EP3615073A1 - Biologische bindemoleküle - Google Patents
Biologische bindemoleküleInfo
- Publication number
- EP3615073A1 EP3615073A1 EP18746104.1A EP18746104A EP3615073A1 EP 3615073 A1 EP3615073 A1 EP 3615073A1 EP 18746104 A EP18746104 A EP 18746104A EP 3615073 A1 EP3615073 A1 EP 3615073A1
- Authority
- EP
- European Patent Office
- Prior art keywords
- binding molecule
- cell
- subset
- cells
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39566—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against immunoglobulins, e.g. anti-idiotypic antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
Definitions
- the present invention relates to the field of production, identification and selection of antibodies or fragments thereof, as well as their use in the context of the prophylaxis and therapy of cancers, in particular malignant B-cell neoplasms.
- Malignant B-cell neoplasms are commonly referred to as malignant diseases of the hematopoietic or lymphatic system. They include diseases such as leukemia and count in a broader sense to the cancers.
- Leukemias are characterized by a greatly increased formation of dysfunctional precursor cells of the white blood cells, which are also called leukemia cells. These cells spread in the bone marrow, displace there the usual blood formation and accumulate usually also greatly increased in the peripheral blood. They can infiltrate the liver, spleen, lymph nodes and other organs, thereby impairing their function.
- the disruption of blood formation results in a decrease in normal blood components, which may cause anemia due to lack of oxygen-carrying red blood cells, lack of hemostatic platelets, and a lack of mature, functional white blood cells.
- Acute leukemias are life-threatening diseases that, if left untreated, can lead to death within a few weeks to months.
- Chronic leukemias usually run over several years and are often symptom poor in the initial stage.
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- leukemias are treated as part of chemotherapy.
- Newer forms of therapy are increasingly relying on the use of monoclonal antibodies such.
- GA101 bisnutuzumab
- rituximab and ofatumumab acts as a CD20 antibody and is used to treat chronic lymphocytic leukemia (CLL).
- CLL chronic lymphocytic leukemia
- Other malignant diseases of the hematopoietic or lymphatic system malignant B-cell neoplasms
- lymphomas such as lymphoma.
- Hodgkin's lymphoma and B-cell variants of non-Hodgkin's lymphoma are malignant diseases of the hematopoietic or lymphatic system.
- antibodies to receptors When antibodies to receptors are generated, animals are usually immunized with the receptor (purified, cloned, or as peptide fragments) and hybridomas are generated. These hybridoma cells produce antibodies which are then tested by ELISA or by expressed receptors in cell systems. For this purpose, conventionally established cell lines are used, since only these can be easily cultivated. Antibodies can be generated which bind relatively specifically to a particular receptor type (e.g., anti-IgGl, anti-IgE). However, this often leads to cross-reactions with other receptors or other epitopes.
- a particular receptor type e.g., anti-IgGl, anti-IgE
- BCR antibodies For a therapeutic application of BCR antibodies, it is usually not sufficient to use only one antibody against the BCR in general, since such a broadband use can trigger significant side effects. Rather, it would be desirable to provide an antibody that selectively binds to a receptor that has (pathophysiological) activation, particularly autonomous activation. Such an antibody is not known in the art and a Process for its preparation or production by selection does not exist.
- the object of the present invention is therefore to provide alternative concepts and active ingredients such as, in particular, alternative antibodies for prophylactic and / or therapeutic use, with which the existing problems of the prior art are overcome.
- neoplasia generally refers to a regeneration of body tissue, which is a malignant or malignant manifestation of malignant neoplasia, malignant B-cell neoplasia thus being a malignant and uncontrolled neoplasm of B-cells, although this term applies equally to all B-cell associated cancers such as leukemias and B-cell lymphomas
- a "neoplasia-killing area" can kill neoplasias either as a direct or indirect effect.
- more specific Antibody binds a molecule to the antibody or to a functional fragment of this antibody or other biological binding molecule comprising that antibody or its fragment so as to exert an effect beyond the effect of the binding of the antibody or its fragment.
- a molecule may be selected from the group consisting of an immunotoxin, a cytokine, a chelator, a radioisotope, and combinations thereof.
