speed of an upper output shaft (19) of the transmission (17), said shaft being connected for conjoint rotation to the upper working roll (3), to a speed of a lower output shaft (20) of the transmission (17), said shaft being connected for conjoint rotation to the lower working roll (4), can be continuously adjusted, is arranged between the common drive (16) on one side and the upper working roll (3) and the lower working roll (4) on the other side. - Rolling mill according to any of the above claims,
characterized
in that the first rolling stand (1) has an upper working roll (3) and a lower working roll (4) and in that the control device (9) is designed in such a way that the control value (A) determined taking into account the measured variable (M) is a temperature modification of the upper working roll (3) and/or of the lower working roll (4) of the first rolling stand (1) and/or of the flat rolled product (2) before rolling in the first rolling stand (1). - Rolling mill according to any of the above claims,
characterized
in that the sensor device (6) is arranged upstream of the first rolling stand (1) and in that the control device (9) is designed in such a way that it outputs to the first rolling stand (1) the control value (A), determined taking into account the measured variable (M), taking into account tracking of the flat rolled product (2) from the sensor device (6) to the first rolling stand (1). - Rolling mill according to Claim 8,
characterized- in that the control device (9) comprises a model (12), by means of which the control device (9) determines the control value (A) for the first rolling stand (1) taking into account the measured variable (M), and, taking into account the control value (A) determined taking into account the measured variable (M), furthermore determines an expected value (E) for the material property of the flat rolled product (2) after rolling in the first rolling stand (1),- in that a further sensor device (13), by means of which at least one further measured variable (M') characteristic of the material property of the flat rolled product (2) after rolling in the first rolling stand (1) can be detected, is arranged downstream of the first rolling stand (1),- in that the further sensor device (13) is connected to the control device (9) to transfer the detected further measured variable (M'),- in that the control device (9) is designed in such a way that it uses the further measured variable (M') for a point in time which the control device (9) determines taking into account tracking of the flat rolled product (2) from the first rolling stand (1) to the further sensor device (13), and- in that the control device (9) is designed in such a way that it adapts the model (12) on the basis of a comparison of the further measured variable (M') and the expected value (E) of the material property. - Rolling mill according to any of the above claims,
characterized
in that the control device (9) is designed in such a way that, in determining the control value (A), it takes into account the temperature (T) of the flat rolled product (2) before the rolling of the flat rolled product (2) in the first rolling stand (1) and/or the rolling force (F) during the rolling of the flat rolled product (2) in the first rolling stand (1) and/or the pass reduction during the rolling of the flat rolled product (2) in the first rolling stand (1) in addition to the transferred measured variable (M). - Rolling mill according to any of the above claims,
characterized- in that the sensor device (9) comprises an excitation element (7) and a first sensor element (8a),- in that a base signal is excited in the flat rolled product (2) by means of the excitation element (7),- in that a first sensor signal (Ia) based on the excited base signal is detected by means of the first sensor element (8a), and- in that the sensor device (6) determines the transferred measured variable (M) taking into account the first sensor signal (Ia) or in that the transferred measured variable (M) comprises the first sensor signal (Ia). - Rolling mill according to Claim 11,
characterized- in that the sensor device (6) additionally comprises a number of second sensor elements (8b to 8d),- in that when viewed in the transport direction (x) from the first sensor element (8a), the respective second sensor element (8b to 8d) is arranged upstream or downstream of the first sensor element (8a) and/or laterally offset,- in that a respective second sensor signal (Ib to Id) based on the excited base signal and of the same kind as the first sensor signal (Ia) is detected by means of the respective second sensor element (8b to 8d), and- in that the sensor device (6) determines the transferred measured variable (M) while also taking into account the respective second sensor signal (Ib to Id) or in that the transferred measured variable (M) also comprises the respective second sensor signal (Ib to Id). - Rolling mill according to Claim 11 or 12,
characterized
in that the base signal is an eddy current (IW) or a sound signal, in particular an ultrasound signal. - Rolling mill according to Claim 11, 12 or 13,
characterized
in that a connecting line from the excitation element (7) to the first sensor element (8a) runs parallel to the transport direction (x). - Rolling mill according to any of the above claims,
characterized
in that the material property is an electromagnetic property or a mechanical property of the rolled product (2). - Rolling mill according to any of the above claims,
characterized
in that the rolling mill is a cold rolling mill.
