EP1570054A2 - Trans-sialidasen aus trypanosoma congolense - Google Patents
Trans-sialidasen aus trypanosoma congolenseInfo
- Publication number
- EP1570054A2 EP1570054A2 EP03785794A EP03785794A EP1570054A2 EP 1570054 A2 EP1570054 A2 EP 1570054A2 EP 03785794 A EP03785794 A EP 03785794A EP 03785794 A EP03785794 A EP 03785794A EP 1570054 A2 EP1570054 A2 EP 1570054A2
- Authority
- EP
- European Patent Office
- Prior art keywords
- trans
- sialidase
- nucleic acid
- enzymes
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Withdrawn
Links
- 108010004486 trans-sialidase Proteins 0.000 title claims abstract description 84
- 241000223107 Trypanosoma congolense Species 0.000 title claims abstract description 20
- 102000004190 Enzymes Human genes 0.000 claims abstract description 78
- 108090000790 Enzymes Proteins 0.000 claims abstract description 78
- 150000007523 nucleic acids Chemical group 0.000 claims abstract description 70
- 238000000034 method Methods 0.000 claims abstract description 49
- 239000013598 vector Substances 0.000 claims abstract description 36
- 230000014509 gene expression Effects 0.000 claims abstract description 33
- 238000004519 manufacturing process Methods 0.000 claims abstract description 22
- 244000005700 microbiome Species 0.000 claims abstract description 18
- 238000012546 transfer Methods 0.000 claims abstract description 17
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 claims abstract description 13
- 239000012636 effector Substances 0.000 claims abstract description 12
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 claims abstract description 12
- 239000003814 drug Substances 0.000 claims abstract description 10
- 230000002255 enzymatic effect Effects 0.000 claims abstract description 10
- 229960005486 vaccine Drugs 0.000 claims abstract description 5
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 6
- 108090000623 proteins and genes Proteins 0.000 claims description 71
- 125000005629 sialic acid group Chemical group 0.000 claims description 41
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 34
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 34
- 150000001413 amino acids Chemical class 0.000 claims description 32
- 229920001184 polypeptide Polymers 0.000 claims description 32
- 102000004169 proteins and genes Human genes 0.000 claims description 30
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 27
- 230000036961 partial effect Effects 0.000 claims description 27
- 230000000694 effects Effects 0.000 claims description 26
- 235000018102 proteins Nutrition 0.000 claims description 26
- 108091033319 polynucleotide Proteins 0.000 claims description 25
- 102000040430 polynucleotide Human genes 0.000 claims description 24
- 239000002157 polynucleotide Substances 0.000 claims description 24
- 239000000047 product Substances 0.000 claims description 23
- 238000006243 chemical reaction Methods 0.000 claims description 18
- 230000001105 regulatory effect Effects 0.000 claims description 18
- 125000003729 nucleotide group Chemical group 0.000 claims description 17
- 108091034117 Oligonucleotide Proteins 0.000 claims description 15
- 150000003839 salts Chemical class 0.000 claims description 15
- 239000012634 fragment Substances 0.000 claims description 14
- 238000011161 development Methods 0.000 claims description 13
- 230000018109 developmental process Effects 0.000 claims description 13
- 230000008569 process Effects 0.000 claims description 13
- 230000000692 anti-sense effect Effects 0.000 claims description 12
- 230000000295 complement effect Effects 0.000 claims description 12
- 239000000126 substance Substances 0.000 claims description 12
- 230000009261 transgenic effect Effects 0.000 claims description 12
- 239000002253 acid Substances 0.000 claims description 11
- 239000012228 culture supernatant Substances 0.000 claims description 11
- 108010006232 Neuraminidase Proteins 0.000 claims description 10
- 102000005348 Neuraminidase Human genes 0.000 claims description 10
- 235000015872 dietary supplement Nutrition 0.000 claims description 10
- 108090000288 Glycoproteins Proteins 0.000 claims description 9
- 102000003886 Glycoproteins Human genes 0.000 claims description 9
- 235000013305 food Nutrition 0.000 claims description 8
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 7
- 108010076119 Caseins Proteins 0.000 claims description 7
- 102000011632 Caseins Human genes 0.000 claims description 7
- 206010028980 Neoplasm Diseases 0.000 claims description 7
- 150000007513 acids Chemical class 0.000 claims description 7
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 claims description 7
- 235000021240 caseins Nutrition 0.000 claims description 7
- 229930182830 galactose Natural products 0.000 claims description 7
- 150000002482 oligosaccharides Chemical group 0.000 claims description 7
- 241000223104 Trypanosoma Species 0.000 claims description 6
- 229940021722 caseins Drugs 0.000 claims description 6
- 201000010099 disease Diseases 0.000 claims description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 6
- 150000004676 glycans Chemical group 0.000 claims description 6
- 210000000987 immune system Anatomy 0.000 claims description 6
- 229920001542 oligosaccharide Polymers 0.000 claims description 6
- 238000007792 addition Methods 0.000 claims description 5
- 230000004071 biological effect Effects 0.000 claims description 5
- 229920001282 polysaccharide Chemical group 0.000 claims description 5
- 239000005017 polysaccharide Chemical group 0.000 claims description 5
- 230000002265 prevention Effects 0.000 claims description 5
- 206010061218 Inflammation Diseases 0.000 claims description 4
- 208000036142 Viral infection Diseases 0.000 claims description 4
- 108010046377 Whey Proteins Proteins 0.000 claims description 4
- 238000001042 affinity chromatography Methods 0.000 claims description 4
- 230000019552 anatomical structure morphogenesis Effects 0.000 claims description 4
- 230000001363 autoimmune Effects 0.000 claims description 4
- 238000012217 deletion Methods 0.000 claims description 4
- 230000037430 deletion Effects 0.000 claims description 4
- 238000002523 gelfiltration Methods 0.000 claims description 4
- 230000002068 genetic effect Effects 0.000 claims description 4
- 230000004054 inflammatory process Effects 0.000 claims description 4
- 239000003446 ligand Substances 0.000 claims description 4
- 238000006467 substitution reaction Methods 0.000 claims description 4
- 230000009385 viral infection Effects 0.000 claims description 4
- UOQHWNPVNXSDDO-UHFFFAOYSA-N 3-bromoimidazo[1,2-a]pyridine-6-carbonitrile Chemical compound C1=CC(C#N)=CN2C(Br)=CN=C21 UOQHWNPVNXSDDO-UHFFFAOYSA-N 0.000 claims description 3
- 208000035143 Bacterial infection Diseases 0.000 claims description 3
- 229930186217 Glycolipid Natural products 0.000 claims description 3
- 208000030852 Parasitic disease Diseases 0.000 claims description 3
- 230000001580 bacterial effect Effects 0.000 claims description 3
- 208000022362 bacterial infectious disease Diseases 0.000 claims description 3
- FHNIYFZSHCGBPP-ABBMIVAOSA-N beta-D-Gal-(1->4)-beta-D-Glc-OMe Chemical compound O[C@@H]1[C@@H](O)[C@H](OC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 FHNIYFZSHCGBPP-ABBMIVAOSA-N 0.000 claims description 3
- WQZGKKKJIJFFOK-FPRJBGLDSA-N beta-D-galactose Chemical group OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-FPRJBGLDSA-N 0.000 claims description 3
- 230000023402 cell communication Effects 0.000 claims description 3
- 239000003795 chemical substances by application Substances 0.000 claims description 3
- 239000002532 enzyme inhibitor Substances 0.000 claims description 3
- 238000001415 gene therapy Methods 0.000 claims description 3
- 230000013595 glycosylation Effects 0.000 claims description 3
- 208000015181 infectious disease Diseases 0.000 claims description 3
- 238000004255 ion exchange chromatography Methods 0.000 claims description 3
- 238000001155 isoelectric focusing Methods 0.000 claims description 3
- VQHSOMBJVWLPSR-JVCRWLNRSA-N lactitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-JVCRWLNRSA-N 0.000 claims description 3
- 239000000832 lactitol Substances 0.000 claims description 3
- 229960003451 lactitol Drugs 0.000 claims description 3
- 235000010448 lactitol Nutrition 0.000 claims description 3
- 229940099563 lactobionic acid Drugs 0.000 claims description 3
- 235000021242 lactoferrin Nutrition 0.000 claims description 3
- 230000003071 parasitic effect Effects 0.000 claims description 3
- 229920000499 poly(galactose) polymer Polymers 0.000 claims description 3
- 229920000642 polymer Polymers 0.000 claims description 3
- 230000006920 protein precipitation Effects 0.000 claims description 3
- 230000000717 retained effect Effects 0.000 claims description 3
- 201000002311 trypanosomiasis Diseases 0.000 claims description 3
- 235000021119 whey protein Nutrition 0.000 claims description 3
- 208000012239 Developmental disease Diseases 0.000 claims description 2
- 230000006806 disease prevention Effects 0.000 claims description 2
- 238000010353 genetic engineering Methods 0.000 claims description 2
- 238000006206 glycosylation reaction Methods 0.000 claims description 2
- 230000001771 impaired effect Effects 0.000 claims description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 claims 2
- 125000000539 amino acid group Chemical group 0.000 claims 1
- 235000012041 food component Nutrition 0.000 claims 1
- 239000005417 food ingredient Substances 0.000 claims 1
- 229940124597 therapeutic agent Drugs 0.000 claims 1
- 235000013373 food additive Nutrition 0.000 abstract description 2
- 239000002778 food additive Substances 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 31
- 102000039446 nucleic acids Human genes 0.000 description 31
- 108020004707 nucleic acids Proteins 0.000 description 31
- 108020004414 DNA Proteins 0.000 description 24
- 239000000370 acceptor Substances 0.000 description 20
- 241001465754 Metazoa Species 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 14
- 239000002773 nucleotide Substances 0.000 description 12
- 241000894006 Bacteria Species 0.000 description 11
- 241000282414 Homo sapiens Species 0.000 description 11
- 241000196324 Embryophyta Species 0.000 description 10
- 235000021255 galacto-oligosaccharides Nutrition 0.000 description 10
- 150000003271 galactooligosaccharides Chemical class 0.000 description 10
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 9
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 8
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 230000033228 biological regulation Effects 0.000 description 8
- 241000233866 Fungi Species 0.000 description 7
- 108010067454 caseinomacropeptide Proteins 0.000 description 7
- 238000004587 chromatography analysis Methods 0.000 description 7
- 239000013604 expression vector Substances 0.000 description 7
- -1 lactyl Chemical group 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 108020003175 receptors Proteins 0.000 description 7
- 102000005962 receptors Human genes 0.000 description 7
- 239000000523 sample Substances 0.000 description 7
- 241001494479 Pecora Species 0.000 description 6
- 108090000141 Sialyltransferases Proteins 0.000 description 6
- 102000003838 Sialyltransferases Human genes 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- 239000002299 complementary DNA Substances 0.000 description 6
- 238000010369 molecular cloning Methods 0.000 description 6
- 235000000346 sugar Nutrition 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- 241000283690 Bos taurus Species 0.000 description 5
- 241000283707 Capra Species 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 5
- 241000224557 Trypanosoma brucei brucei Species 0.000 description 5
- 230000027455 binding Effects 0.000 description 5
- 238000009739 binding Methods 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000009396 hybridization Methods 0.000 description 5
- 239000013615 primer Substances 0.000 description 5
- 238000003786 synthesis reaction Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- CERZMXAJYMMUDR-QBTAGHCHSA-N 5-amino-3,5-dideoxy-D-glycero-D-galacto-non-2-ulopyranosonic acid Chemical class N[C@@H]1[C@@H](O)CC(O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO CERZMXAJYMMUDR-QBTAGHCHSA-N 0.000 description 4
- 241000282412 Homo Species 0.000 description 4
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 4
- 241000223109 Trypanosoma cruzi Species 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 238000004140 cleaning Methods 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 238000002744 homologous recombination Methods 0.000 description 4
- 230000006801 homologous recombination Effects 0.000 description 4
- 239000008101 lactose Substances 0.000 description 4
- 108020004999 messenger RNA Proteins 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 241000282832 Camelidae Species 0.000 description 3
- 241000283086 Equidae Species 0.000 description 3
- 102000017099 Myelin-Associated Glycoprotein Human genes 0.000 description 3
- 108010013731 Myelin-Associated Glycoprotein Proteins 0.000 description 3
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 3
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 3
- 238000006640 acetylation reaction Methods 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 230000015556 catabolic process Effects 0.000 description 3
- 239000012539 chromatography resin Substances 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 238000006731 degradation reaction Methods 0.000 description 3
- 210000003527 eukaryotic cell Anatomy 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 108020001507 fusion proteins Proteins 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 150000002270 gangliosides Chemical class 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 239000002987 primer (paints) Substances 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000012134 supernatant fraction Substances 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000000108 ultra-filtration Methods 0.000 description 3
- LWTDZKXXJRRKDG-KXBFYZLASA-N (-)-phaseollin Chemical compound C1OC2=CC(O)=CC=C2[C@H]2[C@@H]1C1=CC=C3OC(C)(C)C=CC3=C1O2 LWTDZKXXJRRKDG-KXBFYZLASA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- LRFVTYWOQMYALW-UHFFFAOYSA-N 9H-xanthine Chemical compound O=C1NC(=O)NC2=C1NC=N2 LRFVTYWOQMYALW-UHFFFAOYSA-N 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-N Ammonia Chemical compound N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 2
- 241000282836 Camelus dromedarius Species 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- 241000195493 Cryptophyta Species 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 102000005720 Glutathione transferase Human genes 0.000 description 2
- 108010070675 Glutathione transferase Proteins 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 241000589989 Helicobacter Species 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 102000004856 Lectins Human genes 0.000 description 2
- 108090001090 Lectins Proteins 0.000 description 2
- 201000009906 Meningitis Diseases 0.000 description 2
- 206010065764 Mucosal infection Diseases 0.000 description 2
- 108091092724 Noncoding DNA Proteins 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 238000012300 Sequence Analysis Methods 0.000 description 2
- 102000007073 Sialic Acid Binding Immunoglobulin-like Lectins Human genes 0.000 description 2
- 108010047827 Sialic Acid Binding Immunoglobulin-like Lectins Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 238000002105 Southern blotting Methods 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 241000223105 Trypanosoma brucei Species 0.000 description 2
- 241000223097 Trypanosoma rangeli Species 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 125000002252 acyl group Chemical group 0.000 description 2
- 125000003277 amino group Chemical class 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 239000000427 antigen Substances 0.000 description 2
- 108091007433 antigens Proteins 0.000 description 2
- 102000036639 antigens Human genes 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 102000005936 beta-Galactosidase Human genes 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 125000004432 carbon atom Chemical group C* 0.000 description 2
- 125000002843 carboxylic acid group Chemical group 0.000 description 2
- 230000008614 cellular interaction Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 235000013351 cheese Nutrition 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- IERHLVCPSMICTF-XVFCMESISA-N cytidine 5'-monophosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(O)=O)O1 IERHLVCPSMICTF-XVFCMESISA-N 0.000 description 2
- IERHLVCPSMICTF-UHFFFAOYSA-N cytidine monophosphate Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(COP(O)(O)=O)O1 IERHLVCPSMICTF-UHFFFAOYSA-N 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 210000003743 erythrocyte Anatomy 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 102000035122 glycosylated proteins Human genes 0.000 description 2
- 108091005608 glycosylated proteins Proteins 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 208000037797 influenza A Diseases 0.000 description 2
- 208000037798 influenza B Diseases 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000002523 lectin Substances 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000004379 membrane Anatomy 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 230000011987 methylation Effects 0.000 description 2
- 238000007069 methylation reaction Methods 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 210000004400 mucous membrane Anatomy 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- SOWBFZRMHSNYGE-UHFFFAOYSA-N oxamic acid Chemical compound NC(=O)C(O)=O SOWBFZRMHSNYGE-UHFFFAOYSA-N 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 238000003752 polymerase chain reaction Methods 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 238000004904 shortening Methods 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- 241000701447 unidentified baculovirus Species 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- WQZGKKKJIJFFOK-SVZMEOIVSA-N (+)-Galactose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-SVZMEOIVSA-N 0.000 description 1
- HORYNJCIACQHGZ-BHVWUGLYSA-N 1-[(3R,4R,5S,6R)-3-amino-2,4-dihydroxy-6-(hydroxymethyl)-5-[(2S,3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]ethanone Chemical compound C(C)(=O)C1(O)[C@H](N)[C@@H](O)[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@@H](O)[C@H](O2)CO)[C@H](O1)CO HORYNJCIACQHGZ-BHVWUGLYSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- XMTQQYYKAHVGBJ-UHFFFAOYSA-N 3-(3,4-DICHLOROPHENYL)-1,1-DIMETHYLUREA Chemical compound CN(C)C(=O)NC1=CC=C(Cl)C(Cl)=C1 XMTQQYYKAHVGBJ-UHFFFAOYSA-N 0.000 description 1
- GJAKJCICANKRFD-UHFFFAOYSA-N 4-acetyl-4-amino-1,3-dihydropyrimidin-2-one Chemical compound CC(=O)C1(N)NC(=O)NC=C1 GJAKJCICANKRFD-UHFFFAOYSA-N 0.000 description 1
- LQLQRFGHAALLLE-UHFFFAOYSA-N 5-bromouracil Chemical compound BrC1=CNC(=O)NC1=O LQLQRFGHAALLLE-UHFFFAOYSA-N 0.000 description 1
- ZFTBZKVVGZNMJR-UHFFFAOYSA-N 5-chlorouracil Chemical compound ClC1=CNC(=O)NC1=O ZFTBZKVVGZNMJR-UHFFFAOYSA-N 0.000 description 1
- KSNXJLQDQOIRIP-UHFFFAOYSA-N 5-iodouracil Chemical compound IC1=CNC(=O)NC1=O KSNXJLQDQOIRIP-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical group CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000589158 Agrobacterium Species 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 102000019260 B-Cell Antigen Receptors Human genes 0.000 description 1
- 108010012919 B-Cell Antigen Receptors Proteins 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 1
- TXCIAUNLDRJGJZ-UHFFFAOYSA-N CMP-N-acetyl neuraminic acid Natural products O1C(C(O)C(O)CO)C(NC(=O)C)C(O)CC1(C(O)=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-UHFFFAOYSA-N 0.000 description 1
- TXCIAUNLDRJGJZ-BILDWYJOSA-N CMP-N-acetyl-beta-neuraminic acid Chemical compound O1[C@@H]([C@H](O)[C@H](O)CO)[C@H](NC(=O)C)[C@@H](O)C[C@]1(C(O)=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(N=C(N)C=C2)=O)O1 TXCIAUNLDRJGJZ-BILDWYJOSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 102000009016 Cholera Toxin Human genes 0.000 description 1
- 108010049048 Cholera Toxin Proteins 0.000 description 1
- 108020004638 Circular DNA Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108700010070 Codon Usage Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 241000224559 Endotrypanum Species 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 241000713297 Influenza C virus Species 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 241000222712 Kinetoplastida Species 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- SQVRNKJHWKZAKO-PFQGKNLYSA-N N-acetyl-beta-neuraminic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-PFQGKNLYSA-N 0.000 description 1
- 208000009277 Neuroectodermal Tumors Diseases 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 101710163504 Phaseolin Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 239000012564 Q sepharose fast flow resin Substances 0.000 description 1
- 239000012614 Q-Sepharose Substances 0.000 description 1
- 108020004518 RNA Probes Proteins 0.000 description 1
- 239000003391 RNA probe Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 229910003798 SPO2 Inorganic materials 0.000 description 1
- 101100434411 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) ADH1 gene Proteins 0.000 description 1
- 101100478210 Schizosaccharomyces pombe (strain 972 / ATCC 24843) spo2 gene Proteins 0.000 description 1
- 102000003800 Selectins Human genes 0.000 description 1
- 108090000184 Selectins Proteins 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical group [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 108700005078 Synthetic Genes Proteins 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical group OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241001442399 Trypanosoma brucei gambiense Species 0.000 description 1
- 241001442397 Trypanosoma brucei rhodesiense Species 0.000 description 1
- 108090000848 Ubiquitin Proteins 0.000 description 1
- 102000044159 Ubiquitin Human genes 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 238000005903 acid hydrolysis reaction Methods 0.000 description 1
- 125000000641 acridinyl group Chemical group C1(=CC=CC2=NC3=CC=CC=C3C=C12)* 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 101150102866 adc1 gene Proteins 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- NIGUVXFURDGQKZ-UQTBNESHSA-N alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc Chemical compound O[C@H]1[C@H](O)[C@H](O)[C@H](C)O[C@H]1O[C@H]1[C@H](O[C@H]2[C@@H]([C@@H](O[C@]3(O[C@H]([C@H](NC(C)=O)[C@@H](O)C3)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O)[C@@H](CO)O2)O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O NIGUVXFURDGQKZ-UQTBNESHSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 229910021529 ammonia Inorganic materials 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000010420 art technique Methods 0.000 description 1
- 230000003376 axonal effect Effects 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Chemical group C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- 102000023732 binding proteins Human genes 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 238000010364 biochemical engineering Methods 0.000 description 1
- 230000008238 biochemical pathway Effects 0.000 description 1
- 230000004791 biological behavior Effects 0.000 description 1
- 239000013060 biological fluid Substances 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000005018 casein Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 238000011210 chromatographic step Methods 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000012411 cloning technique Methods 0.000 description 1
- 238000000975 co-precipitation Methods 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 238000002742 combinatorial mutagenesis Methods 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 238000001816 cooling Methods 0.000 description 1
- 235000020247 cow milk Nutrition 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 102000038379 digestive enzymes Human genes 0.000 description 1
- 108091007734 digestive enzymes Proteins 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000000416 exudates and transudate Anatomy 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 230000009760 functional impairment Effects 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000005017 genetic modification Effects 0.000 description 1
- 235000013617 genetically modified food Nutrition 0.000 description 1
- 125000002791 glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 1
- 150000002337 glycosamines Chemical class 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- BTIJJDXEELBZFS-QDUVMHSLSA-K hemin Chemical compound CC1=C(CCC(O)=O)C(C=C2C(CCC(O)=O)=C(C)\C(N2[Fe](Cl)N23)=C\4)=N\C1=C/C2=C(C)C(C=C)=C3\C=C/1C(C)=C(C=C)C/4=N\1 BTIJJDXEELBZFS-QDUVMHSLSA-K 0.000 description 1
- 229940025294 hemin Drugs 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- LIIALPBMIOVAHH-UHFFFAOYSA-N herniarin Chemical compound C1=CC(=O)OC2=CC(OC)=CC=C21 LIIALPBMIOVAHH-UHFFFAOYSA-N 0.000 description 1
- JHGVLAHJJNKSAW-UHFFFAOYSA-N herniarin Natural products C1CC(=O)OC2=CC(OC)=CC=C21 JHGVLAHJJNKSAW-UHFFFAOYSA-N 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 230000007124 immune defense Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- ZLQJVGSVJRBUNL-UHFFFAOYSA-N methylumbelliferone Natural products C1=C(O)C=C2OC(=O)C(C)=CC2=C1 ZLQJVGSVJRBUNL-UHFFFAOYSA-N 0.000 description 1
- 238000012009 microbiological test Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 230000023105 myelination Effects 0.000 description 1
- 238000001320 near-infrared absorption spectroscopy Methods 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- CERZMXAJYMMUDR-UHFFFAOYSA-N neuraminic acid Natural products NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO CERZMXAJYMMUDR-UHFFFAOYSA-N 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000007530 organic bases Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 235000006408 oxalic acid Nutrition 0.000 description 1
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- LWTDZKXXJRRKDG-UHFFFAOYSA-N phaseollin Natural products C1OC2=CC(O)=CC=C2C2C1C1=CC=C3OC(C)(C)C=CC3=C1O2 LWTDZKXXJRRKDG-UHFFFAOYSA-N 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000004952 protein activity Effects 0.000 description 1
- 238000000164 protein isolation Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 150000003335 secondary amines Chemical class 0.000 description 1
- 230000009450 sialylation Effects 0.000 description 1
- 238000007086 side reaction Methods 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 238000007447 staining method Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 238000001308 synthesis method Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229940118376 tetanus toxin Drugs 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000009210 therapy by ultrasound Methods 0.000 description 1
- 238000004809 thin layer chromatography Methods 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 238000006276 transfer reaction Methods 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
- 229940075420 xanthine Drugs 0.000 description 1
- 235000020138 yakult Nutrition 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/1048—Glycosyltransferases (2.4)
- C12N9/1081—Glycosyltransferases (2.4) transferring other glycosyl groups (2.4.99)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/10—Antimycotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Definitions
- the invention relates to novel enzymes which transfer sialic acids from a donor molecule (e.g. oligosaccharides, polysialic acids, glycosylated proteins, glycosylated peptides, glycosylated lipids (e.g. gangliosides) and other glycosylated low and high molecular weight molecules) to an acceptor molecule (e.g. oligo - and polysaccharides, glycosylated proteins, glycosylated peptides, glycosylated lipids and other glycosylated low and high molecular weight molecules) are transmitted (trans-sialidases).