- biological binding molecules herein are meant, for example, but not limited to, antibodies including fusion proteins
- an antibody is selected from the group consisting of an IgG antibody, an IgM antibody, a humanized IgG antibody, and a human
- Such a binding molecule may also be provided in the form of a functional fragment of the entire antibody, eg as a Fab fragment
- a binding molecule may also comprise other regions, eg for the purpose of killing / killing neoplasms
- such a binding molecule may also be membrane- or cell-like
- One such membrane-bound form of a binding molecule is, for example, the chimeric antigen receptor (CAR) on CAR-T Cells.
- CAR chimeric antigen receptor
- B-cell receptor or B-cell receptor complex The role of the B-cell receptor or B-cell receptor complex (BCR) on the surface of a B-cell is to recognize and bind pathogens, so it can be regarded as a membrane-bound antibody. This binding leads to a conformational change of the BCR, which triggers a signal cascade which ultimately leads to activation of the BCR. Cell leads.
- the BCR is formed in great variety in maturing B cells.
- B cells The development of B cells occurs in humans and in some other mammals in the bone marrow or fetal liver.
- the signals necessary for the development program are obtained from the developing lymphocytes of so-called stromal cells.
- B-cell development the formation of a functioning B-cell receptor (the membrane-bound form of the 'antibody') is of crucial importance. Only with this antigen receptor are mature B cells later able to recognize foreign antigens and bind to hostile structures through the formation of corresponding antibodies.
- the antigen specificity of the receptor is determined by the linkage of certain gene segments. The segments are called V, D and J segments, which is why the process is called V (D) J recombination. These segments, which form the antigen-binding part of the B-cell receptor, rearranged.
- the entire receptor consists of two identical light protein chains and two identical heavy protein chains, with the heavy and light chains each linked by disulfide bridges.
- VDJ recombination first the V, D and J segments of the heavy chain of the B cell receptor are linked, followed by the V and J segments of the light receptor chain. Only when the genes are successfully rearranged, which is referred to as productive gene rearrangement, the cell can go into the next development step.
- B cells that react to endogenous antigens during maturation in bone marrow generally die from apoptosis.
- small amounts of autoreactive cells, including thyroglobulin or collagen can be detected (Abul K. Abbas: Diseases of Immunity in Vinay Kumar, Abul K. Abbas, Nelson Fausto: Robbins and Cotran - Pathology Basis of Disease. 1st edition. Philadelphia 2005, p. 224f).
- BCR Since the process of generating such a BCR is based on a random assembly of gene segments, it may happen that the newly created BCR recognizes unwanted endogenous structures and thus becomes “permanently activated.” To prevent the emergence of such a "permanently active or activated" BCR There are various body protection mechanisms. However, if these are overcome due to a pathological change in the developing B-cell, it may develop into a malignant or even autoimmune manifesting disease.
- an “autonomously active” or “autonomously activated” BCR is a special type of permanently active BCR. While conventional activation proceeds from an external antigen (see above), the autonomously active BCR results from its interaction with membrane structures on the surface of the same cell. For the clinical picture of CLL, an autonomous activation-triggering interaction between BCRs could be shown, which were located adjacent to each other on the surface of the same cell (M. Dmixen-von Minden et al., Nature 2012). Another example of an autonomously active BCR is the pre-BCR, which is expressed during the development of a B cell as a development check. In addition to the interaction of neighboring receptors (BCR: BCR), an interaction between the receptor and a membrane protein (BCR: membrane protein) can lead to an autonomously active or activated BCR.
- BCR neighboring receptors
- BCR membrane protein
- a tumor-specific treatment by a significantly improved treatment success and, thanks to the reduction of undesirable systemic effects, a markedly increased therapeutic success is characterized.
- the present invention provides biological binding molecules in the form of antibodies or functional fragments thereof and a method for producing (identifying and selecting) such binding molecules which selectively bind to the modified epitopes of autonomously active membrane-bound immunoglobulins of B-cell neoplasias.
- the biological binding proteins selectively bind to such autonomously active B cell receptors on B cells which occur in immunological (eg autoimmune) diseases and are causally related to them (eg allergies, ulcerative colitis, diabetes mellitus Type 1, multiple sclerosis, psoriasis, rheumatic fever, rheumatoid arthritis, celiac disease).
- immunological eg autoimmune
- psoriasis rheumatic fever
- rheumatoid arthritis celiac disease
- B-cell specific antigens such as CD19, CD22 and CD40
- CD19, CD22 and CD40 were selected as targets of immunotoxins generated with plant toxins such as the ricin A chain and bacterial toxins such as Pseudomonas exotoxin A (PE) (Uckun et al., (1992) Blood 79, 2201-2214 Ghetie et al., (1991), Cancer Res. 51, 5876-5880, Francisco et al., (1995), Cancer Res. 55, 3099-3104).