Priority Applications (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP20154128.1A EP3858503B1 (en) | 2020-01-28 | 2020-01-28 | Rolling mill with material property dependent rolling |
RU2020139282A RU2767125C1 (en) | 2020-01-28 | 2020-12-01 | Rolling mill for rolling properties depending on rolling properties |
US17/149,799 US11458518B2 (en) | 2020-01-28 | 2021-01-15 | Rolling mill with rolling dependent on material properties |
JP2021010971A JP2021115630A (en) | 2020-01-28 | 2021-01-27 | Rolling mill with material property dependent rolling |
CN202110118355.0A CN113245368A (en) | 2020-01-28 | 2021-01-28 | Rolling mill with material property-dependent rolling |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP20154128.1A EP3858503B1 (en) | 2020-01-28 | 2020-01-28 | Rolling mill with material property dependent rolling |
Publications (2)
Publication Number | Publication Date |
---|---|
EP3858503A1 EP3858503A1 (en) | 2021-08-04 |
EP3858503B1 true EP3858503B1 (en) | 2023-01-25 |
Family
ID=69374245
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
EP20154128.1A Active EP3858503B1 (en) | 2020-01-28 | 2020-01-28 | Rolling mill with material property dependent rolling |
Country Status (5)
Country | Link |
---|---|
US (1) | US11458518B2 (en) |
EP (1) | EP3858503B1 (en) |
JP (1) | JP2021115630A (en) |
CN (1) | CN113245368A (en) |
RU (1) | RU2767125C1 (en) |
Family Cites Families (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3394587A (en) * | 1966-03-09 | 1968-07-30 | Du Pont | Web tension indicator |
GB1250925A (en) * | 1968-07-03 | 1971-10-27 | ||
AT329902B (en) * | 1973-05-23 | 1976-06-10 | Voest Ag | METHOD FOR DETERMINING TENSION DISTRIBUTION OVER THE WIDTH OF A COLD-ROLLED STRIP AND DEVICE FOR CARRYING OUT THE METHOD |
JPS605373B2 (en) * | 1977-05-27 | 1985-02-09 | 石川島播磨重工業株式会社 | rolling mill |
SU961809A1 (en) * | 1979-03-22 | 1982-09-30 | Новосибирское Отделение Государственного Проектного Института "Электропроект" | Apparatus for automatic searching and maintaining of strip rolling process apparatus for automatic searching and maintaining of strip rolling process |
SU969343A1 (en) * | 1981-04-14 | 1982-10-30 | Институт Черной Металлургии Мчм Ссср | Device for controlling pressure in rolling butt-welded strips |
JPS609509A (en) * | 1983-06-29 | 1985-01-18 | Hitachi Ltd | Control method of rolling mill |
DE19806267A1 (en) * | 1997-11-10 | 1999-05-20 | Siemens Ag | Method and device for controlling a metallurgical plant |
JP2000288614A (en) * | 1999-04-09 | 2000-10-17 | Toshiba Corp | Gage controller for rolling mill |
ITMI20060666A1 (en) * | 2006-04-05 | 2007-10-06 | Danieli Off Mecc | LAMINATION PLANT |
WO2008015747A1 (en) * | 2006-08-03 | 2008-02-07 | Toshiba Mitsubishi-Electric Industrial Systems Corporation | Rolling roll motor driver |
KR101084314B1 (en) | 2010-03-18 | 2011-11-16 | 강릉원주대학교산학협력단 | Asymmetric rolling apparatus, asymmetric rolling method and rolled materials fabricated by using the same |
US9216445B2 (en) * | 2011-08-03 | 2015-12-22 | Ut-Battelle, Llc | Method of forming magnesium alloy sheets |
CA3016699C (en) * | 2016-03-08 | 2022-07-12 | Novelis Inc. | Method and apparatus for controlling metal strip profile during rolling with direct measurement of process parameters |
DE102016222644A1 (en) | 2016-03-14 | 2017-09-28 | Sms Group Gmbh | Process for rolling and / or heat treating a metallic product |
DE102017208576A1 (en) * | 2016-05-25 | 2017-11-30 | Sms Group Gmbh | Apparatus and method for determining a microstructure of a metal product and metallurgical plant |
EP3318342A1 (en) * | 2016-11-07 | 2018-05-09 | Primetals Technologies Austria GmbH | Method for operating a casting roller composite system |
CN108906887A (en) * | 2018-06-14 | 2018-11-30 | 沈阳大学 | A kind of preparation method of electric machine iron core orientation free silicon steel plate |
-
2020
- 2020-01-28 EP EP20154128.1A patent/EP3858503B1/en active Active
- 2020-12-01 RU RU2020139282A patent/RU2767125C1/en active
-
2021
- 2021-01-15 US US17/149,799 patent/US11458518B2/en active Active
- 2021-01-27 JP JP2021010971A patent/JP2021115630A/en active Pending
- 2021-01-28 CN CN202110118355.0A patent/CN113245368A/en active Pending
Also Published As
Publication number | Publication date |
---|---|
EP3858503A1 (en) | 2021-08-04 |
JP2021115630A (en) | 2021-08-10 |
CN113245368A (en) | 2021-08-13 |
RU2767125C1 (en) | 2022-03-16 |
US20210229149A1 (en) | 2021-07-29 |
US11458518B2 (en) | 2022-10-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP2566633B1 (en) | Operating method for a production line with prediction of the command speed | |
EP3202502A1 (en) | Strip position control | |
EP2548665B1 (en) | Method for determining the wear on a roller dependent on relative movement | |
EP2712332B1 (en) | Method for controlling a hot strip rolling line | |
DE102006047718A1 (en) | Method for tracking the physical condition of a hot plate or hot strip as part of the control of a plate rolling mill for processing a hot plate or hot strip | |
EP2603333B1 (en) | Real-time determination method for temperature and geometry of a hot metal strip in a finishing train | |
WO2009016086A1 (en) | Method for adjusting a state of a rolling stock, particularly a near-net strip | |
DE112004002903B4 (en) | Roll wedge setting / control method for rolling plate-shaped material | |
EP2162245B1 (en) | Rolling of a strip in a rolling train using the last stand of the rolling train as a tension reducer | |
WO2015124363A1 (en) | Simple pre-control of a wedge-type roll-gap adjustment of a roughing stand | |
EP2790846B1 (en) | Method for processing milled goods in a hot rolling mill | |
EP1955787B1 (en) | Method and device for stretching metal strips by traction | |
EP3215643B1 (en) | Method for controlling a metallurgical plant in an open-loop and/or closed-loop manner | |