- the enzymes were isolated from the unicellular Trypanosoma congolense.
- the invention further relates to functional equivalents of these enzymes; the nucleic acid sequences coding for these enzymes and their functional equivalents; Expression constructs and vectors containing these sequences; recombinant microorganisms which carry a coding nucleic acid sequence according to the invention; Process for the recombinant production of enzymes according to the invention; Process for isolating enzymes according to the invention from Trypanosoma congolense; Process for the enzymatic sialization of acceptor molecules using enzymes according to the invention; Effectors of the trans-sialidases according to the invention; the use of nucleic acid sequences, enzymes, effectors or sialyzation products according to the invention for the production of vaccines, medicines, food or nutritional supplements; as well as the agents produced according to the invention itself.
- Trans-sialidases can transfer sialic acids, preferably alpha-2,3-linked sialic acids, from a donor molecule to an acceptor molecule, again forming alpha-2,3-glycosidic bonds, preferably at a ⁇ -terminal galactose residue.
- Neuraminic acid (5-amino-3,5-dideoxy-D-glycero-D-galacto-nonulo-pyranosonic acid) is an amino sugar with a backbone made of nine carbon atoms, which is linked to one by the carboxyl group on carbon atom 2 receives a strongly acidic pK value of 2.2 and is therefore negatively charged under physiological conditions.
- the unsubstituted form is very unstable and does not occur in free form in nature (Schauer, 1982). However, more than 40 natural derivatives of neuraminic acid are now known (Schauer and Kamerling, 1997).
- N-acetylneuraminic acid (Neu ⁇ Ac), the precursor of all glycosidically bound sialic acids (Schauer, 1991) and -Glycolylneuraminic acid (Neu ⁇ Gc), which are obtained by hydroxylation of the methyl group of the ⁇ / -acetyl residue of CMP-Neu5Ac emerges (Shaw and Schauer, 1988).
- the hydroxyl groups of these two sialic acids can be substituted by acetyl, lactyl, methyl, sulfate and phosphate residues in different combinations, which leads to the great structural diversity of sialic acids (Schauer, 1991; Schauer and Kamerling, 1997).
- sialic acids are bound as a component of oligosaccharides, polysaccharides and in particular
- sialic acids protect glycoproteins and cells from attack
- sialic acid-containing mucous membranes of the gastrointestinal tract not only provide effective protection against the digestive enzymes, but also protect the underlying tissue against the penetration of pathogenic bacteria (Keim and Schauer, 1997).
- Sialic acids play a very important role in molecular and cellular recognition processes. They mask receptors and thus prevent interactions between receptors and ligands (Schauer, 1985; Keim and Schauer, 1997). So protect sialic acids e.g. B. serum glycoproteins and erythrocytes prior to degradation and phagocytosis by masking underlying galactose residues. If the terminal sialic acids are split off, the subterminal galactose residues can be bound by lectins on hepatocytes or phagocytes and endocytosis of the serum proteins or erythrocytes occurs. Another example is the protection of the body's own tissues, but also many highly sialylated tumors, before they are recognized by the immune system (Pilatte et al., 1993). If the protective sialic acid layer is lost, autoimmune reactions can occur.
- Sialic acids also serve as recognition sites for the body's own cells and hormones and thus play an important role in cellular interactions (Keim and Schauer, 1997).
- endothelial cells express selectins on their surface that recognize certain sialylated structures (e.g. sialyl-Lewis X) on leukocytes so that they can bind to the endothelial cells and penetrate into the tissue (Lasky, 1995).
- the activation of the T cells of the humoral immune defense is influenced by the action of trans-sialidases (Gao et al., 2001).
- Sialoadhesins such as myelin-associated glycoprotein (MAG) also bind to sialylated glycans in a highly specific manner (Keim et al., 1996; Crocker et al., 1998).
- the myelin-associated glycoprotein is involved in the nervous system, among other things, in myelination and in the regulation of axonal growth. It is therefore not surprising that it has recently been found that trans-sialidases are involved in the differentiation of nerve cells and glial cells through the transfer of sialic acids (Chuenkova et al., 2001).
- CD-22 is another sialic acid binding receptor that occurs on lymphocytes and enables the "conversation" of T and B lymphocytes.
- the Siglecs family now consists of more than 10 representatives characterized by molecular biology.
- sialic acids are not only important in the body's own recognition processes, they are also receptors for some bacteria, viruses and toxins.
- B. the binding of the tetanus toxin to gangliosides of ne ⁇ tensynapses via sialic acids (Schauer et al., 1995).
- Sialic acid-specific adhesion via microbial lectins (Sharon and üs, 1997) is often a critical step in infectious diseases, such as that caused by some E. co / i strains Newborn meningitis or gastric mucosal infections caused by Helicobacter pylo ⁇ .
- Influenza A and B viruses in particular, dock onto the cells to be infected via sialic acid (Schauer, 2000).
- Sialic acids are essential modulators of the biological behavior of tumors (Schauer, 2000).
- Figure 1 shows a comparison of the partial amino acid sequences of the trans-sialidases TS1 and TS2 according to the invention. Identical amino acids in both sequences are marked in dark. The agreement (identity) of the two partial sequences is only about 50%.
- Figure 2 shows the different reaction modes of sialidase, sialyltransferases and trans-sialidases
- Figure 3 shows a comparison of the amino acid sequence of the sialidase from Trypanosoma rangeli (T. r. S), the trans-sialidase from Trypanosoma cruzi (T. er. TS) and the trans-sialidase from Trypanosoma brucei brucei (T. b. Br. TS) with partial sequences of the two trans-sialidases according to the invention from Trypanosoma congolense (T. con. TS1 and T. con. TS2).
- Amino acids that are identical in all sequences are shown in white on a dark gray background.
- Amino acids that are identical in at least 4 of the 5 sequences are printed in black on dark gray, while amino acids that match in at least 3 of the 5 sequences are highlighted with a lighter gray.
- the object of the present invention was to provide novel means by means of which sialic acid-controlled biological or patho-biological processes can be influenced.
- the above task was surprisingly achieved by providing novel enzymes with trans-sialidase activity and the coding sequences thereof from Trypanosoma congolense.
- a first object of the invention relates to polynucleotides which code for proteins with trans-sialidase activity and can be isolated from Trypanosoma congolense, these proteins preferably catalyzing the transfer of sialic acid from a donor to an acceptor molecule.
- Preferred polynucleotides comprise at least one nucleic acid sequence according to SEQ ID NO: 1 or 3, or represent fragments thereof, which comprise at least 15 contiguous nucleotide residues.
- the invention also relates to the complementary polynucleotides and fragments; and the nucleotide sequences derived from these polynucleotides by degenerating the genetic code.
- the invention further relates to oligonucleotides which hybridize with a polynucleotide according to the invention, in particular under stringent conditions.
- the invention also relates to polynucleotides which contain an oligonucleotide as defined above, in particular under stringent ones Conditions, hybridize and code for a gene product from microorganisms of the genus Trypanosoma.
- the invention also relates to polypeptides which are encoded by a polynucleotide which comprises a nucleic acid sequence as defined above; or which have an amino acid sequence which comprises at least 10 contiguous amino acids according to SEQ ID NO: 2 or 4; as well as functional equivalents of which have trans-sialidase activity.
- the invention relates in particular to trans-sialidases or functional equivalents thereof with trans-sialidase activity, characterized by one of the following partial amino acid sequences:
- TDTVAKYSTDGGRTWKREVIIPNGR (items 1 to 25 according to SEQ ID NO: 2)
- FRIPSLVEIDGVLIATFDTRYLRASDSSLI (items 1 to 30 according to SEQ ID NO: 4).
- a preferred trans-sialidase 1 is characterized by at least one of the following characteristics:
- TS2 trans-sialidase 2
- polynucleotides and polypeptides according to the invention described above in particular coding nucleic acid sequences and amino acid sequences, can be derived from the organism Trypanosoma congolense. However, they are also accessible using synthetic, in particular chemical, biochemical, enzymatic, genetic engineering and transgenic methods.
- the invention further relates to functional equivalents of trans-sialidases according to the invention.
- the invention furthermore relates to expression cassettes comprising, in operative linkage with at least one regulatory nucleic acid sequence, a nucleic acid sequence as defined above. Furthermore, the invention also includes recombinant vectors containing at least one of these expression cassettes.
- the invention also relates to prokaryotic or eukaryotic hosts transformed with at least one vector as defined above.
- the invention further relates to the use of an expression cassette, a vector or a host as defined above for the recombinant production of a protein with trans-sialidase activity.
- the invention also relates to a method for the enzymatic sialization of an acceptor molecule, characterized in that the acceptor molecule is incubated with a donor containing sialic acid residues in the presence of a trans-sialidase as defined above and the sialylated acceptor is isolated.
- Such processes are characterized by at least one further of the following properties: a) the donor is selected from sialic acids bound to oligosaccharides, polysaccharides, polysialic acids, glycoproteins and glycolipids, such as in particular lactoferrins, glycolized whey proteins and caseins and fragments thereof; b) the acceptor is selected from ß-galactose-containing polymers, such as ß-galactooligosaccharides, lactitol, lactobionic acid, methyl-ß-lactoside, acetyllactosamines, galactopyranosides, trans-galactooligosaccharides, polygalactose and other glycoconjugates (end-bonded) or ugly bound ß (1-4) -galactose; or galactose.
- ß-galactose-containing polymers such as ß-galactooligosaccharides, lactitol, lactobionic
- Another aspect of the present invention relates to the use of a trans-sialidase according to the invention, a nucleic acid sequence coding therefor, or a sialization product produced according to the invention for the manufacture of a medicament, food or food supplement or a food additive for the prevention or treatment of sialic acid-controlled parasitic, bacterial or viral infections; for the treatment of tumor diseases; to treat diseases associated with a developmental disorder of the tissue; for the treatment of diseases of the immune system; for the treatment of autoimmune reactions; for the treatment of diseases with impaired cell communication; and / or to treat inflammation.
- the invention relates to the use of a trans-sialidase according to the invention as defined above, for the development of a trypanosomiasis vaccine or for the development of enzyme inhibitors for the treatment or prevention of trypanosoma infections.
- the invention further relates to the use of a trans-sialidase, a nucleic acid sequence coding therefor or a sialylated product produced according to the invention for the manufacture of a medicament, nutritional supplement or food for protecting the body's own cells or tissues or glycoproteins from enzymatic action.
- the invention furthermore relates to the use of a trans-sialidase, a nucleic acid sequence coding therefor or a sialylated product produced according to the invention for the manufacture of a medicament,
- Dietary supplement or food for influencing the development and / or morphogenesis of body tissues Dietary supplement or food for influencing the development and / or morphogenesis of body tissues.
- the invention further relates to effectors of the trans-sialidase activity of a trans-sialidase, selected from a) polypeptide ligands which interact with a trans-sialidase as defined above; b) low molecular weight effectors which modulate the biological activity of a trans-sialidase as defined above; and c) antisense nucleic acid sequences to form a nucleic acid sequence as defined above.
- the invention relates to the use of such an effector for the manufacture of a medicament, dietary supplement or food for the treatment or prevention of diseases associated with trans-sialidase activity.
- the invention further relates to a process for isolating an enzyme with trans-sialidase activity, wherein a) Trypanosoma congolense is cultivated in a medium, and b) the desired product from the culture supernatant is obtained by ion exchange chromatography using a salt gradient, optionally followed by isoelectric focusing , Gel filtration, affinity chromatography and / or protein precipitation, isolated.
- the invention relates to pharmaceutical or gene therapy agents containing in a pharmaceutically or gene therapy-compatible carrier at least one effector as defined above
- the significance of the present invention results from the influence of the sialic acid-controlled parasitic, bacterial and viral infection mechanisms which is now possible with this invention, the influence on cell communication and the immune system and the change in the regulation and development mechanisms of human and animal tissue and of tumors. This is achieved by the targeted transfer of sialic acids to biologically relevant glycostructures (glycans, glycan derivatives and glycoconjugates) using the trans-sialidases described here.
- sialic acids results, for example, in products for changing inflammatory reactions, changing cellular interactions in the human and animal body, protecting the body's own tissues against attacks by the patient's own immune system (autoimmune reactions), and "unmasking" cancer cells in a patient's body so that they to be fought again by the body's immune system (cancer therapy and cancer prevention), combating the penetration of pathogenic bacteria into the human and animal body, preventing and combating viral infections, combating gastric mucosal infections by Helicobacter py / ori, combating newborn meningitis caused by bacteria and viruses, preventive and therapeutic influence of Receptors of eukaryotic and prokaryotic pathogenic organisms, bacteria, viruses and toxins to prevent their development in the human and animal body, inhibition of the binding of cholera toxin to human and animal mucous membranes of the digestive tract, development of a vaccine against trypanosomiasis, development of enzyme inhibitors to combat ( Therapy) of Trypanosoma infections, influencing molecular
- trans-sialidases according to the invention are characterized by the following partial DNA and amino acid sequences as well as by other DNA sequence homologues, e.g. characterized with a more than 60 percent agreement (identity) to these partial sequences.
- Partial amino acid sequence of the enzyme TS1 (SEQ ID NO: 2): TDTVAKYSTDGGRTWKREVIIPNGRVDAHYSRWDPTWAKGNNIYVLVGRYNVTR GYWHNRNNKAGIADWEPFVYKGTVNVGTKGNATDVSISWERTALKSLYNFPVSGS PGTQFLGGAGGGWTSNGTIVLPVQARNKANRWSMILYSADDGKSWHFGKGEA GVGTSEAALTEWDGKLLISARSDGGQGYRMIFESSDLGATWKEMLNSISRVIGNSP GRSGPGSSSGFITVTVEGVPVMLITHPKNLKGSYYRDRLQLWMTDGNRMWHVGQ VSEGDDNSAYSSLLYTPDGVLYCLHEQNIDEVYSLHLVRLVDELKSIKSTALVWKAQ DELLLGNCLPGDKYDPGCDGIPTAGLAGLLVGPLTEKTWPDAYRCVNAATSGAVST AEGVRLDVGGGGHWWPVSEQGQDQ
- DNA subsequence of the enzyme TS2 (SEQ ID NO: 3): ⁇ 'TTCCGAATTCCCTCACTTGTTGAGATAGACGGCGTGCTTATCGCGACATTCGA TACACGTTATCTTCGCGCTTCCGACAGCAGTCTCATAGACACAGCTATGAAATA CAGTGCCGATCAGGGGAAGACGTGGAAAACTGAAATCATAATAAAAAATGCTAG ACTAACTGATAACTTTTCCCGCGTCGTTGATCCAACGGTTGTTGTTAAGGGTGA TAACTTGTTTATTTTTGTTGGGAGGTACAACACCTCATCTGCCCCATGGGTCTG GCAGGAAAACGGTAAAGACTGGGATGTACTGTTGTACAAGGCCAAGGTGAGGA AGGAATCAGCGGGTGGGGTACCATCAGTGAGCTTTACATGGGACGAACCCCTA TACCTGAAGCATCTGCTCACCTCTGTCGGTAAAATAGACGGCAGGTCCCTCATA CAATACATTGGTGGCGTTGGAAATGGTATTGTAACACCGA
- Table 1 Basic data of the two trans-sialidases TS1 and TS2
- the two substances claimed here are two enzymes that transfer sialic acids from a donor molecule to an acceptor molecule.
- Both enzymes act as donors to glycans, e.g. B. to oligosaccharides, polysaccharides, polysialic acids, glycoproteins and glycolipids, bound sialic acids.
- the glycoproteins include lactoferrins (from humans, cows, goats, sheep, horses, camels and other animals), glycolized whey proteins (from humans, cows, goats, sheep, horses, camels and other animals) and caseins (from humans, cows) , Goat, sheep, horse, camel and other animals) as well as other glycolized proteins of human, animal and vegetable origin as well as parts thereof, e.g. B.
- Both trans-sialidases have a good acceptor specificity for galactooligosaccharides, in particular for beta-galacto-oligosaccharides, such as e.g. B. Vivinal GOS from Borculo Domo Ingredients (BDI) and Oligomate 55 from Yak ⁇ lt.
- lactitol, lactobionic acid, methyl- ⁇ -lactoside, acetyllactosamine, galactopyranoside, trans-galactooligosaccharide, polygalactose and other glycoconjugates with terminally bound ⁇ (1-3) or ⁇ (1-4) galactose can act as acceptors.
- Methylation of the galactose residue leads to a decrease in the acceptor function.
- the methylation of a glucose residue (e.g. in the case of lactose) has little influence on the Acceptor.
- the monosaccharide galactose also serves as an acceptor, albeit with less specificity.
- the TS1 enzyme shows an approximately twice as efficient transfer of the sialic acids to the corresponding acceptors as the TS2 enzyme.
- the substrates can be free, i.e. soluble or cell membrane bound.
- alpha-2,3-linked terminal sialic acids to beta-1,4-linked terminal galactose residues is also from the trans-sialidases of Typanosoma cruzi (Schenkman et al., 1991; Vandekerckhove et al., 1992; Scudder et al ., 1993) and Trypanosoma brucei (Engstier et al., 1992, 1993, 1995).
- TSI and TS2 differ from the already known enzymes.
- TS1 and TS2 are thus clearly characterized as new substances (trans-sialidases). See the next paragraph for further delimitation.
- trans-sialidase was first described in the American trypanosome species Trypanosoma cruz (Schenkmann et al., 1991). A little later, the enzyme was also detected in the African species Trypanosoma brucei gambiense, Trypanosoma brucei rhodesiense and Trypanosoma brucei brucei (Engstier et al., 1993, Pontes de Carvalho et al., 1993, Engstier et al., 1995).
- trans-sialidase was found in endotrypanum species (parasites that attack the sloth) (Medina-Acosta et al., 1994 ), in Corynebacterium diphtheriae (Mattos-Guaraldi et al., 1998) and in human plasma (Tertov et al. 2001), so-called sialidases were known long before the detection of trans-sialidases, which are glycohydrolases, the sialic acids of transfer a donor molecule exclusively to water, which means that the sialic acids hydrolyze from oligosaccharides and glycoconjugates.
- CMP cytidine monophosphate
- the trans-sialidases claimed here do not only transfer sialic acids from a donor molecule to water, as do pure sialidases. However, if a suitable acceptor is missing, the trans-sialidases claimed here hydrolyze the sialic acids as well as the simple sialidases. The trans-sialidases claimed here also do not require activated sialic acids for their transfer reaction like the previously mentioned sialyltransferases. The trans-sialidases also have a broader donor and acceptor specificity than the sialyltransferases and are therefore particularly versatile. The trans-sialidases claimed here are therefore more advantageous for industrial use than the pure sialidases and sialyltransferases.
- the enzyme TS1 claimed here has an agreement (identity) of less than 60% for the corresponding partial amino acid sequence of the trans-sialidase from Trypanosoma brucei brucei and an agreement of less than 50% for the corresponding partial sequence of Trypanosoma cruzi.
- the enzyme TS2 claimed here has an agreement (identity) of less than 50% for the corresponding partial amino acid sequence of the trans-sialidase from Trypanosoma brucei brucei and an agreement of less than 50% for the corresponding partial sequence of Trypanosoma cruzi (see Figure 3). Furthermore, it is known that the amino acid correspondence between the trans-sialidases of trypanosomes and the known sialidases and trans-sialidases of bacteria and viruses is only 20% to 30% (Chuenkova et al., 1999, Montagna et al., 2002 ).
- enzymes described here are thus newly characterized substances (enzymes), whose agreement (identity) with the corresponding DNA and amino acid sequences of other known enzymes of similar function are below 60%.
- Polypeptides in the sense of the invention comprise characteristic partial fragments of the amino acid sequences according to the invention, as well as amino acid sequences of the enzymes according to the invention and the functional equivalents thereof.
- “Functional equivalents” or analogs of the specifically disclosed polypeptides are, within the scope of the present invention, different polypeptides which furthermore have the desired biological activity as defined above (such as substrate specificity).
- “functional equivalents” are understood to mean, in particular, mutants which, in at least one of the sequence positions mentioned above, have a different amino acid than the one specifically mentioned, but nevertheless have one of the biological activities mentioned here.
- “Functional equivalents” thus include the mutants obtainable by one or more amino acid additions, substituents, deletions and / or inversions, the changes mentioned being able to occur in any sequence position as long as they lead to a mutant with the property profile according to the invention.
- Functional equivalence is particularly given when the reactivity patterns between mutant and unchanged polypeptide match qualitatively, ie, for example, the same substrates are implemented at different speeds.
- Salts means both salts of carboxyl groups and acid addition salts of amino groups of the protein molecules according to the invention.
- Salts of carboxyl groups can be prepared in a manner known per se and include inorganic salts, such as, for example, sodium, calcium, ammonium, iron and zinc salts, and salts with organic bases, such as, for example, amines, such as triethanolamine, arginine, lysine , Piperidine and the like.