- PE Pseudomonas exotoxin A
- each individual B-cell progenitor generates its own and almost unique B-cell receptor (BCR) through the rearrangement of individual gene segments.
- BCR B-cell receptor
- subset 2 Two variants (subset 2, subset 4) of the autonomously active BCR are known, which differ from one another with respect to their respective characteristic molecular motif (epitops) (Minici, C. et al., Distinct homotypic B-cell receptor interactions shape the outcome of chronic lymphocytic leukemia, Nature Comm. (2017)). Both variants have different short amino acid sequences that are specific for each of these variants.
- the skilled worker is aware that in addition to the subsets listed, other CLL-B cell receptors are autonomously active.
- the region of subset 2 relevant for the autonomously active functionality of the receptor is characterized by the amino acid sequences KLTVLRQPKA (SEQ ID NO. 1) and VAPGKTAR (SEQ ID NO.
- Range of subset 4 is defined by the amino acid sequences PTIRRYYYYG (SEQ ID NO: 3) and NHKPSNTKV (SEQ ID NO: 4) of the variable part of the heavy chain.
- the sequences used for generating the murine antibodies in the context of immunization for the subsets 2 and 4 are in SEQ ID NOS. 5 and 6 (vHC; LC) and 7 and 8 (vHC; LC), respectively.
- SEQ ID NO. 17 (VSSASTKG), another target sequence or epitope with specificity for the variable part of the heavy chain of a BCR of the subset 4 is given.
- target sequences (epitopes) according to SEQ ID NOS. 3 and 4 represents the sequence according to SEQ ID NO. 17 thus represents another property characteristic of this subset.
- subsets 2 and 4 as two variants of the B cell receptor in critically ill patients is based on the study of numerous case studies and therefore does not indicate that they are not present in a possible variety of other subtypes of the BCR for the two known subtypes characterizing target sequences (epitopes) are present and correlate with a serious disease course.
- the clones identified as potential binding partners in a first step by ELISA were found however, after selection as either nonspecifically binding or not binding to the autonomously active receptor (including SEQ ID Nos. 1 and 2) and therefore had to be discarded.
- the methods used until this finding included not only standard methods such as ELISA and SPR, but also intracellular expression in fibroblasts with an intracellular FACS staining as binding control.
- the binding molecule according to the invention selectively binds to autonomously active or autonomously activated B cell receptors, which are characterized by the presence of structural domains or epitopes (target sequences) and are responsible for the autonomously active or activated state of B cell receptors.
- the selective one Binding behavior of the binding molecule of the invention means that it does not bind to receptors or other membrane structures of B cells that have no structural domain or epitope that are responsible for the autonomously active or activated state of B cells.
- the binding molecule according to the invention does not selectively bind to target sequences of the B cell receptor which are not characteristic of the subset 2 or the subset 4, and in particular to a B cell receptor which does not contain any of the sequences SEQ ID NOS. 1, 2, 3 and / or 4.
- pro- / pre-B cells derived from Triple Knockout (TKO) mice is particularly well-suited to these receptors, despite the difficult handling and costly recovery be expressed and used in a test system for the identification of these receptors.
- the stage of pro- / pre-B cells is naturally designed to carry out the maturation and selection of BCRs, and the cells of this stage are particularly suitable because of their enzyme endowment (chaperones, etc.), even for "difficult" BCR components
- the deletions (knockouts) described below prevent a recombination or the use of the surrogates light chain ("surrogate light chain”) from causing a change in the desired BCR.
- the antibodies suitable for prophylactic and / or therapeutic purposes could be obtained in larger quantities in the form of monoclonal antibodies.
- the binding site of the antibody could be determined (see SEQ ID Nos. 9 and 10).
- Corresponding methods are known to the person skilled in the art and are also commercially available. It is advantageous here to obtain a larger number of hybridoma cells and to select those with the best binding activity (specificity and binding strength / affinity).