EP2741870B1 (en) | Rolling system and rolling method | |
EP3858503B1 (en) | Rolling mill with material property dependent rolling | |
EP2121209B1 (en) | Method for assisting at least partially manual control of a metal processing line | |
EP3194087B1 (en) | Width adjustment in a finishing train | |
EP2662158A1 (en) | Method for processing milled goods and milling system | |
EP3714999B1 (en) | Determination of the adjustment of a roll stand | |
DE102014215396A1 (en) | Differential tension control with optimized controller design | |
EP3632583A1 (en) | Decoupled adjustment of contour and flatness of a metal strip | |
WO2014009093A1 (en) | Method for working rolled stock in a rolling train | |
EP3974073B1 (en) | Rolling taking into account frequency behaviour | |
EP4119247A1 (en) | Incorporation of state-dependent density when solving a heat conduction equation | |
AT522073B1 (en) | Hot rolling with flexible roll stand configuration |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION HAS BEEN PUBLISHED |
|
AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
17P | Request for examination filed |
Effective date: 20220204 |
|
RBV | Designated contracting states (corrected) |
Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
GRAP | Despatch of communication of intention to grant a patent |
Free format text: ORIGINAL CODE: EPIDOSNIGR1 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: GRANT OF PATENT IS INTENDED |
|
INTG | Intention to grant announced |
Effective date: 20220926 |
|
GRAS | Grant fee paid |
Free format text: ORIGINAL CODE: EPIDOSNIGR3 |
|
GRAA | (expected) grant |
Free format text: ORIGINAL CODE: 0009210 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE PATENT HAS BEEN GRANTED |
|
AK | Designated contracting states |
Kind code of ref document: B1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
REG | Reference to a national code |
Ref country code: GB Ref legal event code: FG4D Free format text: NOT ENGLISH |
|
REG | Reference to a national code |
Ref country code: CH Ref legal event code: EP |
|
REG | Reference to a national code |
Ref country code: AT Ref legal event code: REF Ref document number: 1545580 Country of ref document: AT Kind code of ref document: T Effective date: 20230215 Ref country code: IE Ref legal event code: FG4D Free format text: LANGUAGE OF EP DOCUMENT: GERMAN |
|
REG | Reference to a national code |
Ref country code: DE Ref legal event code: R096 Ref document number: 502020002418 Country of ref document: DE |
|
REG | Reference to a national code |
Ref country code: SE Ref legal event code: TRGR |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: FR Payment date: 20230320 Year of fee payment: 4 |
|
REG | Reference to a national code |
Ref country code: LT Ref legal event code: MG9D |
|
PGFP | Annual fee paid to national office [announced via postgrant information from national office to epo] |
Ref country code: SE Payment date: 20230308 Year of fee payment: 4 Ref country code: IT Payment date: 20230131 Year of fee payment: 4 Ref country code: DE Payment date: 20230216 Year of fee payment: 4 Ref country code: BE Payment date: 20230216 Year of fee payment: 4 |
|
REG | Reference to a national code |
Ref country code: NL Ref legal event code: MP Effective date: 20230125 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: NL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: RS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: PT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230525 Ref country code: NO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230425 Ref country code: LV Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: LT Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: HR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: ES Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: PL Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: IS Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230525 Ref country code: GR Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230426 Ref country code: FI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 |
|
REG | Reference to a national code |
Ref country code: CH Ref legal event code: PL |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: LU Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20230128 |
|
REG | Reference to a national code |
Ref country code: DE Ref legal event code: R097 Ref document number: 502020002418 Country of ref document: DE |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SM Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: RO Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: MC Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: LI Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20230131 Ref country code: EE Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: DK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: CZ Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: CH Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20230131 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SK Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 |
|
PLBE | No opposition filed within time limit |
Free format text: ORIGINAL CODE: 0009261 |
|
STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: NO OPPOSITION FILED WITHIN TIME LIMIT |
|
26N | No opposition filed |
Effective date: 20231026 |
|
PG25 | Lapsed in a contracting state [announced via postgrant information from national office to epo] |
Ref country code: SI Free format text: LAPSE BECAUSE OF FAILURE TO SUBMIT A TRANSLATION OF THE DESCRIPTION OR TO PAY THE FEE WITHIN THE PRESCRIBED TIME-LIMIT Effective date: 20230125 Ref country code: IE Free format text: LAPSE BECAUSE OF NON-PAYMENT OF DUE FEES Effective date: 20230128 |