- Acid addition salts such as, for example, salts with mineral acids, such as hydrochloric acid or sulfuric acid, and salts with organic acids, such as acetic acid and oxalic acid, are also a subject of the invention.
- “Functional derivatives” of polypeptides according to the invention can also be prepared on functional amino acid side groups or on their N- or C-terminal end using known techniques.
- Such derivatives include, for example, aliphatic esters of carboxylic acid groups, amides of carboxylic acid groups, obtainable by reaction with ammonia or with a primary or secondary amine; N-acyl derivatives of free amino groups, produced by reaction with acyl groups; or O-acyl derivatives of free hydroxyl groups, produced by reaction with acyl groups.
- “Functional equivalents” naturally also include polypeptides that are accessible from other organisms as well as naturally occurring variants. For example, regions of homologous sequence regions can be determined by sequence comparison and, based on the specific requirements of the invention, equivalent enzymes can be determined.
- “Functional equivalents” also include fragments, preferably individual domains or sequence motifs, of the polypeptides according to the invention which, for example, have the desired biological function.
- “Functional equivalents” are also fusion proteins which have one of the abovementioned polypeptide sequences or functional equivalents derived therefrom and at least one further, functionally different, heterologous sequence in functional N- or C-terminal linkage (ie without mutual substantial functional impairment of the fusion protein parts)
- Non-limiting examples of such heterologous sequences are, for example, signal peptides, enzymes, immunoglobulins, surface antigens, receptors or receptor ligands.
- “Functional equivalents” of trans-sialidases according to the invention are in particular enzymes whose amino acid sequences or partial sequences to the corresponding amino acid sequence or partial sequence according to SEQ ID NO: 2 or 4 have a sequence identity (sequence homology) of at least 60%, in particular at least 65% or at least 70%, such as e.g. 75%, 80%, 85%, 90%, 95%, 98% or 99%, calculated according to the algorithm of Pearson and Lipman, Proc. Natl. Acad, Sei. (USA) 85 (8), 1988, 2444 -2448.
- equivalents according to the invention include proteins of the above-mentioned type in deglycosy healer or glycosylated form and also modified forms obtainable by changing the glycosylation pattern.
- homologs of the proteins or polypeptides of the invention can be generated by mutagenesis, e.g. by point mutation, lengthening or shortening of the protein.
- the term "homolog” as used herein also refers to a variant form of the protein that acts as an agonist or antagonist of protein activity.
- Homologs of the proteins according to the invention can be identified by screening combinatorial banks of mutants, such as, for example, shortening mutants.
- a varied bank of protein variants can be generated by combinatorial mutagenesis at the nucleic acid level, such as, for example, by enzymatic ligation of a mixture of synthetic oligonucleotides. It are a variety of methods that can be used to generate banks of potential homologs from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automated DNA synthesizer, and the synthetic gene can then be ligated into an appropriate expression vector.
- degenerate set of genes makes it possible to provide all the sequences in a mixture which encode the desired set of potential protein sequences.
- Methods for the synthesis of degenerate oligonucleotides are known to the person skilled in the art (eg Narang, SA (1983) Tetrahedron 39: 3; Itakura et al. (1984) Annu. Rev. Biochem. 53: 323; Itakura et al., (1984) Science 198: 1056; Ike et al. (1983) Nucleic Acids Res. 11: 477).
- Polynucleotides in the sense of the present invention comprise characteristic partial fragments of the nucleic acid sequences according to the invention which code for partial amino acid sequences of enzymes according to the invention, as well as nucleic acid sequences which code for enzymes and their functional equivalents. Polynucleotides preferably comprise more than about 20, in particular more than about 30, for example more than about 45 or more than about 60 nucleic acid residues.
- Oligonucleotides in particular comprise a sequence of less than about 60, preferably less than about 45, in particular less than about 30 or less than about 20 nucleic acid residues.
- nucleic acid sequences are, in a manner known per se, by chemical synthesis from the nucleotide building blocks, such as, for example, by fragment condensation of individual overlapping, complementary ones
- Nucleic acid building blocks of the double helix can be produced.
- the chemical synthesis of oligonucleotides can be carried out, for example, in a known manner using the phosphoamidite method (Voet, Voet, 2nd edition, Wiley Press New York, pages 896-897).
- the attachment of synthetic oligonucleotides and filling of Gaps using the Klenow fragment of DNA polymerase and ligation reactions as well as general cloning methods are described in Sambrook et al. (1989) Molecular Cloning: A laboratory manual, Cold Spring Harbor Laboratory Press.
- the invention also relates to nucleic acid sequences (single and double-stranded DNA and RNA sequences, such as cDNA and mRNA) coding for one of the above polypeptides and their functional equivalents, which e.g. are also accessible using artificial nucleotide analogs.
- the invention relates both to isolated nucleic acid molecules which code for polypeptides or proteins or biologically active sections thereof, and to nucleic acid fragments which e.g. can be used for use as hybridization probes or primers for identifying or amplifying coding nucleic acids according to the invention.
- nucleic acid molecules according to the invention can also contain untranslated sequences from the 3 'and / or 5' end of the coding gene region
- nucleic acid molecule is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid and, moreover, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or free of chemical precursors or other chemicals be when it's chemically synthesized.
- a nucleic acid molecule according to the invention can be isolated using standard molecular biological techniques and the sequence information provided according to the invention.
- cDNA can be isolated from a suitable cDNA library by using one of the specifically disclosed complete sequences or a portion thereof as a hybridization probe and standard hybridization techniques (as described, for example, in Sambrook, J., Fritsch, EF and Maniatis, T. Molecular Cloning: A Laboratory Manual. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).
- a nucleic acid molecule comprising one of the disclosed sequences or a portion thereof can be isolated by polymerase chain reaction using the oligonucleotide primers which have been created on the basis of this sequence.
- the nucleic acid amplified in this way can be cloned into a suitable vector and characterized by DNA sequence analysis.
- the oligonucleotides according to the invention can also be produced by standard synthesis methods, for example using an automatic DNA synthesizer.
- the invention further comprises the nucleic acid molecules "complementary" to the specifically described nucleotide sequences or a section thereof.
- the nucleotide sequences according to the invention enable the generation of probes and primers which can be used for the identification and / or cloning of homologous sequences in other cell types and organisms.
- probes or primers usually comprise a nucleotide sequence region which, under stringent conditions, can be attached to at least about 12, preferably at least about 25, e.g. about 40, 50 or 75 successive nucleotides of a sense strand of a nucleic acid sequence according to the invention or a corresponding antisense strand are hybridized.
- nucleic acid sequences according to the invention are derived from SEQ ID NO: 1 and 3 and differ from them by addition, substitution, insertion or deletion of one or more nucleotides, but continue to code for polypeptides with the desired property profile.
- nucleic acid sequences which comprise so-called silent mutations or which correspond to the codon usage of a specific source or host organism compared to a specific one mentioned sequence are changed, as well as naturally occurring variants, such as splice variants or allele variants thereof.
- the subject matter is also obtainable by conservative nucleotide substitutions (ie the amino acid in question is replaced by an amino acid of the same charge, size, polarity and / or solubility).
- the invention also relates to the molecules derived from the specifically disclosed nucleic acids by sequence polymorphisms. These genetic polymorphisms can exist between individuals within a population due to natural variation. These natural variations usually cause a 1 to 5% variance in the nucleotide sequence of a gene.
- the invention also encompasses nucleic acid sequences which hybridize with the above-mentioned coding sequences or are complementary thereto.
- These polynucleotides can be found when screening genomic or cDNA banks and, if appropriate, can be multiplied therefrom with suitable primers by means of PCR and then isolated, for example, with suitable probes.
- Another possibility offers the transformation of suitable microorganisms with polynucleotides or vectors according to the invention, the multiplication of the microorganisms and thus the polynucleotides and their subsequent isolation.
- polynucleotides according to the invention can also be synthesized chemically.
- the property of being able to “hybridize” to polynucleotides means the ability of a poly- or oligonucleotide to bind to an almost complementary sequence under stringent conditions, while under these conditions non-specific bindings between non-complementary partners are avoided.
- the sequences should be closed 70-100%, preferably 90-100%, are complementary
- the property of complementary sequences to be able to bind specifically to one another is demonstrated, for example, in the Northern or Southern blot technique or in primer binding in PCR or RT-PCR Usually, oligonucleotides with a length of 30 base pairs or more are used for this.
- “Stringent” conditions are understood to mean, for example, after the Southern or Northern blot, the DNA or RNA fragments on the membranes with a probe under specific conditions, that is, at a temperature of 60-70 ° C (38-42 ° C hybridizes with 50% hybridization solutions containing 50% formamide). Furthermore, the conditions are specific or stringent if the washing steps carried out after the hybridization for the elution of unspecifically hybridized DNA or RNA probes are also carried out specifically. Specific washing steps usually involve washing twice at 20-25 ° C for 5-10min. with 2 x SSC buffer containing 0.1% SDS (sodium dodecyl sulfate) and then washing twice with buffer of lower ionic strength (e.g.
- antisense nucleic acids comprise a nucleotide sequence that is complementary to a coding "sense" nucleic acid.
- the antisense nucleic acid can be complementary to the entire coding strand or only to a portion thereof "In another embodiment, the antisense nucleic acid molecule is antisense to a non-coding region of the coding strand of a nucleotide sequence.
- non-coding region relates to the sequence segments referred to as 5 'and 3' untranslated regions.
- An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length.
- An antisense nucleic acid of the invention can be constructed by chemical synthesis and enzymatic ligation reactions using methods known in the art.
- An antisense nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides are used which are designed in such a way that they increase the biological stability of the molecules or increase the physical stability of the duplex which has formed between the antisense and sense nucleic acids. For example, phosphorothioate derivatives and acridine substituted nucleotides can be used.
- modified nucleotides that can be used to generate the antisense nucleic acid include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-ioduracil, hypoxanthine, xanthine, 4-acetylcytosine, and the like.
- the antisense nucleic acid molecules according to the invention are usually administered to a cell or generated in situ so that they hybridize with or bind to the cellular mRNA and / or a coding DNA so that the expression of the protein, e.g. by inhibiting transcription and / or translation.
- the terms “express” or “amplification” or “overexpression” describe the production or increase in the intracellular activity of one or more enzymes in a microorganism that are encoded by the corresponding DNA introduce an organism, replace an existing gene with another gene, increase the number of copies of the gene or genes, use a strong promoter or use a gene which codes for a corresponding enzyme with a high activity and these measures can be combined if necessary.
- weaken and “decrease” in the context of the invention describe the weakening or reduction of the intracellular activity of one or more enzymes in a microorganism which are encoded by the corresponding DNA. This can be done, for example, by deleting a gene in an organism, replacing an existing gene with another gene, reducing the copy number of a transcript of the gene or genes, using a weak promoter or using a gene which is suitable for a corresponding enzyme with a encodes lower activity and you can combine these measures if necessary.
- the invention also relates to expression constructs containing, under the genetic control of regulatory nucleic acid sequences, a nucleic acid sequence coding for a polypeptide according to the invention; and vectors comprising at least one of these expression constructs.
- Such constructs according to the invention preferably comprise a promoter 5'-upstream of the respective coding sequence and a terminator sequence 3'-downstream and optionally further customary regulatory elements, in each case operatively linked to the coding sequence.
- operative linkage is understood to mean the sequential arrangement of promoter, coding sequence, terminator and, if appropriate, further regulatory elements in such a way that each of the regulatory elements can perform its function as intended when expressing the coding sequence.
- sequences which can be linked operatively are targeting Sequences, as well as enhancers, polyadenylation signals and the like.
- Further regulatory elements include selectable markers, amplification signals, origins of replication and the like. Suitable regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
- the natural regulatory sequence can still be present before the actual structural gene. This natural regulation can possibly be switched off by genetic modification and the expression of the genes increased or decreased.
- the gene construct can also have a simpler structure, ie no additional regulation signals are inserted in front of the structural gene and the natural promoter with its regulation is not removed. Instead, the natural Regulation sequence mutated so that regulation no longer takes place and gene expression is increased or decreased.
- the nucleic acid sequences can be contained in one or more copies in the gene construct.
- Examples of useful promoters are: cos, tac, trp, tet, trp-tet, Ipp, lac, Ipp-lac, laclq, T7, T5, T3, gal, trc -, ara-, SP6-, lambda-PR or in the lambda-PL promoter, which are advantageously used in gram-negative bacteria; as well as the gram-positive promoters amy and SPO2, the yeast promoters ADC1, MFalpha, AC, P-60, CYC1, GAPDH or the plant promoters CaMV / 35S, SSU, OCS, Iib4, usp, STLS1, B33, not or the ubiquitin or phaseolin promoter.
- inducible promoters such as, for example, light-inducible and in particular temperature-inducible promoters, such as the P r P ⁇ promoter
- inducible promoters such as, for example, light-inducible and in particular temperature-inducible promoters, such as the P r P ⁇ promoter
- all natural promoters with their regulatory sequences can be used.
- synthetic promoters can also be used advantageously.
- the regulatory sequences mentioned are intended to enable the targeted expression of the nucleic acid sequences and the protein expression. Depending on the host organism, this can mean, for example, that the gene is only expressed or overexpressed after induction, or that it is expressed and / or overexpressed immediately.
- the regulatory sequences or factors can preferably have a positive influence on the expression and thereby increase or decrease it.
- the regulatory elements can advantageously be strengthened at the transcription level by using strong transcription signals such as promoters and / or "enhancers".
- an increase in translation is also possible, for example, by improving the stability of the mRNA.
- An expression cassette is produced by fusing a suitable promoter with a suitable coding nucleotide sequence and a Terminator or polyadenylation signal.
- Common recombination and cloning techniques are used, such as those described in T. Maniatis, EF Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) and TJ Silhavy, ML Berman and LW Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) and in Ausubel, FM et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley Interscience (1987).
- the recombinant nucleic acid construct or gene construct is advantageously inserted into a host-specific vector which enables optimal expression of the genes in the host.
- Vectors are well known to those skilled in the art and can be found, for example, in “Cloning Vectors” (Pouwels P.H. et al., Ed., Elsevier, Amsterdam-New York-Oxford, 1985).
- vectors are also understood to mean all other vectors known to the person skilled in the art, such as phages, viruses such as SV40, CMV, baculovirus and Aden ⁇ virus, transposons, IS elements, phasmids, cosmids, and linear or circular DNA. These vectors can be replicated autonomously in the host organism or replicated chromosomally.
- fusion expression vectors such as pGEX (Pharmacia Biotech Ine; Smith, DB and Johnson, KS (1988) Gene 67: 31-40), pMAL (New England Biolabs, Beverly, MA) and pRIT 5 (Pharmacia, Piscataway, NJ) which glutathione-S-transferase (GST), maltose E-binding protein or protein A is fused to the recombinant target protein.
- GST glutathione-S-transferase
- Non-fusion protein expression vectors such as pTrc (Amann et al., (1988) Gene 69: 301-315) and pET 11d (Studier et al. Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, California (1990) 60-89).
- Yeast expression vector for expression in the yeast S. cerevisiae such as pYepSed (Baldari et al., (1987) Embo J. 6: 229-234), pMFa (Kurjan and Herskowitz (1982) Cell 30: 933-943), pJRY88 (Schultz et al.
- Vectors and methods of constructing vectors suitable for use in other fungi such as filamentous fungi include those described in detail in: van den Hondel, CAMJJ & Punt, PJ (1991) "Gene transfer Systems and vector development for filamentous fungi, in: Applied Molecular Genetics of Fungi, JF Peberdy et al., ed., pp. 1-28, Cambridge University Press: Cambridge.
- Baculovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith et al., (1983) Mol. Cell Bio 3: 2156-2165) and the pVL- Series (Lucklow and Summers (1989) Virology 170: 31-39).
- Plant expression vectors such as those described in detail in: Becker, D., Kemper, E., Schell, J. and Masterson, R. (1992) "New plant binary vectors with selectable markers located proximal to the left border” , Plant Mol. Biol. 20: 1195-1197; and Bevan, M.W. (1984) "Binary Agrobacterium vectors for plant transformation", Nucl. Acids Res. 12: 8711-8721.
- Mammalian expression vectors such as pCDM8 (Seed, B. (1987) Nature 329: 840) and pMT2PC (Kaufman et al. (1987) EMBO J. 6: 187-195).
- Recombinant microorganisms With the aid of the vectors according to the invention, recombinant microorganisms can be produced which, for example, have been transformed with at least one vector according to the invention and can be used to produce the polypeptides according to the invention.
- the recombinant constructs according to the invention described above are advantageously introduced and expressed in a suitable host system. Common cloning and transfection methods known to the person skilled in the art, such as, for example, coprecipitation, protoplast fusion, electroporation, retroviral transfection and the like, are preferably used in order to bring the nucleic acids mentioned into expression in the respective expression system. Suitable systems are described, for example, in Current Protocols in Molecular Biology, F.
- homologously recombined microorganisms can also be produced.
- a vector is produced which contains at least a section of a gene or a coding sequence according to the invention, in which, if appropriate, at least one amino acid deletion, addition or substitution has been introduced in order to change the sequence according to the invention, for example to functionally disrupt it.
- the introduced sequence can, for example, also be a homolog from a related microorganism or can be derived from a mammalian, yeast or insect source, or the vector used for homologous recombination can alternatively be designed in such a way that the endogenous gene mutates during homologous recombination or is otherwise altered, but still encodes the functional protein (for example, the upstream regulatory region can be altered in such a way that it changes the expression of the endogenous protein).
- the altered section of the gene according to the invention is in the homologous recombination vector tion of suitable vectors for homologous recombination is described, for example, in Thomas, KR and Capecchi, MR (1987) Cell 51: 503.
- all organisms which enable expression of the nucleic acids according to the invention, their allele variants, their functional equivalents or derivatives are suitable as host organisms.
- Host organisms are, for example, bacteria, fungi, yeasts, plant or animal cells.
- Preferred organisms are bacteria, such as those of the genera Escherichia, such as. B.
- Escherichia coli Streptomyces, Bacillus or Pseudomonas, eukaryotic microorganisms such as Saccharomyces cerevisiae, Aspergillus, higher eukaryotic cells from animals or plants, for example Sf9 or CHO cells.
- Successfully transformed organisms can be selected using marker genes, which are also contained in the vector or in the expression cassette.
- marker genes are genes for antibiotic resistance and for enzymes which catalyze a coloring reaction which stains the transformed cell. These can then be selected using automatic cell sorting.
- Microorganisms successfully transformed with a vector and carrying an appropriate antibiotic resistance gene e.g. G418 or hygromycin
- an appropriate antibiotic resistance gene e.g. G418 or hygromycin
- Marker proteins that are presented on the cell surface can be used for selection by means of affinity chromatography.
- the combination of the host organisms and the vectors which match the organisms, such as plasmids, viruses or phages, such as, for example, plasmids with the RNA polymerase / promoter system, phages 8 or 7 or other temperate phages or transposons and / or further advantageous regulatory ones Sequences form an expression system.
- expression system means the combination of mammalian cells, such as CHO cells, and vectors, such as pcDNA3neo vector, which are suitable for mammalian cells.
- the gene product can also be expressed in transgenic organisms, such as transgenic animals, in particular mice, sheep or transgenic plants.
- transgenic organisms such as transgenic animals, in particular mice, sheep or transgenic plants.
- the invention further relates to processes for the recombinant production of a polypeptide according to the invention or functional, biologically active fragments thereof, wherein a polypeptide-producing microorganism is cultivated, where appropriate inducing the expression of the polypeptides and isolating them from the culture.
- the polypeptides can thus also be produced on an industrial scale, if this is desired.
- the recombinant microorganism can be cultivated and fermented by known methods. Bacteria can be propagated, for example, in TB or LB medium and at a temperature of 20 to 40 ° C and a pH of 6 to 9. Suitable cultivation conditions are described in detail, for example, in T. Maniatis, E.F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989).
- the cells are then disrupted and the product is obtained from the lysate by known protein isolation methods.
- the cells can optionally be operated by high-frequency ultrasound, by high pressure, e.g. in a French pressure cell, by osmolysis, by the action of detergents, lytic enzymes or organic solvents, by homogenizers or by a combination of several of the processes listed.
- Purification of the polypeptides can be achieved with known chromatographic methods, such as molecular sieve chromatography (gel filtration), such as Q-Sepharose chromatography, ion exchange chromatography and hydrophobic chromatography, and with other customary methods such as ultrafiltration, crystallization, salting out, dialysis and native gel electrophoresis.
- chromatographic methods such as molecular sieve chromatography (gel filtration), such as Q-Sepharose chromatography, ion exchange chromatography and hydrophobic chromatography, and with other customary methods such as ultrafiltration, crystallization, salting out, dialysis and native gel electrophoresis.
- Suitable processes are described, for example, in Cooper, FG, Biochemical Working Methods, Verlag Walter de Gruyter, Berlin, New York or in Scopes, R., Protein Purification, Springer Verlag, New York, Heidelberg, Berlin. The same applies to non-recombinantly produced polypeptides.
- Encode fusion proteins e.g. serve easier cleaning.
- suitable modifications are, for example, what are known as anchors
- Tags such as the modification known as hexa-histidine anchor or epitopes which can be recognized as antigens of antibodies (described for example in
- Carriers such as a polymer matrix, which are used, for example, in a
- Chromatography column can be filled, or can be used on a microtiter plate or on another support.
- these anchors can also be used to recognize the proteins.
- customary markers such as fluorescent dyes, enzyme markers which form a detectable reaction product after reaction with a substrate, or radioactive markers, alone or in combination with the anchors, can be used to derivatize the proteins.
- the desired product can be obtained from the microorganism or from the culture supernatant by various methods known in the art. If the desired product is not secreted by the cells, the cells can be harvested from the culture by slow centrifugation, the cells can be lysed by standard techniques such as mechanical force or ultrasound treatment. The cell debris is removed by centrifugation and the supernatant fraction containing the soluble proteins is obtained for further purification of the desired compound. Is the product of When the cells are secreted, the cells are removed from the culture by slow centrifugation and the supernatant fraction is retained for further purification.
- the supernatant fraction from both purification processes can be subjected to chromatography with a suitable resin, with the desired molecule either being retained on the chromatography resin or passing through it with higher selectivity than the impurities. These chromatography steps can be repeated if necessary using the same or different chromatography resins.
- the person skilled in the art is skilled in the selection of the suitable chromatography resins and their most effective application for a particular molecule to be purified.
- the purified product can be concentrated by filtration or ultrafiltration and kept at a temperature at which the stability of the product is maximum.
- the identity and purity of the isolated compounds can be determined by prior art techniques. These include high performance
- cloning steps carried out in the context of the present invention e.g. Restriction cleavages, agarose gel electrophoresis, purification of DNA fragments, transfer of nucleic acids to nitrocellulose and nylon membranes, linking of DNA fragments, transformation of cells, cultivation of bacteria, multiplication of phages and sequence analysis of recombinant DNA were carried out as in Sambrook et al. (1989) op. Cit. described.