- the coding sequence was inserted into an expression plasmid with the DNA of a human antibody sequence to produce a humanized monoclonal antibody with the desired specificity in the usual way of recombination. Because of their unique specificity, these humanized antibodies showed better prophylactic and therapeutic efficacy compared to conventional drugs with relatively few side effects. It will be clear to those skilled in the art that these humanized antibodies can be produced in large quantities by biotechnological means. For the purification of the synthesized antibodies, standardized methods can be used, e.g. Combinations of precipitation, filtration and chromatography, which is well known to those skilled in the art, care should be taken not to denature the antibodies and to detect possible foreign substances such as e.g. To quantitatively remove proteins, pyrogens and toxins.
- the desired antibodies are expressed in systems in which the antibody is glycosylated, such as in particular undergoes a human glycosylation.
- systems are well known to those skilled in the art and include the use of insect cells (S2 cells), mammalian cells (CHO cells), and, most preferably, human cells such as HEK293T type cells.
- the sufficiently purified antibody may in itself be therapeutically effective, provided that it has an isotype which elicits a specific immune response, e.g. an IgG subtype that leads to an immune response against the tumor via Fc receptors.
- the antibody can also be present as a fragment. It is important that the antigen-binding site is present in the fragment, so it is a functional fragment. Such fragments can be e.g. by protease treatment as F (ab) produce fragments. Since these fragments are truncated in the constant part of the antibody, it is advantageous and therefore preferred to insert an effector molecule for killing neoplasms.
- the antibody is provided with a conjugate to enhance its effect.
- This conjugate is an area for killing neoplasms and can kill such neoplasias either as a direct or indirect effect.
- An example of such a conjugate is the binding of ricin to the antibody, wherein its preferably covalent attachment is carried out, for example, by using chemical crosslinkers.
- the antibody can also be used in modified form, for example as a biological binding molecule in the form of a fusion protein with T cell specific activation domains are present.
- T cells are first recovered from the patient's peripheral blood and engineered in vitro to express the CAR on their cell surface. Subsequently, these modified T cells are reintroduced into the patient, thus making CAR T cell immunotherapy feasible (see, eg, N Engl J Med. 2014 Oct 16; 371 (16): 1507-17. Doi: 10.1056 / NEJMoal407222 ).
- the antibody is preferably employed in a composition comprising a pharmaceutically acceptable carrier.
- a pharmaceutically acceptable carrier is a carrier which is physiologically contracted for a patient being treated and which preserves the therapeutic properties of the compound with which it is administered.
- An exemplary pharmaceutically acceptable carrier is physiological saline.
- Other suitable physiologically acceptable carriers and their formulations are known to those skilled in the art and are described, for example, in Remington's Pharmaceutical Sciences (18th ed.), Ed. A. Gennaro, 1990, Mack Publishing Company, Easton, PA).
- a stabilizing salt buffer may be, for example, a phosphate-buffered saline (PBS), as known to those skilled in the art.
- PBS phosphate-buffered saline
- a suitable drying form is, for example, freeze-drying or lyophilization.
- the antibody of the invention having specificity for the autonomously activated BCR (subset-2) in an apharesic system can be used to separate leukemia cells from a blood sample of a patient.
- various methods are suitable for this, as is known to the person skilled in the art.
- the antibodies may be bound to magnetizable particles (beads) (eg Dynabeads).
- the blood is provided with an anticoagulant and brought into contact with the particles outside the body of the patient.
- at least one particle preferably 10 to 100 particles, is used for each tumor cell.
- a particle with a size of, for example, less than 20 ⁇ typically contains several antibodies of the same specificity (number of particles greater than 5000 / ⁇ 1 blood). With the help of magnets, these particles can then be bound before the purified, residual blood is returned to the patient. This therapeutic measure significantly reduces the number of tumor cells in the patient's blood.
- the particles have sizes of more than 20 ⁇ and also have a variety of antibodies per particle (>100,> 1000).
- lymphocytes tumor cells
- These particle / cell conjugates are removed by classical centrifugation as commonly used in apharesis. The times required depend on the nature of the particles and the apparatus and must be determined experimentally.
- both the particle / cell conjugates in particular when using large particles over 20 ⁇ m in diameter
- free particles without cell binding can be separated off with the aid of a fine network of blood.
- Such networks are commercially available, for example, as so-called 'cell trainers'.
- Methods of conjugating the antibodies to the particles are well known to those skilled in the art. Procedural instructions are provided eg by Dynal to their customers. Individual aspects of the present invention will be explained in more detail below with reference to examples.
- the production and identification of antibodies that bind selectively to the modified B cell receptors has been characterized by major and unforeseen problems.
- the generation of the hybridomas was carried out by standard methods.
- the supernatant from the hybridoma groups was pooled and tested for positive binding events by ELISA (soluble B cell receptors on the ELISA plate). Positive pools were isolated and the individual clones tested. Surprisingly, no positive clones were identified in the ELISA.
- the positive ELISA signals of the Poole subsequently turned out to be unspecific bindings.
- the BCR light chain has now been expressed in fibroblasts. This should ensure the correct folding of the protein bearing the motif (epitope) responsible for the autonomic signal. Intracellular FACS analyzes were performed on these cells. No positive clone (antibody) could be identified. For this reason, in another experiment, RAMOS cells (human Burkitt lymphoma cell line) were modified to have functional modified BCRs. This should ensure complete biosynthesis, folding and modification of the BCR.
- the cell's own BCR was deleted by means of CRISPR, and then the "CLL receptor" was reconstituted molecularly (electroporation of CMV vectors) . These cells were used to test positive binding events, again with no positive clone detectable by FACS.
- RAGl and RAG2 form a complex which allows the usual VDJ rearrangement, which is why a knockout of RAGl is an equal-acting agent and thus an alternative to the knockout of RAG2 and is encompassed by the teaching according to the invention.
- the deletion of lambda5 a part of the surrogate light chain, prevents the formation of a pre-BCR. Since the pre-BCR is autonomously active, this would interfere with the detection of an autonomously active receptor. Since a new BCR is cloned into the cell here, a pre-BCR is undesirable, since this one with the desired heavy chain (HC) in conjunction with the unwanted surrogates light chain would appear on the surface and interfere with the selection.
- the knockout of SLP65 an adapter protein of central importance in the BCR signaling pathway, prevents the activation of the
- the knockout of RAG2 or RAG1 and lambda5 is sufficient.
- the activity of the BCR can be measured.
- the method of choice here is the measurement of Ca flux after induction of the SLP65 by means of FACS analysis and the use of a Ca 2+ -dependent dye such as Indo-1. These methods are known to those skilled in the art (see, for example, M. Dschreiben-von Minden et al., Nature 2012.)
- the first two knockouts ensured that only the "BCR of interest" was expressed on the surface
- the inducible SLP65 with which the cells were reconstituted may characterize the function of the expressed BCRs and thus verify the autonomously active state of the BCRs on the surface prior to selection.
- the expression of the BCR was determined by means of anti-IgM and anti-LC antibodies on the FACS. For this purpose, a few cells were taken and stained with 5 ⁇ l antibody in a total volume of ⁇ in PBS. Using these cells as the "target", FACS was now able to identify an antibody that specifically binds to the modified region that is responsible for and is responsible for the autonomous activation of BCR, even though binding to the same type of receptor in RAMOS cells was not successful!
- the cells which carried the "BCR of interest” on the surface were first incubated with the pooled supernatants, and after a few washing steps, the bound antibodies were detected by means of secondary antibodies.TKO cells (TKOs) were used for a specific selection different versions of the "BCR of interest” expressed.
- the selection matrix shown in FIG. 1 is exemplary for the selection of a CLL subset 2 BCR and was used to identify and select positive clones.
- the supernatants of the hybridomas were pooled and measured. The groups that showed binding were singulated and the supernatants of the respective hybridomas tested for binding.
- mice which have a respective knockout for the genes Lambda5, RAG2 and SLP65 (Dlicken von Minden et al., 2012, Nature 489, p309-313).
- the preparation of such mice is known in the art and belongs to the prior art.
- the mice were extracted after their killing the bone marrow of the femurs.
- the cells thus obtained were then cultured under conditions favoring the survival of pro- / pre-B cells (37 ° C, 7.5% CO2, Iscoves medium, 10% FCS, P / S, murine IL7).
- a FACS sorting was performed as a control, the pro / pre-B cells were sorted and then returned to culture.
- the markers used for this purpose are known to the person skilled in the art.
- the corresponding sequences coding for the heavy (HC) and light (LC) chains were synthesized and then each cloned into a CMV promoter-containing expression vectors. These were incorporated by lipofection into the packaging cell line (Phoenix cell line). After a 36 hour incubation, virus supernatant was removed and used for spinfection of TKO cells. Both the work for the recovery of the supernatants and the spinfection of the TKO are widely known methods and known to the skilled person.