- Example 1 Isolation of the enzymes from cultures of Trypanosoma congolense
- the procyclic forms of Trypanosoma congolense (deposited with the Swiss Tropical Institute Basel (STIB) as strain no. 249) can be grown at 27 ° C without CO 2 in SM / SDM 79 medium, which contains 10% fetal calf serum and hemin. After three to four days, the cell number has increased from 1x10 6 to approx. 7x10 6 / ml and the culture supernatant is separated off by centrifugation, filtered and concentrated by ultrafiltration. 84% of the enzyme activity can be determined in the culture supernatant obtained in this way, while 16% of the enzyme activity can still be detected bound to the cell pellet. The concentrated culture supernatants are used directly as enzyme concentrate for the trans-sialidase reactions. The desired sialised molecules are isolated from the culture supernatant after the reaction.
- Example 2 Purification of the enzymes To isolate pure enzymes, the concentrated culture supernatant is placed on an ion exchange column (Q Sepharose). After washing, the column is eluted with a salt gradient. TS2 elutes with a salt concentration up to 0.2M, TS1 with a salt gradient from 0.2M. After elution, the two enzymes are purified separately by means of isoelectric focusing, gel filtration (Sephades G150 SF), affinity chromatography or protein precipitation until apparent homogeneity.
- Q Sepharose ion exchange column
- the sialylated product is eluted with 1 N HCl (700 ⁇ l).
- the sample is neutralized with 250-290 ⁇ l 2N NaOH and 300 ⁇ l 1M glycine / NaOH buffer pH 10.0.
- the fluorescence of the released methylumbelliferone is measured in black 96-well plates (Microfluor, Dynex, U.S.A.) at an excitation wavelength of 365 nm and an emission wavelength of 450 nm.
- the activity of the enzyme corresponds to the intensity of the measured fluorescence and can be read on a previously created calibration curve (method according to Engstier et al. 1992).
- Example 4 Production of transgenic production organisms (bacteria, yeast, fungi, plants) for the enzymes
- the DNA partial sequences of TS1 and TS2 described here for the first time enable complete DNS To create sequences of the enzymes (especially since the DNA sequences presented here do not contain any non-coding introns).
- the corresponding standard techniques are e.g. B. the “polymerase chain reaction” technique (PCR technique), “Southern blott” via genomic DNA or cDNA and mRNA techniques, which can be carried out with the aid of commercially available kits, for example from Invitrogen or Clontech , The techniques are known to the person skilled in the art and are described, inter alia, in: Ausubel et al: Current Protocols in Molecular Biology, Edition 1989 and 2001.
- the complete DNA of the respective enzymes or functional partial sequences thereof are converted into the by means of standard transformation techniques (Ausubel et al.) desired production organisms introduced.
- the transgenic organisms produce TS1 and TS2 and can be isolated from the transgenic organisms and / or their culture supernatants.
- Prokaryotic bacteria, eukaryotic microorganisms, yeasts and other fungi, eukaryotic cell cultures, algae, plants, seeds, animals, parts of animals, tissues, hybridomas, transgenic organisms and genetic, gene therapeutic and transgenic come as recipient organisms of the DNA that codes TS1 or TS2 Recombinants and derived organisms, organs, tissues and cells are used.
- the enzymes claimed here can be isolated from the corresponding whole or parts of transgenic organisms, from their culture supernatants, from organs, tissues, cells, biological fluids, exudates, eggs, blood, lymph, milk, plants, algae and seeds and from parts thereof ,
- GMP glycomacropeptide
- Tris buffer pH 7.0 e.g. from Merk, Darmstadt
- the solution is mixed with 1 liter of the trans-sialidase-containing culture supernatant from Trypanosoma congolense and incubated at 37 ° C. for 3 hours. After this period, the trans-sialidase transferred sialic acids from the GMP to the galactooligosaccharides.
- the specialized products can with the help usual chromatographic methods (Ausubel et al.) or filter techniques can be separated and cleaned and are available in pure form for product formulations.
- Glycomacropeptide is a waste product from the production of cheese from cow's milk. After the casein for cheese preparation has been precipitated, it can be isolated from the remaining whey using filter techniques.
- Galactooligosaccharides are made by reacting lactose using the commercially available enzyme beta-galactosidase. In this reaction, beta-galactosidase splits the lactose into its monomeric sugars. On the other hand, this reaction also produces longer-chain galactooligosaccharides in a side reaction, which can be separated off and are then available as acceptors for the trans-sialidase reaction.
- the two isolated enzymes can be used, for example, for the sialylation of polymers containing beta-galactose (such as gum arabic, etc.) and in particular for polylactosamines and galactans and for galactooligosaccharides (GOS), in particular for beta-galacto-oligosaccharides, such as, for. B. Vivinal GOS from Borculo Domo Ingredients (BDI) and Oligomate 55 from Yakult.
- beta-galactose such as gum arabic, etc.
- GOS galactooligosaccharides
- Siglecs a family of sialic-acid binding lectins. Glycobiology 8, v.
- the developmentally regulated trans-sialidase from Trypanosoma brucei sialylates the procyclic acidic repetitive protein. Moles of Biochem Parasitol; 61: 1-13.
- the receptor-destroying enzyme of influenza C virus is neuraminate-O-acetylesterase. EMBO J. 4, 1503-1506.
- Influenza virus hemagglutinins differentiate between receptor determinants bearing N-acetyl-, N-glycolyl-, and N, O- diacetyl-neuraminic acids.
- Keim, S. and Schauer, R. (1997). Sialic acids in molecular and cellular interactions. Int. Rev. Cytol. 175: 137-240. Keim, S., Schauer, R. and Crocker, P.R. (1996). The Sialoadhesins - a family of sialic acid-dependent cellular recognition molecules within the immunoglobulin superfamily. Glycoconj. J. 13: 913-926.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Communicable Diseases (AREA)
- Microbiology (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Transplantation (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- General Preparation And Processing Of Foods (AREA)
Abstract
Die Erfindung betrifft neuartige Enzyme, die Sialinsäuren von einem Donormolekül auf ein Akzeptormolekül übertragen (Trans-Sialidasen). Die Enzyme wurden aus dem Einzeller Trypanosoma congolense isoliert. Weiterhin betrifft die Erfindung funktionale Äquivalente dieser Enzyme; die für diese Enzyme und deren funktionalen Äquivalente kodierenden Nukleinsäuresequenzen und Aminosäuresequenzen;Expressionskonstrukte und Vektoren, welche diese Sequenzen enthalten; rekombinante Mikroorganismen welche eine erfindungsgemässe kodierende Nukleinsäuresequenz tragen; Verfahren zur rekombinanten Herstellung erfindungsgemässer Enzyme; Verfahren zur Isolierung erfindungsgemässer Enzyme aus Trypanosoma congolense; Verfahren zur enzymatischen Sialisierung von Akzeptormolekülen unter Verwendung erfindungsgemässer Enzyme; Effektoren der erfindungsgemässen Trans-Sialidasen; die Verwendung erfindungsgemässer Nukleinsäuresequenzen, Aminosäuresequenzen, Enzyme, Effektoren oder Sialysierungsprodukte zur Herstellung von Impfstoffen, Medikamenten, Nahrungsoder Nahrungsergänzungsmitteln; sowie die erfindungsgemäss hergestellten Mittel selbst.
Description
Titel: Trans-Sialidasen aus Trypanosoma congolense Gegenstand der Erfindung
Die Erfindung betrifft neuartige Enzyme, die Sialinsäuren von einem Donormolekül (z. B. Oligosaccharide, Polysialinsäuren, glykosylierte Proteine, glykosylierte Peptide, glykosylierte Lipide (z.B. Ganglioside) und andere glykosylierte nieder- und hochmolekulare Moleküle) auf ein Akzeptormolekül (z. B. Oligo- und Polysaccharide, glykosylierte Proteine, glykosylierte Peptide, glykosylierte Lipide und andere glykosylierte nieder und hochmolekulare Moleküle) übertragen (Trans-Sialidasen). Die Enzyme wurden aus dem Einzeller Trypanosoma congolense isoliert.
Weiterhin betrifft die Erfindung funktionale Äquivalente dieser Enzyme; die für diese Enzyme und deren funktionalen Äquivalente kodierenden Nukleinsäuresequenzen; Expressionskonstrukte und Vektoren, welche diese Sequenzen enthalten; rekombinante Mikroorganismen, welche eine erfindungsgemäße kodierende Nukleinsäuresequenz tragen; Verfahren zur rekombinanten Herstellung erfindungsgemäßer Enzyme; Verfahren zur Isolierung erfindungsgemäßer Enzyme aus Trypanosoma congolense; Verfahren zur enzymatischen Sialisierung von Akzeptormolekülen unter Verwendung erfindungsgemäßer Enzyme; Effektoren der erfindungsgemäßen Trans-Sialidasen; die Verwendung erfindungsgemäßer Nukleinsäuresequenzen, Enzyme, Effektoren oder Sialysierungsprodukte zur Herstellung von Impfstoffen, Medikamenten, Nahrungs- oder Nahrungsergänzungsmittel; sowie die erfindungsgemäß hergestellten Mittel selbst.
Hintergrund der Erfindung
Trans-Sialidasen können Sialinsäuren, bevorzugt alpha-2,3-gebundene Sialinsäuren, von einem Donormolekül auf ein Akzeptormolekül übertragen, wobei wiederum alpha-2,3-glykosidische Bindungen, bevorzugt an einem ß-terminalen Galaktoserest, ausgebildet werden.
Unter dem Begriff Sialinsäuren werden alle N- und O- Derivate der Neuraminsäure zusammengefasst (Blix et al., 1957). Die Neuraminsäure (5-Amino-3,5-didesoxy-D- glycero-D-galacto-nonulo-pyranosonsäure) ist ein Aminozucker mit einem Rückgrat aus neun Kohlenstoffatomen, der durch die Carboxylgruppe am C-Atom 2 einen
stark sauren pK-Wert von 2,2 erhält und daher unter physiologischen Bedingungen negativ geladen ist. Die unsubstituierte Form ist sehr instabil und kommt in der Natur in freier Form nicht vor (Schauer, 1982). Allerdings sind inzwischen mehr als 40 natürliche Derivate der Neuraminsäure bekannt (Schauer und Kamerling, 1997). Die beiden häufigsten in der Natur vorkommenden Sialinsäuren sind die N- Acetylneuraminsäure (NeuδAc), der Vorläufer aller glykosidisch gebundenen Sialinsäuren (Schauer, 1991) und die -Glykolylneuraminsäure (NeuδGc), die durch Hydroxylierung der Methylgruppe des Λ/-Acetylrestes von CMP-Neu5Ac entsteht (Shaw und Schauer, 1988). Die Hydroxylgruppen dieser beiden Sialinsäuren können durch Acetyl-, Lactyl-, Methyl-, Sulfat- und Phosphatreste in unterschiedlicher Kombination substituiert sein, was zu der großen strukturellen Vielfalt der Sialinsäuren führt (Schauer, 1991; Schauer und Kamerling, 1997).
Der größte Teil der natürlich vorkommenden Sialinsäuren liegt gebunden als Bestandteil von Oligosacchariden, Polysacchariden und insbesondere
Glykokonjugaten vor (Schauer, 1982). Es sind aber auch schon Polysialinsäuren aus transgener mikrobieller Produktion bekannt. Sialylierte Glykokonjugate kommen vor allem in der äußeren Membran der Zellen vor, sind jedoch auch wichtige
Bestandteile des Serums und von mukösen Schleimen (Traving und Schauer, 1998). Die Sialinsäuren schützen Glykoproteine und Zellen vor dem Angriff durch
Proteasen und anderen Enzymen und damit vor dem Abbau (Reuter et al., 1988).
Die sialinsäurehaltigen Schleimhäute des Magen-Darmtraktes bilden nicht nur einen wirksamen Schutz vor den Verdauungsenzymen, sondern schützen die darunter liegenden Gewebe auch vor dem Eindringen pathogener Bakterien (Keim und Schauer, 1997).
Eine sehr wichtige Funktion üben Sialinsäuren bei molekularen und zellulären Erkennungsprozessen aus. Dabei maskieren sie Rezeptoren und verhindern so Interaktionen zwischen Rezeptoren und Liganden (Schauer, 1985; Keim und Schauer, 1997). So schützen Sialinsäuren z. B. Serumglykoproteine und Erythrozyten vor Abbau und Phagozytose, indem sie darunterliegende Galaktosereste maskieren. Werden die endständigen Sialinsäuren abgespalten,
können die subterminalen Galaktosereste durch Lektine auf Hepatozyten bzw. Phagozyten gebunden werden und es kommt zur Endozytose der Serumproteine bzw. Erythrozyten. Ein weiteres Beispiel ist der Schutz körpereigener Gewebe, aber auch vieler hochsialylierter Tumore vor der Erkennung durch das Immunsystem (Pilatte et al., 1993). Geht die schützende Sialinsäureschicht verloren, kann es zu Autoimmunreaktionen kommen.
Sialinsäuren dienen auch als Erkennungsstellen für körpereigene Zellen und Hormone und spielen so eine wichtige Rolle bei zellulären Interaktionen (Keim und Schauer, 1997). Bei Entzündungen etwa exprimieren Endothelzellen auf ihrer Oberfläche Selektine, die bestimmte sialylierte Strukturen (z. B. Sialyl-Lewis X ) auf Leukozyten erkennen, so dass diese an die Endothelzellen binden und in das Gewebe eindringen können (Lasky, 1995). Außerdem wird die Aktivierung der T- Zellen der humoralen Immunabwehr durch die Wirkung von Trans-Sialidasen beeinflusst (Gao et al., 2001). Sialoadhäsine (Siglecs) wie das Myelin-assoziierte Glykoprotein (MAG) binden ebenfalls hochspezifisch an sialylierte Glykane (Keim et al., 1996; Crocker et al., 1998). Das Myelin-assoziierte Glykoprotein ist im Nervensystem unter anderem an der Myelinisierung und an der Regulation des axonaien Wachstums beteiligt. Somit ist es nicht verwunderlich, dass jüngst festgestellt wurde, dass Trans-Sialidasen durch die Übertragung von Sialinsäuren an der Differenzierung von Nervenzellen und Gliazellen beteiligt sind (Chuenkova et al., 2001). CD-22 ist ein weiterer Sialinsäure-bindender Rezeptor, der auf Lymphozyten vorkommt und das "Zwiegespräch" von T- und B-Lymphozyten ermöglicht. Die Familie der Siglecs besteht mittlerweise aus über 10 molekularbiologisch charakterisierten Vertretern.
Sialinsäuren sind jedoch nicht nur bei körpereigenen Erkennungsprozessen wichtig, sondern stellen auch Rezeptoren für einige Bakterien, Viren und Toxine dar. So erfolgt z. B. die Bindung des Tetanus-Toxins an Ganglioside von Neπtensynapsen über Sialinsäuren (Schauer et al., 1995). Die Sialinsäure-spezifische Adhäsion über mikrobielle Lektine (Sharon und üs, 1997) ist oft ein kritischer Schritt bei Infektionskrankheiten, etwa bei der durch einige E. co/i-Stämme hervorgerufenen
Neugeborenen-Meningitis oder bei Infektionen der Magenschleimhaut durch Helicobacter pyloή. Vor allem die Grippeerreger Influenza A und B Viren docken über Sialinsäure an die zu infizierenden Zellen an (Schauer, 2000).
Modifikationen der Sialinsäuren, insbesondere die O-Acetylierung, besitzen eine große Bedeutung bei der Regulation der molekularen und zellulären Erkennung (Schauer, 1991). So binden Influenza C-Viren spezifisch an 9-O-acetylierte Sialinsäuren auf Bronchialepithelien (Herrler et al., 1985), während die O- Acetylierung eine Bindung von Influenza A- und B-Viren verhindert (Higa et al., 1985). Vor allem aber ist die O-Acetylierung von Sialinsäuren sehr wichtig für die Morphogenese und Entwicklung verschiedener Gewebe (Varki et al., 1991). Bei neuroektodermalen Tumoren ist sie erhöht (Hubl et al., 2000; Fahr und Schauer, 2001) und bei Dickdarmkrebs erniedrigt (Corfield et al., 1999). Sialinsäuren sind essentielle Modulatoren des biologischen Verhaltens von Tumoren (Schauer, 2000).
Figurenbeschreibung
Bild 1 zeigt einen Vergleich der von Aminosäureteilsequenzen der erfindungsgemäßen Trans-Sialidasen TS1 und TS2. Identische Aminosäuren in beiden Sequenzen sind dunkel markiert. Die Übereinstimmung (Identität) der beiden Teilsequenzen beträgt nur etwa 50%.
Bild 2 zeigt die verschiedenen Reaktionsweisen von Sialidase, Sialyltransferasen und Trans-Sialidasen
Bild 3 zeigt einen Vergleich der Aminosäuresequenz der Sialidase aus Trypanosoma rangeli (T. r. S), der Trans-Sialidase von Trypanosoma cruzi (T. er. TS) und der Trans-Sialidase von Trypanosoma brucei brucei (T. b. br. TS) mit Teilsequenzen der beiden erfindungsgemäßen Trans-Sialidasen aus Trypanosoma congolense (T. con. TS1 und T. con. TS2). Aminosäuren, die in allen Sequenzen identisch sind, sind weiß auf dunkelgrauem Hintergrund dargestellt. Aminosäuren, die in mindestens 4 von den 5 Sequenzen identisch sind, sind schwarz auf Dunkelgrau gedruckt,
während Aminosäuren, die in mindestens 3 der 5 Sequenzen übereinstimmen mit hellerem Grau hinterlegt sind.
Kurze Beschreibung der Erfindung
Aufgabe der vorliegenden Erfindung war es, neuartige Mittel bereitzustellen, mit deren Hilfe Sialinsäure-gesteuerte biologische oder patho-biologische Prozesse beeinflussbar sind.
Obige Aufgabe konnte überraschenderweise gelöst werden durch Bereitstellung neuartiger Enzyme mit Trans-Sialidase-Aktivität und der kodierenden Sequenzen davon aus Trypanosoma congolense.
Ein erster Gegenstand der Erfindung betrifft Polynukleotide, welche für Proteine mit Trans-Sialidase-Aktivität kodieren und aus Trypanosoma congolense isolierbar sind, wobei diese Proteine vorzugsweise den Transfer von Sialinsäure von einem Donor auf ein Akzeptormolekül katalysieren.
Bevorzugte Polynukleotide umfassen wenigstens eine Nukleinsäuresequenz gemäß SEQ ID NO: 1 oder 3, oder stellen Fragmente davon dar, welche wenigstens 15 zusammenhängende Nukleotidreste umfassen. Gegenstand der Erfindung sind auch die dazu komplementären Polynukleotide und Fragmente; und die von diesen Polynukleotiden durch Entartung des genetischen Codes abgeleiteten Nukleotidsequenzen.
Ein weiterer Gegenstand der Erfindung betrifft Oligonukleotide, welche mit einem erfindungsgemäßen Polynukleotid, insbesondere unter stringenten Bedingungen, hybridisieren.
Gegenstand der Erfindung sind auch Polynukleotide, welche mit einem Oligonukleotid gemäß obiger Definition, insbesondere unter stringenten
Bedingungen, hybridisieren und für ein Genprodukt aus Mikroorganismen der Gattung Trypanosoma kodieren.
Gegenstand der Erfindung sind auch Polypeptide, welche von einem Polynukleotid kodiert werden, das eine Nukleinsäuresequenz gemäß obiger Definition umfasst; oder welche eine Aminosäuresequenz aufweisen, die wenigstens 10 zusammenhängende Aminosäuren gemäß SEQ ID NO: 2 oder 4 umfasst; sowie funktionale Äquivalente davon, welche Trans-Sialidase-Aktivität besitzen.
Gegenstand der Erfindung sind insbesondere Trans-Sialidasen oder funktionale Äquivalente davon mit Trans-Sialidase-Aktivität, gekennzeichnet durch eine der folgenden Aminosäureteilsequenzen:
TDTVAKYSTDGGRTWKREVIIPNGR (Pos. 1 bis 25 gemäß SEQ ID NO:2) FRIPSLVEIDGVLIATFDTRYLRASDSSLI (Pos. 1 bis 30 gemäß SEQ ID NO:4).
Eine bevorzugte Trans-Sialidase 1 (TS1) ist durch wenigstens eines der folgenden Charakteristika gekennzeichnet:
Eine weitere bevorzugte Trans-Sialidase 2 (TS2), ist durch wenigstens eines der folgenden Charakteristika gekennzeichnet:
Die oben beschriebenen erfindungsgemäßen Polynukleotide und Polypeptide, insbesondere kodierenden Nukleinsäuresequenzen und Aminosäuresequenzen sind aus dem Organismus Trypanosoma congolense ableitbar. Sie sind aber auch unter Anwendung synthetischer, insbesondere chemischer, biochemischer, enzymatischer, gentechnologischer und transgener Methoden zugänglich.
Gegenstand der Erfindung sind weiterhin funktionale Äquivalente erfindungsgemäßer Trans-Sialidasen.
Gegenstand der Erfindung sind weiterhin Expressionskassetten, umfassend in operativer Verknüpfung mit wenigstens einer regulativen Nukleinsäuresequenz eine Nukleinsäuresequenz gemäß obiger Definition. Weiterhin umfasst die Erfindung auch rekombinante Vektoren, enthaltend wenigstens eine dieser Expressionskassetten.
Gegenstand der Erfindung sind außerdem prokaryotische oder eukaryotische Wirte, transformiert mit wenigstens einem Vektor gemäß obiger Definition.
Weiterhin betrifft die Erfindung die Verwendung einer Expressionskassette, eines Vektors oder eines Wirts gemäß obiger Definition zur rekombinanten Herstellung eines Proteins mit Trans-Sialidase-Aktivität.
Gegenstand der Erfindung ist auch ein Verfahren zur enzymatischen Sialisierung eines Akzeptormoleküls, dadurch gekennzeichnet, dass man das Akzeptormolekül mit einem Sialinsäurereste enthaltenden Donor in Gegenwart einer Trans-Sialidase gemäß obiger Definition inkubiert und den sialylierten Akzeptor isoliert.
Derartige Verfahren sind durch wenigsten eine weitere der folgenden Eigenschaften charakterisiert: a) der Donor ist ausgewählt unter an Oligosaccharide, Polysaccharide, Polysialinsäuren, Glykoproteine und Glykolipide gebundene Sialinsäuren, wie insbesondere Lactoferrine, glykolisierte Molkenproteine und Caseine und Fragmente davon; b) der Akzeptor ist ausgewählt unter ß-Galaktose enthaltenden Polymeren, wie ß- Galaktooligosacchariden, Laktitol, Laktobionsäure, Methyl-ß-lactosid, Acetyllaktosaminen, Galaktopyranosiden, Trans-Galaktooligosacchariden, Polygalaktose und anderen Glykokonjugaten mit endständig gebundener ß(1-3) oder ß(1-4)-Galaktose; oder Galaktose.