- subset-2 B cell receptors were taken from the corresponding literature (see above).
- Exemplary CLL subset 2 VH and complete LC DNA segments were synthesized by a contract manufacturer in a standard procedure. These were then fused with a murine IgGl constant segment by PCR and transformed into a CMV Vector cloned. The sequence of the final vector was confirmed by Sanger sequencing.
- CLL subsets 2 IgG1 For expression of CLL subsets 2 IgG1, a human cellular expression system based on HEK293T cells was used. For transfection, a polyethyleneimine (PEI) based protocol was used. After several passages, the supernatant was pooled and the medium contained in the pooled cell supernatant was purified by means of Protein G columns. The purity and quality of the soluble Subset-2 IgGl was determined by Western blot.
- PEI polyethyleneimine
- the mRNA was isolated from the individual hybridoma clones, from which cDNA was generated and amplified by means of anchor PCR (Rapid Expression Cloning of human immunoglobulin Fab fragments for the analysis of antigenic specificity of B cell lymphomas and anti-idiotype lymphoma vaccination; Osterroth F, alkane 0, Mackensen A, Lindemann A, fish P, Skerra A, Veelken H., J Immunol Methods 1999 Oct 29; 229 (1-2): 141-53).
- CDRs binding sites
- SEQ ID NO. 9 shows the variable part of the heavy chain (HC)
- SEQ ID NO. 10 relate to the variable part of the light chain (LC)
- the marked regions - in the order given - denote CDR 1, 2 and 3.
- SEQ ID NO. 9 (AVA-mAbOl HC)
- Exemplary CLL subset 4 VH and complete LC DNA segments were synthesized by a contract manufacturer in a standard procedure. These were then fused with a murine IgGl constant segment by PCR and cloned into a C V vector. The sequence of the final vector was confirmed by Sanger sequencing.
- CLL subset 4 HC (SEQ ID NO. 7) QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWTWIRQSPGKGLEWIGEINHSGSTTYNPSL KSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARGYGDTPTIRRYYYYGMDVWGQGTTVTVSS ASTKGPSVFPLAPSSKSTSGGTA ⁇ LGCLVKDYFPEPVTVSWNSGALTSGVHTFPACLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKC The bold regions indicate the target sequences (epitopes) of the variable part of the heavy chain of the BCR the subset 4, which are responsible for its autonomous active state (see FIG. SEQ ID NOS. 3 and 4).
- CLL Subset 4 LC (SEQ ID NO. 8): DIVMTQSPLSLPVTLGQPASISCRSSQSLVHSDGNTYLNWFQQRPGQSPRRLIYKVSDRDSGV PDRFSGSGSGTDFTLKISRVEAEDVGLYYCMQGTHWPPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKS FNRGEC.
- the antibody of the invention having autonomous activated BCR (Subset-2) specificity was used in an apharesic system to separate leukemia cells from a patient's blood sample. Peripheral blood was collected from a patient (EDTA blood from blood collection tubes). The lymphocyte count was determined using a cell counter and yielded 80,000 lymphocytes / ⁇ .
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biomedical Technology (AREA)
- Microbiology (AREA)
- Urology & Nephrology (AREA)
- Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Analytical Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
Description
Claims
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17001167 | 2017-07-07 | ||
| EP17001166 | 2017-07-07 | ||
| EP18162672.2A EP3424528A1 (de) | 2017-07-07 | 2018-03-19 | Biologische bindemoleküle |
| PCT/EP2018/068317 WO2019008129A1 (de) | 2017-07-07 | 2018-07-05 | Biologische bindemoleküle |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP3615073A1 true EP3615073A1 (de) | 2020-03-04 |
Family
ID=64500047
Family Applications (4)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP18162666.4A Withdrawn EP3424527A1 (de) | 2017-07-07 | 2018-03-19 | Diagnostisches verfahren |
| EP18162672.2A Withdrawn EP3424528A1 (de) | 2017-07-07 | 2018-03-19 | Biologische bindemoleküle |
| EP18746103.3A Pending EP3615072A1 (de) | 2017-07-07 | 2018-07-05 | Diagnostisches verfahren |
| EP18746104.1A Pending EP3615073A1 (de) | 2017-07-07 | 2018-07-05 | Biologische bindemoleküle |
Family Applications Before (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP18162666.4A Withdrawn EP3424527A1 (de) | 2017-07-07 | 2018-03-19 | Diagnostisches verfahren |
| EP18162672.2A Withdrawn EP3424528A1 (de) | 2017-07-07 | 2018-03-19 | Biologische bindemoleküle |
| EP18746103.3A Pending EP3615072A1 (de) | 2017-07-07 | 2018-07-05 | Diagnostisches verfahren |
Country Status (5)
| Country | Link |
|---|---|
| US (2) | US11634487B2 (de) |
| EP (4) | EP3424527A1 (de) |
| JP (2) | JP7239575B2 (de) |
| CA (1) | CA3070848A1 (de) |
| WO (2) | WO2019008128A1 (de) |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3424527A1 (de) * | 2017-07-07 | 2019-01-09 | AVA Lifescience GmbH | Diagnostisches verfahren |
| EP3733709A1 (de) * | 2019-05-02 | 2020-11-04 | AVA Lifescience | Biologische bindemoleküle |
| CA3148214A1 (en) * | 2019-05-02 | 2020-11-05 | Ava Lifescience Gmbh | Antigent binding domains and uses therefor |
| WO2020221463A1 (de) * | 2019-05-02 | 2020-11-05 | Ava Lifescience Gmbh | Verfahren zur selektion biologischer bindemoleküle |
| IL310901A (en) * | 2021-08-18 | 2024-04-01 | Univ Pennsylvania | Compositions and methods for chimeric antigen receptors specific to b cell receptors |
| EP4227321A1 (de) * | 2022-02-10 | 2023-08-16 | AVA Lifescience GmbH | Antikörper gegen den b-zell rezeptor chronischer lymphatischer leukämie (cll) zur verwendung bei der behandlung von cll |
| EP4476264A1 (de) | 2022-02-10 | 2024-12-18 | SinABioSolution GmbH | Antikörper gegen den b-zell-rezeptor von chronischer lymphozytischer leukämie und verwendungen davon |
| CA3262006A1 (en) * | 2022-07-25 | 2024-02-01 | Sinabiosolution Gmbh | Humanized chimeric antigen receptors targeting the B-lymphocyte receptor in chronic lymphocytic leukemia and their uses |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7393531B2 (en) | 2003-01-21 | 2008-07-01 | Arius Research Inc. | Cytotoxicity mediation of cells evidencing surface expression of MCSP |
| EP3539985A1 (de) * | 2012-02-24 | 2019-09-18 | AbbVie Stemcentrx LLC | Anti-sez6-antikörper und verfahren zur verwendung |
| US9770504B2 (en) * | 2013-05-03 | 2017-09-26 | The Board Of Regents Of The University Of Texas System | Generating peptoid vaccines |
| SG11201601424PA (en) * | 2013-08-28 | 2016-03-30 | Stemcentrx Inc | Site-specific antibody conjugation methods and compositions |
| EP3424527A1 (de) * | 2017-07-07 | 2019-01-09 | AVA Lifescience GmbH | Diagnostisches verfahren |
-
2018
- 2018-03-19 EP EP18162666.4A patent/EP3424527A1/de not_active Withdrawn
- 2018-03-19 EP EP18162672.2A patent/EP3424528A1/de not_active Withdrawn
- 2018-07-05 US US16/625,754 patent/US11634487B2/en active Active
- 2018-07-05 CA CA3070848A patent/CA3070848A1/en active Pending
- 2018-07-05 JP JP2020522785A patent/JP7239575B2/ja active Active
- 2018-07-05 EP EP18746103.3A patent/EP3615072A1/de active Pending
- 2018-07-05 WO PCT/EP2018/068316 patent/WO2019008128A1/de not_active Ceased
- 2018-07-05 JP JP2020522786A patent/JP7271532B2/ja active Active