Ein weiterer Aspekt der vorliegenden Erfindung betrifft die Verwendung einer erfindungsgemäßen Trans-Sialidase, einer dafür kodierenden Nukleinsäuresequenz oder eines erfindungsgemäß hergestellten Sialisierungsprodukts zur Herstellung eines Medikaments, Nahrungsmittels oder Nahrungsergänzungsmittels oder einer Nahrungsmittelzusatzes zur Prävention oder Behandlung Sialinsäure-gesteuerter parasitärer, bakterieller oder viraler Infektionen; zur Behandlung von Tumorerkrankungen; zur Behandlung von Erkrankungen, welche mit einer Entwicklungsstörung des Gewebes assoziiert sind; zur Behandlung von Erkrankungen des Immunsystems; zur Behandlung von Autoimmunreaktionen; zur Behandlung von Erkrankungen mit gestörter Zellkommunikation; und/oder zur Behandlung von Entzündungen.
Insbesondere ist Gegenstand der Erfindung die Verwendung einer erfindungsgemäßen Trans-Sialidase gemäß obiger Definiton, zur Entwicklung eines Trypanosomiasis-Impfstoffs oder zur Entwicklung von Enzyminhibitoren zur Behandlung oder Prävention von Trypanosoma-Infektionen.
Die Erfindung betrifft weiterhin die Verwendung einer Trans-Sialidase, einer dafür kodierenden Nukleinsäuresequenz oder eines erfindungsgemäß hergestellten sialylierten Produkts zur Herstellung eines Medikaments, Nahrungsergänzungsmittels oder Nahrungsmittels zum Schutz körpereigener Zellen oder Gewebe oder Glykoproteine vor enzymatischer Einwirkung.
Gegenstand der Erfindung ist weiterhin die Verwendung einer Trans-Sialidase, einer dafür kodierenden Nukleinsäuresequenz oder eines erfindungsgemäß hergestellten sialylierten Produkts zur Herstellung eines Medikaments,
Nahrungsergänzungsmittels oder Nahrungsmittels zu Beeinflussung der Entwicklung und/oder Morphogenese von Körpergeweben.
Weiterhin betrifft die Erfindung Effektoren der Trans-Sialidase-Aktivität einer Trans- Sialidase, ausgewählt unter a) Polypeptid-Liganden, welche mit einer Trans-Sialidase gemäß obiger Definition wechselwirken; b) niedermolekularen Effektoren, welche die biologische Aktivität einer Trans- Sialidase gemäß obiger Definition modulieren; und c) Antisense-Nukleinsäuresequenzen zu einer Nukleinsäuresequenz gemäß obiger Definition.
Weiterhin betrifft die Erfindung die Verwendung eines solchen Effektors zur Herstellung eines Medikaments, Nahrungsergänzungsmittels oder Nahrungsmittels zur Behandlung oder Prävention von mit Trans-Sialidase-Aktivität assoziierten Erkrankungen.
Gegenstand der Erfindung ist weiterhin ein Verfahren zur Isolierung eines Enzyms mit Trans-Sialidase-Ayktivität, wobei man a) Trypanosoma congolense in einem Medium kultiviert, und b) das gewünschte Produkt aus dem Kulturüberstand durch lonenaustauschchromatographie mit Hilfe eines Salzgradienten, gegebenenfalls gefolgt von Isoelektrischer Fokussierung, Gelfiltration, Affinitätschromatographie und/oder Proteinfällung, isoliert.
Schließlich berifft die Erfindung pharmazeutisches oder gentherapeutisches Mittel, enthaltend in einem pharmazeutisch oder gentherapeutisch verträglichen Träger wenigsten einen Effektor gemäß obiger Definition
Detaillierte Beschreibung der Erfindung
i) Bedeutung der Erfindung
Die Bedeutung der vorliegenden Erfindung ergibt sich aus der mit dieser Erfindung nun möglichen Beeinflussung der Sialinsäure-gesteuerten parasitären, bakteriellen und viralen Infektionsmechanismen, der Beeinflussung der Zellkommunikation und des Immunsystems und der Veränderung der Regulations- und Entwicklungsmechnismen menschlicher und tierischer Gewebe sowie von Tumoren. Dies wird durch die gezielte Übertragung von Sialinsäuren auf biologisch relevante Glykostrukturen (Glykane, Glykanderivate und Glykokonjugate) mittels der hierin beschriebenen Trans-Sialidasen erreicht.
Aus der Übertragung der Sialinsäuren auf ausgewählte Trägerstrukturen ergeben sich beispielsweise Produkte zur Veränderung von Entzündungsreaktionen, Veränderung zellulärer Interaktionen im menschlichen und tierischen Körper, Schutz körpereigener Gewebe vor Angriffen des eigenen Immunsystems (Autoimmunreaktionen), „Enttarnung" von Krebszellen im Körper eines Patienten, damit sie vom körpereigenen Immunsystem wieder bekämpft werden (Krebstherapie
und Krebsprävention), Bekämpfung des Eindringens pathogener Bakterien in den menschlichen und tierischen Körper, Prävention und Bekämpfung von viralen Infektionen, Bekämpfung von Infektionen der Magenschleimhaut durch Helicobacter py/ori, Bekämpfung der durch Bakterien und Viren hervorgerufenen Neugeborenen- Meningitis, Präventive und therapeutische Beeinflussung von Rezeptoren von eukaryontischen und prokaryontischen pathogenen Organismen, Bakterien, Viren und Toxinen zur Vermeidung derer Wirkungsentfaltung im menschlichen und tierischen Körper, Inhibition der Bindung des Cholera-Toxins an menschliche und tierische Schleimhäute des Verdauungstraktes, Entwicklung eines Impfstoffes gegen Trypanosomiasis, Entwicklung von Enzyminhibitoren zur Bekämpfung (Therapie) von Trypanosoma Infektionen, Beeinflussung molekularer und zellulärer Erkennungsprozesse im menschlichen und tierischen Körper, Schutz von Glykoproteinen und Zellen vor dem Angriff durch Proteasen und andere Enzyme, unter anderem auch zum Schutz des Abbaus der Moleküle durch Enzyme des menschlichen und tierischen Verdauungstraktes, Beeinflussung der Entwicklung von Körpergeweben und Beeinflussung der Morphogenese von Körpergeweben.
Die erfindungsgemäßen Trans-Sialidasen sind durch folgende DNS- und Aminosäure-Teilsequenzen sowie durch andere DNS-Sequenze-Homologe, z.B. mit einer mehr als 60 prozentigen Übereinstimmung (Identität) zu diesen Teilsequenzen, charakterisiert.
ii) Sequenzangaben zu bevorzugten Trans-Sialidasen
(1) Informationen für die Sequenz des Enzyms TS1 :
Merkmale der DNS der Teilsequenz von TS1 : Länge: 1491 Basenpaare Typ: Nukleinsäure Strangform: doppelt
Ursprung: Trypanosoma congolense
DNS Teilsequenz des Enzyms TS1 (SEQ ID NO: 1):
5ΛACCGACACCGTTGCTAAATACAGCACTGACGGTGGGAGAACGTGGAAGAGG GAGGTTATAATTCCGAATGGTCGTGTGGATGCCCACTACTCCCGCGTCGTTGAT CCCACTGTTGTTGCGAAGGGTAATAACATTTATGTTCTCGTTGGGCGGTACAAT GTCACGCGGGGCTACTGGCACAATAGGAACAACAAGGCTGGCATAGCCGATTG GGAGCCCTTCGTGTACAAGGGCACGGTGAACGTGGGCACGAAGGGCAATGCC ACTGATGTGTCGATCAGCTGGGAGAGGACTGCACTGAAGTCGCTGTACAACTT CCCGGTTTCGGGAAGCCCTGGCACGCAGTTCCTTGGAGGGGCTGGGGGTGGT GTTGTAACATCCAACGGGACGATTGTGCTGCCAGTGCAGGCAAGGAACAAGGC CAACCGTGTTGTGAGCATGATCCTGTACTCGGCTGACGATGGAAAGTCATGGC ACTTTGGGAAGGGTGAGGCCGGTGTAGGCACGTCCGAGGCTGCCCTCACTGA GTGGGACGGCAAGCTGCTGATTAGTGCACGATCCGATGGTGGACAGGGCTAC CGCATGATATTCGAATCGAGTGACCTTGGTGCGACGTGGAAAGAGATGCTCAA CAGCATCTCCCGCGTGATTGGCAACTCTCCGGGTCGCAGTGGTCCTGGCAGCT CGAGTGGCTTCATCACGGTGACAGTGGAGGGTGTGCCTGTGATGCTGATTACC CACCCGAAGAACCTTAAGGGCTCGTATTATCGGGACCGTCTGCAGCTGTGGAT GACGGACGGCAATCGTATGTGGCATGTCGGGCAGGTCTCTGAGGGCGACGAT AACAGCGCTTACAGCTCCCTGCTGTACACTCCGGACGGGGTCCTGTACTGCTT GCATGAGCAGAACATTGATGAGGTGTACAGCCTCCACCTTGTGCGCCTTGTGG ACGAGCTGAAAAGCATTAAATCAACGGCTCTGGTGTGGAAGGCACAGGACGAG CTTCTCCTGGGCAACTGCCTCCCGGGCGATAAATACGATCCCGGGTGTGACGG CATCCCCACCGCTGGGCTTGCCGGGCTGCTGGTAGGACCCCTGACGGAGAAG ACGTGGCCCGACGCGTATCGGTGCGTGAACGCTGCAACCAGCGGCGCTGTGA GCACTGCTGAAGGCGTGCGGCTGGACGTGGGTGGCGGTGGCCATGTTGTGTG GCCCGTGAGTGAGCAGGGGCAGGACCAGCGGTATTACTTTACCAACAGCGAGT TCACGCTCGCCGTCACGGTGCGGTTTGACGAGATGCCACGGGGGGAGCTCCC GTTGCTGGGGTTTGTGAACCGCAAAGGGAAGGTGAAGAAGATACTGAAGGTGT CGCTGAGCGGGGTGGAGTGGCTCCTGGCATACGGGAATGAGTACAACAGCAC AGCCGCTGAGCCGCTGGACGTGAACGAGAGCCACCAGGTGGTGCTAGCGCTT CACGACGGGATCGTCTCC 3
Aminosäureteilsequenz des Enzyms TS1 (SEQ ID NO: 2):
TDTVAKYSTDGGRTWKREVIIPNGRVDAHYSRWDPTWAKGNNIYVLVGRYNVTR GYWHNRNNKAGIADWEPFVYKGTVNVGTKGNATDVSISWERTALKSLYNFPVSGS PGTQFLGGAGGGWTSNGTIVLPVQARNKANRWSMILYSADDGKSWHFGKGEA GVGTSEAALTEWDGKLLISARSDGGQGYRMIFESSDLGATWKEMLNSISRVIGNSP GRSGPGSSSGFITVTVEGVPVMLITHPKNLKGSYYRDRLQLWMTDGNRMWHVGQ VSEGDDNSAYSSLLYTPDGVLYCLHEQNIDEVYSLHLVRLVDELKSIKSTALVWKAQ DELLLGNCLPGDKYDPGCDGIPTAGLAGLLVGPLTEKTWPDAYRCVNAATSGAVST AEGVRLDVGGGGHWWPVSEQGQDQRYYFTNSEFTLAVTVRFDEMPRGELPLLG FVNRKGKVKKILKVSLSGVEWLLAYGNEYNSTAAEPLDVNESHQWLALHDGIVS
(2) Informationen für die Sequenz des Enzyms TS2:
Merkmale der DNS der Teilsequenz von TS2: Länge: 831 Basenpaare Typ: Nukleinsäure
Strangform: doppelt Ursprung: Trypanosoma congolense
DNS Teilsequenz des Enzyms TS2 (SEQ ID NO: 3): δ'TTCCGAATTCCCTCACTTGTTGAGATAGACGGCGTGCTTATCGCGACATTCGA TACACGTTATCTTCGCGCTTCCGACAGCAGTCTCATAGACACAGCTATGAAATA CAGTGCCGATCAGGGGAAGACGTGGAAAACTGAAATCATAATAAAAAATGCTAG ACTAACTGATAACTTTTCCCGCGTCGTTGATCCAACGGTTGTTGTTAAGGGTGA TAACTTGTTTATTTTTGTTGGGAGGTACAACACCTCATCTGCCCCATGGGTCTG GCAGGAAAACGGTAAAGACTGGGATGTACTGTTGTACAAGGCCAAGGTGAGGA AGGAATCAGCGGGTGGGGTACCATCAGTGAGCTTTACATGGGACGAACCCCTA TACCTGAAGCATCTGCTCACCTCTGTCGGTAAAATAGACGGCAGGTCCCTCATA CAATACATTGGTGGCGTTGGAAATGGTATTGTAACACCGAAAGGTACTATCGTG TTTCCAGTTCAGGTTTTAAACACCAACAAATCCGTCATGAACATGCTTCTGTATT CAAGTAACGACGGAAAAACCTGGGAGTTCAGCAAAACTTCCACACCCGCGGGC ACAACTGAGGCCTCCCTTGTTTGGTGGGATGGACAACTACTTCTCACAAGCAGA ACAACTCCGGATGTCGGCAGCCGCAAAGTATATTTAACAAGCGACCTCGGAACT
TCATGGAATGAAGCGATCGGAAGTATCTCTCGTGTAATTGGTAACTCGCGGTAC CGTAACGATCCTGGGGGGTCAGGTAGCTCAATTGCCATAACTGTGGAGGGAGT ACCGGTGATGCTGATTACCCACCCG3
Aminosäureteilsequenz des Enzyms TS2 (SEQ ID NO: 4):
FRIPSLVEIDGVLIATFDTRYLRASDSSLIDTAMKYSADQGKTWKTEIIIKNARLTDNF
SR\Λ DPTVVVKGDNLFIFVGRYNTSSAPWVWQENGKDWDVLLYKAKVRKESAGG
VPSVSFTWDEPLYLKHLLTSVGKIDGRSLIQYIGGVGNGIVTPKGTIVFPVQVLNTNK
SVMNMLLYSSNDGKTWEFSKTSTPAGTTEASLVWWDGQLLLTSRTTPDVGSRKV
YLTSDLGTSWNEAIGSISRVIGNSRYRNDPGGSGSSIAITVEGVPVMLITHP
Die Teilsequenzen der Aminosäuren von Enzym TS1 und Enzym TS2 haben eine Übereinstimmung (Identiät) von nur ca. 50%. Die Teilsequenzen charakterisieren daher eindeutig zwei verschiedene Stoffe (siehe Bild 1).
iii) Beschreibung der Eigenschaften der neu gefundenen Enzyme TS1 und TS2
a) Physikalisch/chemische Eigenschaften der Stoffe
Tabelle 1: Basisdaten der beiden Trans-Sialidasen TS1 und TS2
Einfluss von putativen 10 mM /V-(4-Nitrophenyl)oxamsäure: wenig Inhibition Inhibitoren 10 mM Λ/-acetyl-2,3-didehydr-2-deoxyneuraminsäure: wenig Inhibition.
b) Biologische Eigenschaften der Stoffe
Die beiden hier beanspruchten Stoffe sind zwei Enzyme, die Sialinsäuren von einem Donormolekül auf ein Akzeptormolekül übertragen.
Als Donoren fungieren bei beiden Enzymen an Glykane, z. B. an Oligosaccharide, Polysaccharide, Polysialinsäuren, Glykoproteine und Glykolipide, gebundene Sialinsäuren. Unter den Glykoproteinen sind insbesondere Lactoferrine (aus Mensch, Kuh, Ziege, Schaf, Pferd, Kamel und anderen Tieren), glykolisierte Molkenproteine (aus Mensch, Kuh, Ziege, Schaf, Pferd, Kamel und anderen Tieren) und Caseine (aus Mensch, Kuh, Ziege, Schaf, Pferd, Kamel und anderen Tieren) sowie andere glykolisierte Proteine humanen, tierischen und pflanzlichen Ursprungs sowie Teilen davon, wie z. B. Teilstücke aus Caseinen (aus Mensch, Kuh, Ziege, Schaf, Pferd, Kamel und anderen Tieren) wie beispielsweise das Glykomakropeptid aus den Caseinen dieser Tiere gute Donoren für Sialinsäuren, die von den Enzymen übertragen werden können. Ganglioside können ebenfalls als Donoren eingesetzt werden.
Beide Trans-Sialidasen haben eine gute Akzeptorspezifität für Galaktooligosaccharide, insbesondere für beta-Galakto-Oligosaccharide, wie z. B. Vivinal GOS von der Firma Borculo Domo Ingredients (BDI) und Oligomate 55 von der Firma Yakυlt. Außerdem können Laktitol, Laktobionsäure, Methyl-ß-lactosid, Acetyllaktosamine, Galaktopyranoside, Trans-Galaktooligosaccharide, Polygalaktosen und andere Glykokonjugate mit endständig gebundener ß(1-3) oder ß(1-4)-Galaktose als Akzeptoren fungieren. Eine Methylierung des Galaktoserestes führt zu einer Verminderung der Akzeptorfunktion. Die Methylierung eines Glukoserestes (z. B. bei der Laktose) hat einen geringen Einfluss auf die
Akzeptorfunktion. Das Monosaccharid Galaktose dient ebenfalls als Akzeptor, wenn auch mit geringerer Spezifität.
Das Enzym TS1 zeigt eine etwa doppelt so effiziente Übertragung der Sialinsäuren auf die entsprechenden Akzeptoren wie das Enzym TS2. Die Substrate können frei, d.h. löslich, oder auch Zellmembran-gebunden sein.
Die Übertragung von alpha-2,3-gebundenen endständigen Sialinsäuren auf beta-1,4- gebundene endständige Galaktosereste ist auch von den Trans-Sialidasen von Typanosoma cruzi (Schenkman et al. ,1991; Vandekerckhove et al., 1992; Scudder et al., 1993) und Trypanosoma brucei (Engstier et al., 1992, 1993, 1995) bekannt. Aufgrund unterschiedlicher DNS- und Aminosäuresequenzen unterscheiden sich TSIund TS2 jedoch von den bereits bekannten Enzymen. TS1 und TS2 sind damit eindeutig als neue Stoffe (Trans-Sialidasen) charakterisiert. Zur weiteren Abgrenzung siehe den nächsten Absatz.
iv) Abgrenzung der Erfindung zu anderen Trans-Sialidasen, Sialidasen und Sialyltransferasen
Das erste Mal beschrieben wurde ein Enzym „Trans-Sialidase" in der amerikanischen Trypanosomenart Trypanosoma cruz (Schenkmann et al., 1991). Wenig später konnte das Enzym ebenfalls in den afrikanischen Arten Trypanosoma brucei gambiense, Trypanosoma brucei rhodesiense und Trypanosoma brucei brucei nachgewiesen werden (Engstier et al,. 1993, Pontes de Carvalho et al., 1993, Engstier et al., 1995). Weiterhin wurde Trans-Sialidase in Endotrypanum Arten (Parasiten, die das Faultier befallen) (Medina-Acosta et al., 1994), in Corynebacterium diphtheriae (Mattos-Guaraldi et al., 1998) und im menschlichen Plasma (Tertov et al. 2001) detektiert. Bereits lange vor den Nachweis der Trans- Sialidasen waren die sogenannten Sialidasen bekannt. Dies sind Glykohydrolasen, die Sialinsäuren von einem Donormolekül ausschließlich auf Wasser übertragen, die Sialinsäuren also von Oligosacchariden und Glykokonjugaten abhydrolysieren.
Weiterhin können bestimmte Enzyme mit Cytidin-Monophosphat (CMP)-aktivierte Sialinsäuren auf andere Zuckerreste, meist Galaktose und Λ/-Acetylgalaktosamin, übertragen. Diese Enzyme nennt man Sialyltransferasen (siehe Bild 2).
Die hier beanspruchten Trans-Sialidasen übertragen Sialinsäuren nicht ausschließlich von einem Donormolekül auf Wasser, wie dies die reinen Sialidasen tun. Fehlt jedoch ein geeigneter Akzeptor, hydrolysieren die hier beanspruchten Trans-Sialidasen die Sialinsäuren ebenso wie die einfachen Sialidasen. Die hier beanspruchten Trans-Sialidasen benötigen auch keine aktivierten Sialinsäuren für ihre Übertragungsreaktion wie die zuvor erwähnten Sialyltransferasen. Die Trans- Sialidasen haben auch eine breitere Donor- und Akzeptorspezifität als die Sialyltransferasen und sind deshalb besonders vielseitig einsetzbar. Die hier beanspruchten Trans-Sialidasen sind damit für die industrielle Verwertung vorteilhafter als die reinen Sialidasen und Sialyltransferasen.
Bisher sind nur die DNS- und Aminosäuresequenzen der Trans-Sialidasen von Trypanosoma cruzi und Trypanosoma brucei brucei bekannt, sowie die DNS- und Aminosäuresequenz einer reinen Sialidase aus Trypanosoma rangeli. Das hier beanspruchte Enzym TS1 hat zu der entsprechenden Aminosäureteilsequenz der Trans-Sialidase aus Trypanosoma brucei brucei eine Übereinstimmung (Identität) von unter 60% und zu der entsprechenden Teilsequenz von Trypanosoma cruzi eine Übereinstimmung von unter 50%. Das hier beanspruchte Enzym TS2 hat zu der entsprechenden Aminosäureteilsequenz der Trans-Sialidase aus Trypanosoma brucei brucei eine Übereinstimmung (Identität) von unter 50% und zu der entsprechenden Teilsequenz von Trypanosoma cruzi eine Übereinstimmung von ebenfalls unter 50% (siehe Bild 3). Des Weiteren ist bekannt, dass die Übereinstimmung der Aminosäuren zwischen den Trans-Sialidasen von Trypanosomen und den bekannten Sialidasen und Trans-Sialidasen von Bakterien und Viren nur 20% bis 30% beträgt (Chuenkova et al., 1999, Montagna et al., 2002).
Bei den hier beschriebenen Enzymen handelt es sich somit um neu charakterisierte Stoffe (Enzyme), deren Übereinstimmung (Identität) zu den entsprechenden DNS-
und Aminosäuresequenzen anderer bekannter Enzyme ähnlicher Funktion unter 60% beträgt.
v) Weitere Erläuterungen zur vorliegenden Erfindung
a) Polypeptide und funktionale Äquivalente
„Polypeptide" im Sinne der Erfindung umfassen charakteristische Teilfragmente der erfindungsgemäßen Aminosäuresequenzen, ebenso wie Aminosäuresequenzen der erfindungsgemäßen Enzyme und der funktionalen Äquivalente davon.
Erfindungsgemäß mit umfasst sind somit ebenfalls „funktionale Äquivalente'Oder „Homologe"der konkret offenbarten neuen Polypeptide bzw. Enzyme.
„Funktionale Äquivalente" oder Analoga der konkret offenbarten Polypeptide sind im Rahmen der vorliegenden Erfindung davon verschiedene Polypeptide, welche weiterhin die gewünschte biologische Aktivität gemäß obiger Definition (wie z.B. Substratspezifität) besitzen.
Unter "funktionalen Äquivalenten" versteht man erfindungsgemäß insbesondere Mutanten, welche in wenigstens einer der oben genannten Sequenzpositionen eine andere als die konkret genannte Aminosäure aufweisen aber trotzdem eine der hierin genannten biologische Aktivität besitzen. "Funktionale Äquivalente" umfassen somit die durch eine oder mehrere Aminosäure-Additionen, -Substituenten, - Deletionen und/oder -Inversionen erhältlichen Mutanten, wobei die genannten Veränderungen in jeglicher Sequenzposition auftreten können, solange sie zu einer Mutante mit dem erfindungsgemäßen Eigenschaftsprofil führen. Funktionale Äquivalenz ist insbesondere auch dann gegeben, wenn die Reaktivitätsmuster zwischen Mutante und unverändertem Polypeptid qualitativ übereinstimmen, d.h. beispielsweise gleiche Substrate mit unterschiedlicher Geschwindigkeit umgesetzt werden.
„Funktionale Äquivalente" im obigen Sinne sind auch Präkursoren der beschriebenen Polypeptide sowie funktionale Derivate und Salze der Polypeptide. Unter dem Ausdruck „Salze" versteht man sowohl Salze von Carboxylgruppen als auch Säureadditionssalze von Aminogruppen der erfindungsgemäßen Proteinmoleküle. Salze von Carboxylgruppen können in an sich bekannter Weise hergestellt werden und umfassen anorganische Salze, wie zum Beispiel Natrium-, Calcium-, Ammonium-, Eisen- und Zinksalze, sowie Salze mit organischen Basen, wie zum Beispiel Aminen, wie Triethanolamin, Arginin, Lysin, Piperidin und dergleichen. Säureadditionssalze, wie zum Beispiel Salze mit Mineralsäuren, wie Salzsäure oder Schwefelsäure und Salze mit organischen Säuren, wie Essigsäure und Oxalsäure sind ebenfalls Gegenstand der Erfindung.
„Funktionale Derivate" erfindungsgemäßer Polypeptide können an funktionellen Aminosäure-Seitengruppen oder an deren N- oder C-terminalen Ende mit Hilfe bekannter Techniken ebenfalls hergestellt werden. Derartige Derivate umfassen beispielsweise aliphatische Ester von Carbonsäuregruppen, Amide von Carbonsäuregruppen, erhältlich durch Umsetzung mit Ammoniak oder mit einem primären oder sekundären Amin; N-Acylderivate freier Aminogruppen, hergestellt durch Umsetzung mit Acylgruppen; oder O-Acylderivate freier Hydroxygruppen, hergestellt durch Umsetzung mit Acylgruppen.
"Funktionale Äquivalente" umfassen natürlich auch Polypeptide welche aus anderen Organismen zugänglich sind sowie natürlich vorkommende Varianten. Beispielsweise lassen sich durch Sequenzvergleich Bereiche homologer Sequenzregionen festlegen und in Anlehnung an die konkreten Vorgaben der Erfindung äquivalente Enzyme ermitteln.
„Funktionale Äquivalente" umfassen ebenfalls Fragmente, vorzugsweise einzelne Domänen oder Sequenzmotive, der erfindungsgemäßen Polypeptide, welche z.B. die gewünschte biologische Funktion aufweisen.
„Funktionale Äquivalente" sind außerdem Fusionsproteine, welche ein der oben genannten Polypeptidsequenzen oder davon abgeleitete funktionale Äquivalente und wenigstens eine weitere, davon funktionell verschiedene, heterologe Sequenz in funktioneller N- oder C-terminaler Verknüpfung (d.h. ohne gegenseitigen wesentliche funktionelle Beeinträchtigung der Fusionsproteinteile) aufweisen. Nichtlimitiernde Beispiele für derartige heterologe Sequenzen sind z.B. Signalpeptide, Enzyme, Immunoglobuline, Oberflächenantigene, Rezeptoren oder Rezeptorliganden.
„Funktionale Äquivalente" erfindungsgemäßer Trans-Sialidasen sind insbesondere Enzyme, deren Aminosäuresequenzen oder -teilsequenzen zur korrespondierenden Aminosäuresequenz oder -teilsequenz gemäß SEQ ID NO: 2 oder 4 eine Sequenzidentität (Sequenzhomologie) von wenigsten 60 % insbesondere wenigstens 65 % oder wenigstens 70 %, wie z.B. 75%, 80%, 85%, 90%, 95%, 98% oder 99%, berechnet nach dem Algorithmus von Pearson und Lipman, Proc. Natl. Acad, Sei. (USA) 85(8), 1988, 2444-2448, aufweisen.
Im Falle einer möglichen Proteinglykosylierung umfassen erfindungsgemäße Äquivalente Proteine des oben bezeichneten Typs in deglykosy Heiler bzw. glykosylierter Form sowie durch Veränderung des Glykosylierungsmusters erhältliche abgewandelte Formen.
Homologe der erfindungsgemäßen Proteine oder Polypeptide können durch Mutagenese erzeugt werden, z.B. durch Punktmutation, Verlängerung oder Verkürzung des Proteins. Der Begriff "Homolog", wie er hier verwendet wird, betrifft auch eine Variante Form des Proteins, die als Agonist oder Antagonist der Protein- Aktivität wirkt.
Homologe der erfindungsgemäßen Proteine können durch Screening kombinatorischer Banken von Mutanten, wie z.B. Verkürzungsmutanten, identifiziert werden. Beispielsweise kann eine variegierte Bank von Protein-Varianten durch kombinatorische Mutagenese auf Nukleinsäureebene erzeugt werden, wie z.B. durch enzymatisches Ligieren eines Gemisches synthetischer Oligonukleotide. Es
gibt eine Vielzahl von Verfahren, die zur Herstellung von Banken potentieller Homologer aus einer degenerierten Oligonukleotidsequenz verwendet werden können. Die chemische Synthese einer degenerierten Gensequenz kann in einem DNA-Syntheseautomaten durchgeführt werden, und das synthetische Gen kann dann in einen geeigneten Expressionsvektor ligiert werden. Die Verwendung eines degenerierten Gensatzes ermöglicht die Bereitstellung sämtlicher Sequenzen in einem Gemisch, die den gewünschten Satz an potentiellen Proteinsequenzen codieren. Verfahren zur Synthese degenerierter Oligonukleotide sind dem Fachmann bekannt (Z.B. Narang, S.A. (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu. Rev. Biochem. 53:323; Itakura et al., (1984) Science 198:1056; Ike et al. (1983) Nucleic Acids Res. 11:477).
b) Polynukleotide
„Polynukleotide" im Sinne der vorliegender Erfindung umfassen charakteristische Teilfragmente der erfindungsgemäßen Nukleinsäuresequenzen die für Aminosäureteilsequenzen erfindungsgemäßer Enzyme kodieren, ebenso wie Nukleisäuresequenzen die für Enzyme und deren funktionale Äquivalente kodieren. Polynukleotide umfassen vorzugsweise mehr als etwa 20 insbesondere mehr als etwa 30, wie z.B. mehr als etwa 45 oder mehr als etwa 60 Nukleinsäurereste.
„Oligonukleotide" umfassen insbesondere eine Sequenz von weniger als etwa 60, vorzugsweise weniger als etwa 45, insbesondere weniger als etwa 30 oder weniger als etwa 20 Nukleinsäuresten.
Alle hierin erwähnten „Nukleinsäuresequenzen" sind in an sich bekannter Weise durch chemische Synthese aus den Nukleotidbausteinen, wie beispielsweise durch Fragmentkondensation einzelner überlappender, komplementärer
Nukleinsäurebausteine der Doppelhelix herstellbar. Die chemische Synthese von Oligonukleotiden kann beispielsweise, in bekannter Weise, nach der Phosphoamiditmethode (Voet, Voet, 2. Auflage, Wiley Press New York, Seiten 896- 897) erfolgen. Die Anlagerung synthetischer Oligonukleotide und Auffüllen von
Lücken mit Hilfe des Klenow-Fragmentes der DNA-Polymerase und Ligationsreaktionen sowie allgemeine Klonierungsverfahren werden in Sambrook et al. (1989), Molecular Cloning: A laboratory manual, Cold Spring Harbor Laboratory Press, beschrieben.
Gegenstand der Erfindung sind auch Nukleinsäuresequenzen (einzel- und doppelsträngige DNA- und RNA-Sequenzen, wie z.B. cDNA und mRNA), kodierend für eines der obigen Polypeptide und deren funktionalen Äquivalenten, welche z.B. auch unter Verwendung künstlicher Nukleotidanaloga zugänglich sind.
Die Erfindung betrifft sowohl isolierte Nukleinsäuremoleküle, welche für erfindungsgemäße Polypeptide bzw. Proteine oder biologisch aktive Abschnitte davon kodieren, sowie Nukleinsäurefragmente, die z.B. zur Verwendung als Hybridisierungssonden oder Primer zur Identifizierung oder Amplifizierung von erfindungsgemäßer kodierenden Nukleinsäuren verwendet werden können.
Die erfindungsgemäßen Nukleinsäuremoleküle können zudem untranslatierte Sequenzen vom 3'- und/oder 5'-Ende des kodierenden Genbereichs enthalten
Ein "isoliertes" Nukleinsäuremolekül wird von anderen Nukleinsäuremolekülen abgetrennt, die in der natürlichen Quelle der Nukleinsäure zugegen sind und kann überdies im wesentlichen frei von anderem zellulären Material oder Kulturmedium sein, wenn es durch rekombinante Techniken hergestellt wird, oder frei von chemischen Vorstufen oder anderen Chemikalien sein, wenn es chemisch synthetisiert wird.
Ein erfindungsgemäßes Nukleinsäuremolekül kann mittels molekularbiologischer Standardtechniken und der erfindungsgemäß bereitgestellten Sequenzinformation isoliert werden. Beispielsweise kann cDNA aus einer geeigneten cDNA-Bank isoliert werden, indem eine der konkret offenbarten vollständigen Sequenzen oder ein Abschnitt davon als Hybridisierungssonde und Standard-Hybridisierungstechniken (wie z.B. beschrieben in Sambrook, J., Fritsch, E.F. und Maniatis, T. Molecular
Cloning: A Laboratory Manual. 2. Aufl., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989) verwendet werden. Überdies läßt sich ein Nukleinsäuremolekül, umfassend eine der offenbarten Sequenzen oder ein Abschnitt davon, durch Polymerasekettenreaktion isolieren, wobei die Oligonukleotidprimer, die auf der Basis dieser Sequenz erstellt wurden, verwendet werden. Die so amplifizierte Nukleinsäure kann in einen geeigneten Vektor Moniert werden und durch DNA-Sequenzanalyse charakterisiert werden. Die erfindungsgemäßen Oligonukleotide, können ferner durch Standard- Syntheseverfahren, z.B. mit einem automatischen DNA-Synthesegerät, hergestellt werden.
Die Erfindung umfasst weiterhin die zu den konkret beschriebenen Nukleotidsequenzen „komplementären" Nukleinsäuremoleküle oder einen Abschnitt davon.
Die erfindungsgemäßen Nukleotidsequenzen ermöglichen die Erzeugung von Sonden und Primern, die zur Identifizierung und/oder Klonierung von homologen Sequenzen in anderen Zelltypen und Organismen verwendbar sind. Solche Sonden bzw. Primer umfassen gewöhnlich einen Nukleotidsequenzbereich, der unter stringenten Bedingungen an mindestens etwa 12, vorzugsweise mindestens etwa 25, wie z.B. etwa 40, 50 oder 75 aufeinanderfolgende Nukleotide eines Sense- Stranges einer erfindungsgemäßen Nukleinsäuresequenz oder eines entsprechenden Antisense-Stranges hybridisiert.
Weitere erfindungsgemäße Nukleinsäuresequenzen sind abgeleitet von SEQ ID NO: 1 und 3 und unterscheiden sich davon durch Addition, Substitution, Insertion oder Deletion einzelner oder mehrerer Nukleotide, kodieren aber weiterhin für Polypeptide mit dem gewünschten Eigenschaftsprofil.
Erfindungsgemäß umfasst sind auch solche Nukleinsäuresequenzen, die sogenannte stumme Mutationen umfassen oder entsprechend der Codon-Nutzung eins speziellen Ursprungs- oder Wirtsorganismus, im Vergleich zu einer konkret
genannten Sequenz verändert sind, ebenso wie natürlich vorkommende Varianten, wie z.B. Spleißvarianten oder Allelvarianten, davon. Gegenstand sind ebenso durch konservative Nukleotidsubstutionen (d.h. die betreffende Aminosäure wird durch eine Aminosäure gleicher Ladung, Größe, Polarität und/oder Löslichkeit ersetzt) erhältliche Sequenzen.
Gegenstand der Erfindung sind auch die durch Sequenzpolymorphismen von den konkret offenbarten Nukleinsäuren abgeleiteten Moleküle. Diese genetischen Polymorphismen können zwischen Individuen innerhalb einer Population aufgrund der natürlichen Variation existieren. Diese natürlichen Variationen bewirken üblicherweise eine Varianz von 1 bis 5 % in der Nukleotidsequenz eines Gens.
Weiterhin umfasst die Erfindung auch Nukleinsäuresequenzen, welchen mit oben genannten kodierenden Sequenzen hybridisieren oder dazu komplementär sind. Diese Polynukleotide lassen sich bei Durchmusterung von genomischen oder cDNA- Banken auffinden und gegebenenfalls daraus mit geeigneten Primern mittels PCR vermehren und anschließend beispielsweise mit geeigneten Sonden isolieren. Eine weitere Möglichkeit bietet die Transformation geeigneter Mikroorganismen mit erfindungsgemäßen Polynukleotiden oder Vektoren, die Vermehrung der Mikroorganismen und damit der Polynukleotide und deren anschließende Isolierung. Darüber hinaus können erfindungsgemäße Polynukleotide auch auf chemischem Wege synthetisiert werden.
Unter der Eigenschaft, an Polynukleotide „hybridisieren" zu können, versteht man die Fähigkeit eines Poly- oder Oligonukleotids unter stringenten Bedingungen an eine nahezu komplementäre Sequenz zu binden, während unter diesen Bedingungen unspezifische Bindungen zwischen nicht-komplementären Partnern unterbleiben. Dazu sollten die Sequenzen zu 70-100%, vorzugsweise zu 90-100%, komplementär sein. Die Eigenschaft komplementärer Sequenzen, spezifisch aneinander binden zu können, macht man sich beispielsweise in der Northern- oder Southern-Blot-Technik oder bei der Primerbindung in PCR oder RT-PCR zunutze. Üblicherweise werden dazu Oligonukleotide ab einer Länge von 30 Basenpaaren eingesetzt.
Unter "stringenten" Bedingungen versteht man, wenn beispielsweise nach dem Southern bzw. Northern Blot die DNA bzw. RNA Fragmente auf den Membranen mit einer Sonde unter spezifischen Bedingungen, das heißt, bei einer Temperatur von 60 - 70 °C, (38-42°C bei 50 % Hybridisierungslösungen die 50 % Formamid enthalten) hybridisiert. Weiterhin sind die Bedingungen dann spezifisch bzw. stringent, wenn die im Anschluss an die Hybridisierung durchgeführten Waschschritte zur Elution unspezifisch hybridisierter DNA bzw. RNA-Sonden ebenfalls spezifisch durchgeführt werden. Bei spezifischen Waschschritten handelt es sich üblicherweise um das zweimalige Waschen bei 20-25 °C für 5-10min. mit 2 x SSC-Puffer, der 0,1% SDS (Natriumdodecylsulfat) enthält und anschließendem zweimaligen Waschen mit Puffer niedrigerer lonenstärke (z.B. 0,1 x SSC mit 0,1 % SDS) bei höherer Temperatur (z.B. 64 °C). [20x SSC: 3M NaCI, 0,3M Na-Citrat, pH 7,0]. Dabei bleiben nur in hohem Maße komplementäre Nukleinsäuren aneinander gebunden. Die Einstellung stringenter Bedingungen ist dem Fachmann bekannt und ist z.B. in Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. beschrieben.
Ein weiterer Aspekt der Erfindung betrifft "Antisense-'Nukleinsäuren. Diese umfassen eine Nukleotidsequenz, die zu einer kodierenden "Sense-"Nukleinsäure, komplementär ist. Die Antisense-Nukleinsäure kann zum gesamten kodierenden Strang oder nur zu einem Abschnitt davon komplementär sein. Bei einer weiteren Ausführungsform ist das Antisense-Nukleinsäuremolekül antisense zu einem nicht- kodierenden Bereich des kodierenden Stranges einer Nukleotidsequenz. Der Begriff "nicht-kodierender Bereich" betrifft die als 5'- und 3'-untranslatierte Bereiche bezeichneten Sequenzabschnitte.
Ein Antisense-Oligonukleotid kann z.B. etwa 5, 10, 15, 20, 25, 30, 35, 40, 45 oder 50 Nukleotide lang sein. Eine erfindungsgemäße Antisense-Nukleinsäure kann durch chemische Synthese und enzymatische Ligationsreaktionen mittels im Fachgebiet bekannter Verfahren konstruiert werden. Eine Antisense-Nukleinsäure kann chemisch synthetisiert werden, wobei natürlich vorkommende Nukleotide oder
verschieden modifizierte Nukleotide verwendet werden, die so gestaltet sind, daß sie die biologische Stabilität der Moleküle erhöhen, oder die physikalische Stabilität des Duplexes erhöhen, der zwischen der Antisense- und Sense-Nukleinsäure entstanden ist. Beispielsweise können Phosphorthioat-Derivate und acridinsubstituierte Nukleotide verwendet werden. Beispiele modifizierter Nukleotide, die zur Erzeugung der Antisense-Nukleinsäure verwendet werden können, sind z.B. 5-Fluoruracil, 5-Bromuracil, 5-Chloruracil, 5-loduracil, Hypoxanthin, Xanthin, 4- Acetylcytosin, und dergleichen.
Die erfindungsgemäßen Antisense-Nukleinsäuremoleküle werden üblicherweise an eine Zelle verabreicht oder in situ erzeugt, so daß sie mit der zellulären mRNA und/oder einer kodierenden DNA hybridisieren oder daran binden, so daß die Expression des Proteins, z.B. durch Hemmung der Transkription und/oder Translation, gehemmt wird.
Die Begriffe "exprimieren" bzw. "Verstärkung" oder „Überexpression" beschreiben im Kontext der Erfindung die Produktion bzw. Erhöhung der intrazellulären Aktivität eines oder mehrerer Enzyme in einem Mikroorganismus, die durch die entsprechende DNA kodiert werden. Dazu kann man beispielsweise ein Gen in einen Organismus einbringen, ein vorhandenes Gen durch ein anderes Gen ersetzen, die Kopienzahl des Gens bzw. der Gene erhöhen, einen starken Promotor verwenden oder ein Gen verwenden, das für ein entsprechendes Enzym mit einer hohen Aktivität kodiert und man kann gegebenenfalls diese Maßnahmen kombinieren.
Die Begriffe „abschwächen" und „verringern" beschreiben im Kontext der Erfindung die Abschwächung oder Verringerung der intrazellulären Aktivität eines oder mehrerer Enzyme in einem Mikroorganismus, die durch die entsprechende DNA kodiert werden. Dazu kann man beispielsweise ein Gen in einem Organismus deletieren, ein vorhandenes Gen durch ein anderes Gen ersetzen, die Kopienzahl eines Transkriptes des Gens bzw. der Gene erniedrigen, einen schwachen Promotor verwenden oder ein Gen verwenden, das für ein entsprechendes Enzym mit einer
niedrigeren Aktivität kodiert und man kann gegebenenfalls diese Maßnahmen kombinieren.
c) Expressionskonstrukte und Vektoren:
Gegenstand der Erfindung sind außerdem Expressionskonstrukte, enthaltend unter der genetischen Kontrolle regulativer Nukleinsäuresequenzen eine für ein erfindungsgemäßes Polypeptid kodierende Nukleinsäuresequenz; sowie Vektoren, umfassend wenigstens eines dieser Expressionskonstrukte. Vorzugsweise umfassen solche erfindungsgemäßen Konstrukte 5'-stromaufwärts von der jeweiligen kodierenden Sequenz einen Promotor und 3'-stromabwärts eine Terminatorsequenz sowie gegebenenfalls weitere übliche regulative Elemente, und zwar jeweils operativ verknüpft mit der kodierenden Sequenz.
Unter einer „operativen Verknüpfung" versteht man die sequentielle Anordnung von Promotor, kodierender Sequenz, Terminator und gegebenenfalls weiterer regulativer Elemente derart, dass jedes der regulativen Elemente seine Funktion bei der Expression der kodierenden Sequenz bestimmungsgemäß erfüllen kann. Beispiele für operativ verknüpfbare Sequenzen sind Targeting-Sequenzen sowie Enhancer, Polyadenylierungssignale und dergleichen. Weitere regulative Elemente umfassen selektierbare Marker, Amplifikationssignale, Replikationsursprünge und dergleichen. Geeignete regulatorische Sequenzen sind z.B. beschrieben in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, CA (1990).
Zusätzlich zu den artifiziellen Regulationssequenzen kann die natürliche Regulationssequenz vor dem eigentlichen Strukturgen noch vorhanden sein. Durch genetische Veränderung kann diese natürliche Regulation gegebenenfalls ausgeschaltet und die Expression der Gene erhöht oder erniedrigt werden. Das Genkonstrukt kann aber auch einfacher aufgebaut sein, das heißt es werden keine zusätzlichen Regulationssignale vor das Strukturgen insertiert und der natürliche Promotor mit seiner Regulation wird nicht entfernt. Statt dessen wird die natürliche
Regulationssequenz so mutiert, dass keine Regulation mehr erfolgt und die Genexpression gesteigert oder verringert wird. Die Nukleinsäuresequenzen können in einer oder mehreren Kopien im Genkonstrukt enthalten sein.
Beispiele für brauchbare Promotoren sind: cos-, tac-, trp-, tet-, trp-tet-, Ipp-, lac-, Ipp-lac-, laclq-, T7-, T5-, T3-, gal-, trc-, ara-, SP6-, lambda-PR- oder im lambda-PL- Promotor, die vorteilhafterweise in gram-negativen Bakterien Anwendung finden; sowie die gram-positiven Promotoren amy und SPO2, die Hefepromotoren ADC1, MFalpha , AC, P-60, CYC1, GAPDH oder die Pflanzenpromotoren CaMV/35S, SSU, OCS, Iib4, usp, STLS1, B33, not oder der Ubiquitin- oder Phaseolin-Promotor. Besonders bevorzugt ist die Verwendung induzierbarer Promotoren, wie z.B. licht- und insbesondere temperaturinduztierbarer Promotoren, wie der PrPι-Promotor. Prinzipiell können alle natürlichen Promotoren mit ihren Regulationssequenzen verwendet werden. Darüber hinaus können auch synthetische Promotoren vorteilhaft verwendet werden.