- 2018-07-05 WO PCT/EP2018/068317 patent/WO2019008129A1/de not_active Ceased
- 2018-07-05 EP EP18746104.1A patent/EP3615073A1/de active Pending
- 2018-07-05 US US16/625,756 patent/US11591391B2/en active Active
Also Published As
| Publication number | Publication date |
|---|---|
| US20200199225A1 (en) | 2020-06-25 |
| US11634487B2 (en) | 2023-04-25 |
| EP3424527A1 (de) | 2019-01-09 |
| JP2020526590A (ja) | 2020-08-31 |
| EP3424528A1 (de) | 2019-01-09 |
| WO2019008128A1 (de) | 2019-01-10 |
| JP2020527727A (ja) | 2020-09-10 |
| EP3615072A1 (de) | 2020-03-04 |
| US20200209246A1 (en) | 2020-07-02 |
| JP7239575B2 (ja) | 2023-03-14 |
| JP7271532B2 (ja) | 2023-05-11 |
| WO2019008129A1 (de) | 2019-01-10 |
| US11591391B2 (en) | 2023-02-28 |
| CA3070847A1 (en) | 2019-01-10 |
| CA3070848A1 (en) | 2019-01-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3615073A1 (de) | Biologische bindemoleküle | |
| DE69128253T2 (de) | Bispezifische antikörper, verfahren zu ihrer herstellung und deren verwendungen | |
| DE69426743T2 (de) | Bispezifische Auslösemoleküle, die das Lymphozytantigen CD2 und Tumorantigene erkennen | |
| DE3853636T3 (de) | Antigene epitope, die sich ausschliesslich auf ige-tragenden b-lymphocyten befinden. | |
| DE69605181T2 (de) | Antikörper gegen cd30, die proteolytische spaltung und abgabe des membrangebundenen cd30 antigens verhindern | |
| DE69100768T2 (de) | CD25-bindende Moleküle. | |
| DE69333591T2 (de) | CD40CR-Rezeptor und Liganden dafür | |
| DE69518919T2 (de) | Autoantikörper enthaltende zusammensetzung für tumorbehandlung und -vorbeugung | |
| DE60226036T3 (de) | ANTIKÖRPER, DER DAS GM1-GANGLIOSID-GEBUNDENE AMYLOID-b-PROTEIN ERKENNT, UND DNA, DIE FÜR DIESEN ANTIKÖRPER CODIERT | |
| DE69031410T2 (de) | Monoklonale Antikörper gegen den humanen alpha/beta-T-Zellenrezeptor, ihre Herstellung und Verwendung | |
| DE69126607T2 (de) | Extrazelluläre teilstücke humaner ige-immunoglobulin-ankerpeptide und dafür spezifische antikörper | |
| DE69126526T2 (de) | Verfahren zur zellwachstumshinderung und dazu nützliche verbindungen | |
| WO2011036183A2 (de) | Anti-cd33 antikörper und ihre anwendung zum immunotargeting bei der behandlung von cd33-assoziierten erkrankungen | |
| DE69938451T2 (de) | Fas peptide und antikörper zur modulierung von apoptosis | |
| EP3505536A1 (de) | Antikörper gegen das prostata-spezifische stammzellantigen und dessen verwendung | |
| DE69333039T2 (de) | Monoklonaler antikörper gegen ein humanes mdr1-gen produkt, das eine resistenz gegen verschiedene medikamente erzeugt und seine verwendung | |
| EP3899536B1 (de) | Verfahren zur selektion biologischer bindemoleküle | |
| WO2020221466A1 (de) | Biologische bindemoleküle | |
| EP3543697B1 (de) | Verfahren zur selektion biologischer bindemoleküle | |
| DE10210427A1 (de) | Humaner monoklonaler Antikörper | |
| DE69635161T2 (de) | Rekombinante hetero-multimerische proteine von dem alpha-beta c4 bp typ | |
| DE69028713T3 (de) | Schimäre immunoglobuline für cd4-rezeptoren | |
| DE19852804C1 (de) | Beeinflussung der Angiogenese durch CD66a | |
| EP3733709A1 (de) | Biologische bindemoleküle | |
| WO2020221463A1 (de) | Verfahren zur selektion biologischer bindemoleküle |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: UNKNOWN |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE |
|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE |
|
| 17P | Request for examination filed |
Effective date: 20191126 |
|
| AK | Designated contracting states |
Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR |
|
| AX | Request for extension of the european patent |
Extension state: BA ME |
|
| DAV | Request for validation of the european patent (deleted) | ||
| DAX | Request for extension of the european patent (deleted) | ||
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: EXAMINATION IS IN PROGRESS |
|
| 17Q | First examination report despatched |
Effective date: 20210618 |
|
| 19A | Proceedings stayed before grant |
Effective date: 20230512 |
|
| RAP3 | Party data changed (applicant data changed or rights of an application transferred) |
Owner name: AVA LIFESCIENCE GMBH |