Die genannten regulatorischen Sequenzen sollen die gezielte Expression der Nukleinsäuresequenzen und der Proteinexpression ermöglichen. Dies kann beispielsweise je nach Wirtsorganismus bedeuten, dass das Gen erst nach Induktion exprimiert oder überexprimiert wird, oder dass es sofort exprimiert und/oder überexprimiert wird.
Die regulatorischen Sequenzen bzw. Faktoren können dabei vorzugsweise die Expression positiv beeinflussen und dadurch erhöhen oder erniedrigen. So kann eine Verstärkung der regulatorischen Elemente vorteilhafterweise auf der Transkriptionsebene erfolgen, indem starke Transkriptionssignale wie Promotoren und/oder "Enhancer" verwendet werden. Daneben ist aber auch eine Verstärkung der Translation möglich, indem beispielsweise die Stabilität der mRNA verbessert wird.
Die Herstellung einer Expressionskassette erfolgt durch Fusion eines geeigneten Promotors mit einer geeigneten kodierenden Nukleotidsequenz sowie einem
Terminator- oder Polyadenylierungssignal. Dazu verwendet man gängige Rekombinations- und Klonierungstechniken, wie sie beispielsweise in T. Maniatis, E.F. Fritsch und J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) sowie in T.J. Silhavy, M.L. Berman und L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) und in Ausubel, F.M. et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley Interscience (1987) beschrieben sind.
Das rekombinante Nukleinsäurekonstrukt bzw. Genkonstrukt wird zur Expression in einem geeigneten Wirtsorganismus vorteilhafterweise in einen wirtsspezifischen Vektor insertiert, der eine optimale Expression der Gene im Wirt ermöglicht.
"Vektoren" sind dem Fachmann wohl bekannt und können beispielsweise aus "Cloning Vectors" (Pouwels P. H. et al., Hrsg, Elsevier, Amsterdam-New York- Oxford, 1985) entnommen werden. Unter Vektoren sind außer Plasmiden auch alle anderen dem Fachmann bekannten Vektoren, wie beispielsweise Phagen, Viren, wie SV40, CMV, Baculovirus und Adenσvirus, Transposons, IS-Elemente, Phasmide, Cosmide, und lineare oder zirkuläre DNA zu verstehen. Diese Vektoren können autonom im Wirtsorganismus repliziert oder chromosomal repliziert werden.
Als Beispiele für geeignete Expressionsvektoren können genannt werden:
Übliche Fusionsexpressionsvektoren, wie pGEX (Pharmacia Biotech Ine; Smith, D.B. und Johnson, K.S. (1988) Gene 67:31-40), pMAL (New England Biolabs, Beverly, MA) und pRIT 5 (Pharmacia, Piscataway, NJ), bei denen Glutathion-S-Transferase (GST), Maltose E-bindendes Protein bzw. Protein A an das rekombinante Zielprotein fusioniert wird.
Nicht-Fusionsprotein-Expressionsvektoren wie pTrc (Amann et al., (1988) Gene 69:301-315) und pET 11d (Studier et al. Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Kalifornien (1990) 60-89).
Hefe-Expressionsvektor zur Expression in der Hefe S. cerevisiae , wie pYepSed (Baldari et al., (1987) Embo J. 6:229-234), pMFa (Kurjan und Herskowitz (1982) Cell 30:933-943), pJRY88 (Schultz et al. (1987) Gene 54:113-123) sowie pYES2 (Invitrogen Corporation, San Diego, CA). Vektoren und Verfahren zur Konstruktion von Vektoren, die sich zur Verwendung in anderen Pilzen, wie filamentösen Pilzen, eignen, umfassen diejenigen, die eingehend beschrieben sind in: van den Hondel, C.A.M.J.J. & Punt, P.J. (1991) "Gene transfer Systems and vector development for filamentous fungi, in: Applied Molecular Genetics of Fungi, J.F. Peberdy et al., Hrsg., S. 1-28, Cambridge University Press: Cambridge.
Baculovirus-Vektoren, die zur Expression von Proteinen in gezüchteten Insektenzellen (bspw. Sf9-Zellen) verfügbar sind, umfassen die pAc-Reihe (Smith et al., (1983) Mol. Cell Bio 3:2156-2165) und die pVL-Reihe (Lucklow und Summers (1989) Virology 170:31-39).
Pflanzen-Expressionsvektoren, wie solche, die eingehend beschrieben sind in: Becker, D., Kemper, E., Schell, J. und Masterson, R. (1992) "New plant binary vectors with selectable markers located proximal to the left border", Plant Mol. Biol. 20:1195-1197; und Bevan, M.W. (1984) "Binary Agrobacterium vectors for plant transformation", Nucl. Acids Res. 12:8711-8721.
Säugetier-Expressionsvektoren, wie pCDM8 (Seed, B. (1987) Nature 329:840) und pMT2PC (Kaufman et al. (1987) EMBO J. 6:187-195).
Weitere geeignete Expressionssysteme für prokaryontische und eukaryotische Zellen sind in Kapitel 16 und 17 von Sambrook, J., Fritsch, E.F. und Maniatis, T., Molecular cloning: A Laboratory Manual, 2. Auflage, Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989 beschrieben.
d) Rekombinante Mikroorganismen:
Mit Hilfe der erfindungsgemäßen Vektoren sind rekombinante Mikroorganismen herstellbar, welche beispielsweise mit wenigstens einem erfindungsgemäßen Vektor transformiert sind und zur Produktion der erfindungsgemäßen Polypeptide eingesetzt werden können. Vorteilhafterweise werden die oben beschriebenen erfindungsgemäßen rekombinanten Konstrukte in ein geeignetes Wirtssystem eingebracht und exprimiert. Dabei werden vorzugsweise dem Fachmann bekannte geläufige Klonierungs- und Transfektionsmethoden, wie beispielsweise Co- Präzipitation, Protoplastenfusion, Elektroporation, retrovirale Transfektion und dergleichen, verwendet, um die genannten Nukleinsäuren im jeweiligen Expressionssystem zur Expression zu bringen. Geeignete Systeme werden beispielsweise in Current Protocols in Molecular Biology, F. Ausubel et al., Hrsg., Wiley Interscience, New York 1997, oder Sambrook et al. Molecular Cloning: A Laboratory Manual. 2. Aufl., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989 beschrieben.
Erfindungsgemäß sind auch homolog rekombinierte Mikroorganismen herstellbar. Dazu wird ein Vektor hergestellt, der zumindest einen Abschnitt eines erfindungsgemäßen Gens oder einer kodierenden Sequenz enthält, worin gegebenenfalls wenigstens eine Aminosäure-Deletion, -Addition oder -Substitution eingebracht worden ist, um die erfindungsgemäße Sequenz zu verändern, z.B. funktionell zu disrumpieren ("Knockouf-Vektor). Die eingebrachte Sequenz kann z.B. auch ein Homologes aus einem verwandten Mikroorganismus sein oder aus einer Säugetier-, Hefe- oder Insektenquelle abgeleitet sein. Der zur homologen Rekombination verwendete Vektor kann alternativ derart ausgestaltet sein, daß das endogene Gen bei homologer Rekombination mutiert oder anderweitig verändert ist, jedoch noch das funktionelle Protein codiert (z.B. kann der stromaufwärts gelegene regulatorische Bereich derart verändert sein, daß dadurch die Expression des endogenen Proteins verändert wird). Der veränderte Abschnitt des erfindungsgemäßen Gens ist im homologen Rekombinationsvektor. Die Konstruktion geeigneter Vektoren zur homologen Rekombination ist z.B. beschrieben in Thomas, K.R. und Capecchi, M.R. (1987) Cell 51:503.
Als Wirtsorganismen sind prinzipiell alle Organismen geeignet, die eine Expression der erfindungsgemäßen Nukleinsäuren, ihrer Allelvarianten, ihrer funktioneilen Äquivalente oder Derivate ermöglichen. Unter Wirtsorganismen sind beispielsweise Bakterien, Pilze, Hefen, pflanzliche oder tierische Zellen zu verstehen. Bevorzugte Organismen sind Bakterien, wie solche der Gattungen Escherichia, wie z. B. Escherichia coli, Streptomyces, Bacillus oder Pseudomonas, eukaryotische Mikroorganismen, wie Saccharomyces cerevisiae, Aspergillus, höhere eukaryotische Zellen aus Tieren oder Pflanzen, beispielsweise Sf9 oder CHO-Zellen.
Die Selektion erfolgreich transformierter Organismen kann durch Markergene erfolgen, die ebenfalls im Vektor oder in der Expressionskassette enthalten sind. Beispiele für solche Markergene sind Gene für Antibiotikaresistenz und für Enzyme, die eine farbgebende Reaktion katalysieren, die ein Anfärben der transformierten Zelle bewirkt. Diese können dann mittels automatischer Zellsortierung selektiert werden. Erfolgreich mit einem Vektor transformierte Mikroorganismen, die ein entsprechendes Antibiotikaresistenzgen (z.B. G418 oder Hygromycin) tragen, lassen sich durch entsprechende Antibiotika-enthaltende Medien oder Nährböden selektieren. Markerproteine, die an der Zelloberfläche präsentiert werden, können zur Selektion mittels Affinitätschromatographie genutzt werden.
Die Kombination aus den Wirtsorganismen und den zu den Organismen passenden Vektoren, wie Plasmide, Viren oder Phagen, wie beispielsweise Plasmide mit dem RNA-Polymerase/Promoter-System, die Phagen 8 oder 7 oder andere temperente Phagen oder Transposons und/oder weiteren vorteilhaften regulatorischen Sequenzen bildet ein Expressionssystem. Beispielsweise ist unter dem Begriff "Expressionssystem" die Kombination aus Säugetierzellen, wie CHO-Zellen, und Vektoren, wie pcDNA3neo-Vektor, die für Säugetierzellen geeignet sind, zu verstehen.
Gewünschtenfalls kann das Genprodukt auch in transgenen Organismen, wie transgenen Tieren, insbesondere Mäusen, Schafen oder transgenen Pflanzen zur Expression, gebracht werden.
e) Rekombinante Herstellung der Polypeptide:
Gegenstand der Erfindung sind weiterhin Verfahren zur rekombinanten Herstellung einer erfindungsgemäßen Polypeptide oder funktioneller, biologisch aktiver Fragmente davon, wobei man einen Polypeptide-produzierenden Mikroorganismus kultiviert, gegebenenfalls die Expression der Polypeptide induziert und diese aus der Kultur isoliert. Die Polypeptide können so auch in großtechnischem Maßstab produziert werden, falls dies erwünscht ist.
Der rekombinante Mikroorganismus kann nach bekannten Verfahren kultiviert und fermentiert werden. Bakterien können beispielsweise in TB- oder LB-Medium und bei einer Temperatur von 20 bis 40°C und einem pH-Wert von 6 bis 9 vermehrt werden. Im Einzelnen werden geeignete Kultivierungsbedingungen beispielsweise in T. Maniatis, E.F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) beschrieben.
Die Zellen werden dann, falls die Polypeptide nicht in das Kulturmedium sezerniert werden, aufgeschlossen und das Produkt nach bekannten Proteinisolierungsverfahren aus dem Lysat gewonnen. Die Zellen können wahlweise durch hochfrequenten Ultraschall, durch hohen Druck, wie z.B. in einer French- Druckzelle, durch Osmolyse, durch Einwirkung von Detergenzien, lytischen Enzymen oder organischen Lösungsmitteln, durch Homogenisatoren oder durch Kombination mehrerer der aufgeführten Verfahren aufgeschlossen werden.
Eine Aufreinigung der Polypeptide kann mit bekannten, chromatographischen Verfahren erzielt werden, wie Molekularsieb-Chromatographie (Gelfiltration), wie Q- Sepharose-Chromatographie, lonenaustausch-Chromatographie und hydrophobe Chromatographie, sowie mit anderen üblichen Verfahren wie Ultrafiltration, Kristallisation, Aussalzen, Dialyse und nativer Gelelektrophorese. Geeignete Verfahren werden beispielsweise in Cooper, F. G., Biochemische Arbeitsmethoden, Verlag Walter de Gruyter, Berlin, New York oder in Scopes, R., Protein Purification,
Springer Verlag, New York, Heidelberg, Berlin beschrieben. Analoges gilt für nicht- rekominant hergestellte Polypeptide.
Besonders vorteilhaft ist es, zur Isolierung des rekombinanten Proteins Vektorsysteme oder Oligonukleotide zu verwenden, die die cDNA um bestimmte
Nukleotidsequenzen verlängern und damit für veränderte Polypeptide oder
Fusionsproteine kodieren, die z.B. einer einfacheren Reinigung dienen. Derartige geeignete Modifikationen sind beispielsweise als Anker fungierende sogenannte
"Tags", wie z.B. die als Hexa-Histidin-Anker bekannte Modifikation oder Epitope, die als Antigene von Antikörpern erkannt werden können (beschrieben zum Beispiel in
Harlow, E. and Lane, D., 1988, Antibodies: A Laboratory Manual. Cold Spring Harbor
(N.Y.) Press). Diese Anker können zur Anheftung der Proteine an einen festen
Träger, wie z.B. einer Polymermatrix, dienen, die beispielsweise in einer
Chromatographiesäule eingefüllt sein kann, oder an einer Mikrotiterplatte oder an einem sonstigen Träger verwendet werden kann.
Gleichzeitig können diese Anker auch zur Erkennung der Proteine verwendet werden. Zur Erkennung der Proteine können außerdem übliche Marker, wie Fluoreszenzfarbstoffe, Enzymmarker, die nach Reaktion mit einem Substrat ein detektierbares Reaktionsprodukt bilden, oder radioaktive Marker, allein oder in Kombination mit den Ankern zur Derivatisierung der Proteine verwendet werden.
f) Reinigung des gewünschten Sialisierungsprodukt.es aus der Kultur
Die Gewinnung des gewünschten Produktes aus dem Mikrooganismus oder aus dem Kulturüberstand kann durch verschiedene, im Fachgebiet bekannte Verfahren erfolgen. Wird das gewünschte Produkt von den Zellen nicht sezerniert, können die Zellen aus der Kultur durch langsame Zentrifugation geerntet werden, die Zellen können durch Standard-Techniken, wie mechanische Kraft oder Ultraschallbehandlung, lysiert werden. Die Zelltrümmer werden durch Zentrifugation entfernt, und die Überstandsfraktion, die die löslichen Proteine enthält, wird zur weiteren Reinigung der gewünschten Verbindung erhalten. Wird das Produkt von
den Zellen sezemiert, werden die Zellen durch langsame Zentrifugation aus der Kultur entfernt, und die Überstandsfraktion wird zur weiteren Reinigung behalten.
Die Überstandsfraktion aus beiden Reinigungsverfahren kann einer Chromatographie mit einem geeigneten Harz unterworfen werden, wobei das gewünschte Molekül mit höherer Selektivität als die Verunreinigungen entweder auf dem Chromatographieharz zurückgehalten wird oder dieses passiert. Diese Chromatographieschritte können nötigenfalls wiederholt werden, wobei die gleichen oder andere Chromatographieharze verwendet werden. Der Fachmann ist in der Auswahl der geeigneten Chromatographieharze und ihrer wirksamsten Anwendung für ein bestimmtes zu reinigendes Molekül bewandert. Das gereinigte Produkt kann durch Filtration oder Ultrafiltration konzentriert und bei einer Temperatur aufbewahrt werden, bei der die Stabilität des Produktes maximal ist.
Im Stand der Technik sind viele Reinigungsverfahren bekannt. Diese Reinigungstechniken sind z.B. beschrieben in Bailey, J.E. & Ollis, D.F. Biochemical Engineering Fundamentals, McGraw-Hill: New York (1986).
Die Identität und Reinheit der isolierten Verbindungen kann durch Techniken des Standes der Technik bestimmt werden. Diese umfassen Hochleistungs-
Flüssigkeitschromatographie (HPLC), spektroskopische Verfahren, Färbeverfahren,
Dünnschichtchromatographie, NIRS, Enzymtest oder mikrobiologische Tests. Diese
Analyseverfahren sind z.B. zusammengefaßt in: Patek et al. (1994) Appl. Environ.
Microbiol. 60:133-140; Malakhova et al. (1996) Biotekhnologiya 11 27-32; und Schmidt et al. (1998) Bioprocess Engineer. 19:67-70. Ullmann's Encyclopedia of
Industrial Chemistry (1996) Bd. A27, VCH: Weinheim, S. 89-90, S. 521-540, S. 540-
547, S. 559-566, 575-581 und S. 581-587; Michal, G (1999) Biochemical Pathways:
An Atlas of Biochemistry and Molecular Biology, John Wiley and Sons; Fallon, A. et al. (1987) Applications of HPLC in Biochemistry in: Laboratory Techniques in Biochemistry and Molecular Biology, Bd. 17.
Folgende nichtlimitierende Beispiele beschreiben spezielle Ausführungsformen der Erfindung.
Beispiele der Herstellung, Reinigung und Verwendung der hier beanspruchten Trans-Sialidasen
Allgemeines:
Die im Rahmen der vorliegenden Erfindung durchgeführten Klonierungsschritte wie z.B. Restriktionsspaltungen, Agarose Gelelektrophorese, Reinigung von DNA- Fragmenten, Transfer von Nukleinsäuren auf Nitrozellulose und Nylonmembranen, Verknüpfen von DNA-Fragmenten, Transformation von Zellen, Anzucht von Bakterien, Vermehrung von Phagen und Sequenzanalyse rekombinanter DNA wurden wie bei Sambrook et al. (1989) a.a.O. beschrieben durchgeführt.
Beispiel 1: Isolation der Enzyme aus Kulturen von Trypanosoma congolense
Die prozyklischen Formen von Trypanosoma congolense (hinterlegt beim Schweizer Tropeninstitut Basel (STIB) als Stamm Nr. 249) können bei 27°C ohne CO2 in SM/SDM 79 Medium, welches 10% fötales Kälberserum und Hemin enthält, angezüchtet werden. Nach drei bis vier Tagen ist die Zellzahl von 1x106 auf ca. 7x106/ml angewachsen und der Kulturüberstand wird durch Zentrifugation abgetrennt, filtriert und durch Ultrafiltration konzentriert. In dem so gewonnenen Kulturüberstand können 84% der Enzymaktivität festgestellt werden, während noch 16% der Enzyaktivität gebunden an das Zellpellet detektiert werden können. Die konzentrierten Kulturüberstände werden direkt als Enzymkonzentrat für die Trans- Sialidase Reaktionen eingesetzt. Die gewünschten sialisierten Moleküle werden nach der Reaktion aus dem Kulturüberstand isoliert.
Beispiel 2: Reinigung der Enzyme
Zur Isolierung reiner Enzyme wird der konzentrierte Kulturüberstand auf eine lonenaustauschsäule (Q Sepharose) gegeben. Die Säule wird nach dem Waschen mit einem Salzgradienten eluiert. TS2 eluiert mit einer Salzkonzentration bis 0,2M, TS1 mit einem Salzgradienten ab 0,2M. Nach der Elution werden die beiden Enzyme getrennt mittels Isoelektrischer Fokussierung, Gelfiltration (Sephades G150 SF), Affinitätschromatographie oder Proteinfällung bis zur apparenten Homogenität aufgereinigt.
Beispiel 3: Bestimmung der Enzymaktivität
Zur Bestimmung der Transferaktivität der Trans-Sialidase werden 25μl Enzymlösung in 50 mM BisTris Puffer, pH7,0, zusammen mit 1 mM Neu5Ac-α(2-3)lactose als Donor und 0,5 mM 4-Methylumbelliferylgalactosid als Akzeptor in einem Endvolumen von 50μl bei 37°C für 2h inkubiert. Die Inkubation wird durch Zugabe von 1 ml eiskaltem Wasser abgestoppt. Anschliessend wird der Reaktionsansatz auf vorher mit 0,3 ml Q Sepharose FF (Acetatform) gefüllte und mit Wasser preequillibrierte Säulen gegeben. Nach dem Auswaschen des Akzeptors mit Wasser und dem Verwerfen des Todvolumens (200 μl 1N HCI), wird das sialylierte Produkt mit 1 N HCI eluiert (700μl). Nach saurer Hydrolyse des Produktes bei 95°C für 45 min und Abkühlung auf Eis, wird die Probe mit 250-290μl 2 N NaOH und 300μl 1 M Glycin/NaOH Puffer pH 10,0 neutralisiert. Die Fluoreszenz des freigesetzten Methylumbelliferons wird in schwarzen 96-well-plates (Microfluor, Dynex, U.S.A.) bei einer Anregungswellenlänge von 365 nm und einer Emissionswellenlänge von 450 nm gemessen. Die Aktivität des Enzyms entspricht der Intensität der gemessenen Fluoreszenz und kann an einer zuvor erstellten Eichkurve abgelesen werden (Methode nach Engstier et al. 1992).
Beispiel 4: Herstellung transgener Produktionsorganismen (Bakterien, Hefen, Pilzen, Pflanzen) für die Enzyme
Die hier erstmals beschriebenen DNS-Teilsequenzen von TS1 und TS2 ermöglichen mittels routinemäßig angewandten Standardtechniken die vollständige DNS-
Sequenzen der Enzyme zu erstellen (insbesondere, da die hier vorgestellten DNS- Sequenzen keine nicht codierenden Introns enthalten). Die entsprechenden Standardtechniken sind z. B. die „Polymerase-Chain-Reaction" Technik (PCR- Technik), „Southern-Blott" über die genomische DNS oder cDNS und mRNA- Techniken, die mit Hilfe von kommerziell erhältlichen Kits beispielsweise von den Firmen Invitrogen oder Clontech durchgeführt werden können. Die Techniken sind dem Fachmann bekannt und sind unter anderem beschrieben in: Ausubel et al: Current Protocols in Molecular Biology, Edition 1989 und 2001. Die vollständige DNS der jeweiligen Enzyme oder funktionelle Teilsequenzen daraus werden mittels Standard Transformationstechniken (Ausubel et al.) in die gewünschten Produktionsorganismen eingebracht. Die transgenen Organismen produzieren TS1 und TS2 und können aus den transgenen Organismen und/oder deren Kulturüberständen isoliert werden. Als Empfängerorganismen der DNS, die TS1 oder TS2 kodiert, kommen prokaryontische Bakterien, eukaryontische Mikroorganismen, Hefen und andere Pilze, eukaryontische Zellkulturen, Algen, Pflanzen, Samen, Tiere, Teile von Tieren, Gewebe, Hybridome, transgene Organismen und genbiologische, gentherapeutische und transgene Rekombinanten sowie davon abgeleitete Organismen, Organe, Gewebe und Zellen zum Einsatz. Die hier beanspruchten Enzyme können aus den entsprechenden Ganzen oder Teilen von transgenen Organismen, aus ihren Kulturüberständen, aus Organen, Gewebe, Zellen, biologische Flüssigkeiten, Exsudaten, Eiern, Blut, Lymphe, Milch, Pflanzen, Algen und Samen sowie aus Teilen davon isoliert werden.
Beispiel 5: Reaktionsbeispiel der Enzyme
6kg von Glycomakropeptid (GMP) werden zusammen mit 1kg Galaktooligosaccharide mit einer Kettenlänge von 6-10 Zucker in handelsüblichem 50mM Bis Tris Puffer pH 7,0 (z. B. von der Firma Merk, Darmstadt) gelöst. Die Lösung wird mit 1 Liter des Trans-Sialidase enthaltenden Kulturüberstandes von Trypanosoma congolense versetzt und bei 37°C 3 Stunden lang inkubiert. Nach diesem Zeitraum hat die Trans-Sialidase Sialinsäuren von dem GMP auf die Galaktooligosaccharide übertragen. Die sialisierten Produkte können mit Hilfe
üblicher chromatographischer Methoden (Ausubel et al.) oder Filtertechniken abgetrennt und gereinigt werden und stehen in reinem Zustand für Produktformulierungen zur Verfügung.
Glycomakropeptid (GMP) ist ein Abfallprodukt der Käseherstellung aus Kuhmilch. Nach Fällung des Caseins für die Käsezubereitung kann es aus der verbleibenden Molke mittels Filtertechniken isoliert werden.
Galaktooligosaccharide werden hergestellt, indem Laktose mittels des im Handel erhältlichen Enzyms beta-Galaktosidase umgesetzt wird. Bei dieser Umsetzung spaltet beta-Galaktosidase einerseits die Laktose in seine monomeren Zucker. Andererseits entstehen bei dieser Umsetzung in einer Nebenreaktion auch längerkettige Galaktooligosaccharide, die abgetrennt werden können und dann als Akzeptoren für die Trans-Sialidase Reaktion zur Verfügung stehen.
Beispiel 6: Verwendung der Enzyme
Die beiden isolierten Enzyme können beispielsweise zur Sialylierung von beta- Galaktose enthaltene Polymere (wie Gum arabicum etc.) und insbesondere für Poylactosamine und Galactane sowie für Galactooligosaccharide (GOS), insbesondere für beta-Galakto-Oligosaccharide, wie z. B. Vivinal GOS von der Firma Borculo Domo Ingredients (BDI) und Oligomate 55 von der Firma Yakult eingesetzt werden.
Diese polymeren Galaktose-Zucker und neu gebildete Galaktooligosaccharide (Herstellung wie in Beispiel 5 beschrieben) können mit Hilfe der in diesem Patent beanspruchten Trans-Sialidasen sialyliert werden.. Als Donoren für die Sialinsäuren können alle oben erwähnten Donoren und insbesondere das Glykomakropeptid aus Caseinen (von Mensch, Kuh, Ziege, Schaf, Pferd, Kamel und anderen Tieren) zum Einsatz kommen. Sialisierte Zuckerstrukturen weisen eine erhöhte Ähnlichkeit zu sauren Zuckern auf, die auch im menschlichen Körper gefunden werden können und dort vielfältige Aufgaben haben.
Literatur
Blix, F. G., Gottschalk, A. und Klenk, E. (1957). Proposed nomenclature in the field of neuraminic and sialic acids. Nature 179: 1088
Chuenkova M., Pereira M., (1999).Taylor G. trans-sialidase of Trypanosoma cruzi: Location of galactose-binding site(S). BIOCHEM BIOPHYS RES COMMUN; 262: 549-556.
Chuenkova M.V., Pereira M.A. (2001). The T. cruzi trans-sialidase induces PC12 cell differentiation via MAPK/ERK pathway. Neuroreport 12: 3715-3718.
Corfield A.P., Myerscough N., Warren B.F., Durdey P., Paraskeva C. and:Schauer R. (1999). Reduction of sialic acid O-acetylation in human colon mucins in the adenoma-carcinoma sequence, Glycoconjugate J. 16: 307-317
Cracker, P. R., Clark, E. A., Filbin, M., Gordon, S., Jones, Y., Kehrl, J. H., Keim, S., Le Douarin, N., Powell, L., Roder, J., Schnaar, R. L., Sgroi, D. C, Stamenkovic, K.,
Schauer, R., Schachner, M., van den Berg, T. K., van der Merwe, P. A., Watt, S. M. und Varki, A. (1998). Siglecs: a family of sialic-acid binding lectins. Glycobiology 8, v.
Engstier, M., Reuter, G. und Schauer, R. (1992). Purification and characterization of a novel sialidase found in procyclic culture forms of Trypanosoma brucei Mol. Biochem. Parasitol. 54: 21-30.
Engstier M., Reuter G., Schauer R. (1993). The developmentally regulated trans- sialidase from Trypanosoma brucei sialylates the procyclic acidic repetitive protein. Mol Biochem Parasitol; 61: 1-13. Engstier M., Schauer R., Brun R. (1995). Distribution of developmentally regulated trans-sialidases in the Kinetoplastida and characterization of a shed trans- sialidase activity from procyclic Trypanosoma congolense. Acta Trop; 59: 117-129.
Fahr C. and Schauer R. (2001). Detection of Sialic Acids and Gangliosides with Special Reference to 9-O-Acetylated Species in Basaliomas and Normal Human Skin, J. Invest. Dermatol. 116: 254-260
Gao W, Pereira MA. (2001). Trypanosoma cruzi trans-sialidase potentiates T cell activation through antigen-presenting cells: role of IL-6 and Bruton's tyrosine kinase. Eur J Immunol 31: 1503-1512.
Herrler, G., Rott, R., Klenk, H. D., Müller, H. P., Shukla, A. K. und Schauer, R. (1985). The receptor-destroying enzyme of influenza C virus is neuraminate-O- acetylesterase. EMBO J. 4, 1503-1506.
Higa, H. H., Rogers, G. N. und Paulson, J. C. (1985). Influenza virus hemagglutinins differentiate between receptor determinants bearing N-acetyl-, N-glycolyl-, and N,O- diacetyl-neuraminic acids. Virology 144: 279-282. Hubl U., Ishida H., Kiso M., Hasegawa A., and Schauer R. (2000). Studies on the Specificity and Sensitivity of the Influenza C Virus Binding Assay for O-Acetylated Sialic Acids and Its Application to Human Melanomas, J. Biochem. 127: 1021-1031
Keim, S. und Schauer, R. (1997). Sialic acids in molecular and cellular interactions. Int. Rev. Cytol. 175: 137-240. Keim, S., Schauer, R. und Crocker, P. R. (1996). The Sialoadhesins - a family of sialic acid-dependent cellular recognition molecules within the immunoglobulin superfamily. Glycoconj. J. 13: 913-926.
Lasky, L. A. (1995). Selectin-carbohydrate interactions and the initiation of the inflamma-tory response. Ann. Rev. Biochem. 64 , 113-139. Mattos-Guaraldi, A.L., Formiga, L.C.D. and Andrade, A.F.B. (1998). FEMS Microbiology Letters, 168: 167-172
Medina-Acosta E., Paul S., Tomlinson S., Pontes-de-Carvalho L.C. (1994). Combined occurrence of trypanosomal sialidase/trans-sialidase activities and leishmanial metalloproteinase gene homologues in Endotrypanum sp. Mol Biochem Parasitol; 64: 273-282.
Montagna G, Cremona ML, Paris G, Amaya MF, Buschiazzo A, Alzari PM, Frasch AC (2002). The trans-sialidase from the african trypanosome Trypanosoma brucei. Eur J Biochem; 269: 2941-2950.
Pilatte, Y., Bignon, J. und Lambre, C. R. (1993). Sialic acids as important molecules in the regulation of the immune System: pathophysiological implications of sialidases in immunity. Glycobiology 3: 201-218.
Pontes de Carvalho L.C., Tomlinson S., Vandekerckhove F., Bienen E.J., Clarkson A.B., Jiang M.S., Hart G.W., Nussenzweig V. (1993). Characterization of a novel trans-sialidase of Trypanosoma brucei procyclic trypomastigotes and identification of procyclin as the main sialic acid acceptor. J Exp Med; 777: 465-474.
Reuter, G. und Schauer, R. (1988). Nomenclature of sialic acids. Glycoconj. J. 5: 133-135. Reuter, G., Keim, S. und Schauer, R. (1988). Chemistry and biology of cell surface glyco-conjugates. Acta Histochem. Suppl. 36: 51-79.
Schauer R. (2000), Achievements and challenges of sialic acid research, Glycoconjugate J. 17: 485-499
Schauer, R. (1982). Chemistry, metabolism, and biological functions of sialic acids. Adv. Carbohydr. Chem. Biochem. 40: 131-234.
Schauer, R. (1985). Sialic acids and their role as biological masks. Trends Biochem. Sei. 10, 357-360.
Schauer, R. (1991). Biosynthesis and funetion of N- and O-substituted sialic acids. Glyco-biology 7: 449-452. Schauer, R. und Kamerling, J. P. (1997). Chemistry, biochemistry and biology of sialic acids. In Glycoproteins II. J. Montreuil, J. F. G. Vliegenthart, und H. Schachter, eds. (Amsterdam: Elsevier), pp. 243-402.
Schauer, R., Keim, S., Reuter, G., Roggentin, P. und Shaw, L. (1995). Biochemistry and role of sialic acids. In Biology of sialic acids. A. Rosenberg, ed. (New York: Plenum Press), pp. 7-67.
Schenkman, S., Jiang, M. S., Hart, G. W. und Nussenzweig, V. (1991). A novel cell surface trans-sialidase of Trypanosoma cruzi generates a stage-speeifie epitope required for invasion of mammalian cells. Cell 65: 1117-1125.
Sharon, N. und Lis, H. (1997). Microbial lectins and their glycoprotein receptors. In Glyco-proteins II. J. Montreuil, J. F. G. Vliegenthart und H. Schachter, eds. (Amsterdam: Elsevier), pp. 475-506.
Shaw, L. und Schauer, R. (1988). The biosynthesis of N-glycoloylneuraminic acid occurs by hydroxylation of the CMP-glycoside of N-acetylneuraminic acid. Biol. Chem. Hoppe-Seyler 369: 477-486.
Tertov V.V., Kaplun V.V., Sobenin I.A., Boytsova, E.Y., Bovin N.V. & Orekhov A.N. (2001). Human plasma trans-sialidase causes atherogenic modification of low density lipoprotein. Atherosclerosis 159: 103-115 Traving, C. und Schauer, R. (1998). Structure, function and metabolism of sialic acids. CMLS, Cell. Mol. Life Sei. 54: 1330-1349.
Varki, A., Hooshmand, F., Diaz, S., Varki, N. M. und Hedrick, S. M. (1991). Developmental abnormalities in transgenic mice expressing a sialic aeid-speeifie 9- O-acetylesterase. Cell 65: 65-74.
Claims
1. Polynukleotid, welches für ein Protein mit Trans-Sialidase-Aktivität kodiert und aus Trypanosoma congolense isolierbar ist.
2. Polynukleotid nach Anspruch 1 , welches für ein Protein mit Trans-
Sialidase-Aktivität kodiert, das den Transfer von Sialinsäure von einem Donor auf ein Akzeptormolekül katalysiert.
3. Polynukleotid, nach Anspruch 1 oder 2, umfassend eine
Nukleinsäuresequenz gemäß SEQ ID NO: 1 oder 3, oder Fragmente davon, welche wenigstens 15 zusammenhängende Nukleotidreste umfassen; die dazu komplementären Polynukleotide und Fragmente; und die von diesen Polynukleotiden durch Entartung des genetischen Codes abgeleiteten Nukleotidsequenzen.
4. Oligonukleotid, welches mit einem Polynukleotid nach einem der vorhergehenden Ansprüche, insbesondere unter stringenten Bedingungen, hybridisiert.
5. Polynukleotid, welches mit einem Oligonukleotid nach Anspruch 4, insbesondere unter stringenten Bedingungen, hybridisiert und für ein
Genprodukt aus Mikroorganismen der Gattung Trypanosoma kodiert.
6. Polypeptid, welches von einem Polynukleotid kodiert wird, das eine Nukleinsäuresequenz gemäß einem der Ansprüche 1 bis 3 oder 5 umfasst; oder welches eine Aminosäuresequenz aufweist, die wenigstens 10 zusammenhängende Aminosäuren gemäß SEQ ID NO: 2 oder 4 umfasst; sowie funktionale Äquivalente davon, welche Trans-Sialidase-Aktivität besitzen.
7. Trans-Sialidase oder funktionale Äquivalente davon mit Trans- Sialidase-Aktivität, gekennzeichnet durch eine der folgenden Aminosäureteilsequenzen:
TDTVAKYSTDGGRTWKREVIIPNGR (Pos. 1 bis 25 gemäß SEQ ID NO:2)
FRIPSLVEIDGVLIATFDTRYLRASDSSLI (Pos. 1 bis 30 gemäß SEQ ID
NO:4).
8. Trans-Sialidase 1 (TS1) gekennzeichnet durch wenigstens eines der folgenden Charakteristika:
9. Trans-Sialidase 2 (TS2), gekennzeichnet durch wenigstens eines der folgenden Charakteristika:
10. Stoff nach einem der Ansprüche 1 bis 9, abgeleitet aus dem Organismus Trypanosoma congolense.
1 1. Stoffe nach einem der Ansprüche 1 bis 9, hergestellt unter Anwendung synthetischer, insbesondere chemischer, biochemischer, enzymatischer, gentechnologischer und transgener Methoden.
12. Funktionales Äquivalent einer Trans-Sialidase nach einem der Ansprüche 8 und 9, deren Aminosäuresequenz oder -teilsequenz zur korrespondierenden Aminosäuresequenz oder -teilsequenz gemäß SEQ ID NO: 2 oder 4 eine Sequenzidentität von wenigsten 50 % oder wenigstens 60 %, insbesondere wenigstens 65 % oder wenigstens 70 %, wie z.B. 75%, 80%, 85%, 90%, 95%, 98% oder 99%, berechnet nach dem Algorithmus von Pearson und Lipman, Proc. Natl. Acad, Sei. (USA) 85(8), 1988, 2444-2448, aufweist; oder das eine oder mehrere Deletionen, Additionen, Substitutionen oder Inversionen einzelner oder mehrerer Aminosäurereste enthält oder ein verändertes Glykosylierungsmuster zeigt; wobei die Befähigung zur Katalyse der Übertragung von Sialinsäuren von einem Donor auf einen Akzeptor erhalten bleibt.
13. Expressionskassette, umfassend in operativer Verknüpfung mit wenigstens einer regulativen Nukleinsäuresequenz eine Nukleinsäuresequenz nach einem der Ansprüche 1 bis 5.
14. Rekombinanter Vektor, umfassend wenigstens eine Expressionskassette nach Anspruch 13.
15. Prokaryotischer oder eukaryotischer Wirt, transformiert mit wenigstens einem Vektor nach Anspruch 14.
16. Verwendung einer Expressionskassette nach Anspruch 13, eines Vektors nach Anspruch 14 oder eines Wirts nach Anspruch 15 zur rekombinanten Herstellung eines Proteins mit Trans-Sialidase-Aktivität.
17. Verfahren zur enzymatischen Sialisierung eines Akzeptormoleküls, dadurch gekennzeichnet, dass man das Akzeptormolekül mit einem Sialinsäurereste enthaltenden Donor in Gegenwart eines Enzyms nach einem der Ansprüche 6 bis 12 inkubiert und den sialylierten Akzeptor isoliert.
18. Verfahren nach Anspruch 17, gekennzeichnet durch wenigsten eine weitere der folgenden Eigenschaften:
a) der Donor ist ausgewählt unter an Oligosaccharide, Polysaccharide, Polysialinsäuren, Glykoproteine und Glykolipide gebundene Sialinsäuren, wie insbesondere Lactoferrine, glykolisierte Molkenproteine und Caseine und Fragmente davon;
b) der Akzeptor ist ausgewählt unter ß-Galaktose enthaltenden Polymeren, wie ß-Galaktooligosacchariden, Laktitol, Laktobionsäure, Methyl-ß-lactosid, Acetyllaktosaminen, Galaktopyranosiden, Trans-Galaktooligosacchariden, Polygalaktose und anderen Glykokonjugaten mit endständig gebundener ß(1-3) oder ß(1 -4)-Galaktose oder Galaktose.
19. Verwendung einer Trans-Sialidase nach einem der Ansprüche 6 bis 12, einer dafür kodierenden Nukleinsäuresequenz nach einem der Ansprüche 1 bis 5 oder eines nach einem der Ansprüche 18 und 19 hergestellten Sialisierungsprodukts zur Herstellung eines Medikaments, Nahrungsmittels oder Nahrungsergänzungsmittels oder einer Nahrungsmittelzutat zur Prävention oder Behandlung Sialinsäure- gesteuerter parasitärer, bakterieller oder viraler Infektionen; zur Behandlung von Tumorerkrankungen; zur Behandlung von Erkrankungen, welche mit einer Entwicklungsstörung des Gewebes assoziiert sind; zur Behandlung von Erkrankungen des Immunsystems; zur Behandlung von Autoimmunreaktionen; zur Behandlung von Erkrankungen mit gestörter Zellkommunikation; oder zur Behandlung von Entzündungen.
20. Verwendung einer Trans-Sialidase nach einem der Ansprüche 6 bis 12, zur Entwicklung eines Trypanosomiasis-Impfstoffs oder zur Entwicklung von Enzyminhibitoren zur Behandlung oder Prävention von Trypanosoma- Infektionen.
21. Verwendung einer Trans-Sialidase nach einem der Ansprüche 6 bis 12, einer dafür kodierenden Nukleinsäuresequenz nach einem der Ansprüche 1 bis 5 oder eines nach einem der Ansprüche 18 und 19 hergestellten sialylierten Produkts zur Herstellung eines Medikaments, Nahrungsergänzungsmittels oder Nahrungsmittels zur Schutz körpereigener Zellen oder Gewebe oder Glykoproteine vor enzymatischer Einwirkung.
22. Verwendung einer Trans-Sialidase nach einem der Ansprüche 6 bis 12, einer dafür kodierenden Nukleinsäuresequenz nach einem der
Ansprüche 1 bis 5 oder eines nach einem der Ansprüche 17 und 18 hergestellten sialylierten Produkts zur Herstellung eines Medikaments, Nahrungsergänzungsmittels oder Nahrungsmittels zu Beeinflussung der Entwicklung und/oder Morphogenese von Körpergeweben.
23. Effektor der Trans-Sialidase-Aktivität einer Trans-Sialidase nach einem der Ansprüche 6 bis 12, ausgewählt unter a) Polypeptid-Liganden, welche mit einer Trans-Sialidase nach einem der Ansprüche 6 bis 12 wechselwirken; b) niedermolekularen Effektoren, welche die biologische Aktivität einer Trans-Sialidase nach einem der Ansprüche 6 bis 12 modulieren; und c) Antisense-Nukleinsäuresequenzen zu einer Nukleinsäuresequenz nach einem der Ansprüche 1 bis 5.
24. Verwendung eines Effektors nach Anspruch 23 zur Herstellung eines pharmazeutisches oder gentherapeutisches Mittels, Nahrungsergänzungs-mittels oder Nahrungsmittels zur Behandlung oder Prävention von mit Trans-Sialidase-Aktivität assoziierten Erkrankungen.
25. Verfahren zur Isolierung eines Enzyms mit Trans-Sialidase- Ayktivität, wobei man a) Trypanosoma congolense in einem Medium kultiviert, b) und das gewünschte Produkt aus dem Kulturüberstand durch lonenaustauschchromatographie mit Hilfe eines Salzgradienten, gegebenenfalls gefolgt von Isoelektrischer Fokussierung, Gelfiltration, Affinitätschromatographie und/oder Proteinfällung, isoliert.
26. Pharmazeutisches oder gentherapeutisches Mittel, enthaltend in einem pharmazeutisch oder gentherapeutisch verträglichen Träger wenigsten einen Effektor nach Anspruch 23.
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DE10258400 | 2002-12-13 | ||
| DE10258400A DE10258400A1 (de) | 2002-12-13 | 2002-12-13 | Trans-Sialidasen aus Trypanosoma congolense |
| PCT/EP2003/014079 WO2004055176A2 (de) | 2002-12-13 | 2003-12-11 | Trans-sialidasen aus trypanosoma congolense |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| EP1570054A2 true EP1570054A2 (de) | 2005-09-07 |
Family
ID=32336317
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| EP03785794A Withdrawn EP1570054A2 (de) | 2002-12-13 | 2003-12-11 | Trans-sialidasen aus trypanosoma congolense |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US7655784B2 (de) |
| EP (1) | EP1570054A2 (de) |
| JP (1) | JP2006509515A (de) |
| CN (1) | CN1726279A (de) |
| AU (1) | AU2003294833A1 (de) |
| CA (1) | CA2509070A1 (de) |
| DE (1) | DE10258400A1 (de) |
| RU (1) | RU2393222C2 (de) |
| WO (1) | WO2004055176A2 (de) |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7807174B2 (en) * | 2002-11-22 | 2010-10-05 | Nexbio, Inc. | Class of therapeutic protein based molecules |
| AU2007317206B2 (en) * | 2006-11-10 | 2013-04-18 | Ondek Pty Ltd | Methods and devices for the delivery of peptides into the gastric mucosa |
| FR2952382B1 (fr) * | 2009-11-10 | 2011-11-25 | Univ Victor Segalen Bordeaux 2 | Vaccins et diagnostics contre les trypanosomoses animales africaines |
| FR2952649B1 (fr) | 2009-11-13 | 2012-05-04 | Univ Victor Segalen Bordeaux 2 | Applications therapeutiques et diagnostiques contre les trypanosomoses animales africaines |
| KR101221666B1 (ko) | 2010-06-18 | 2013-01-14 | 한국생명공학연구원 | 효모 표면 발현된 코리네박테리움 디프테리아 유래 트랜스-시알리다아제 및 이를 이용한 시알산 전구체 제조방법 |
| NL2007931C2 (en) * | 2011-12-07 | 2013-06-10 | Friesland Brands Bv | Methods for providing sialylated oligosaccharides and products obtainable thereby. |
| WO2013190530A1 (en) * | 2012-06-22 | 2013-12-27 | Glycom A/S | Modified galactooligosaccharides |
| WO2014167112A1 (en) * | 2013-04-12 | 2014-10-16 | Danmarks Tekniske Universitet | A mutant sialidase having trans-sialidase activity for use in production of sialylated glycans |
| CA2908407C (en) * | 2013-05-29 | 2022-06-14 | F. Hoffmann-La Roche Ag | Quantitative control of sialylation |
| CN114395545B (zh) * | 2021-04-22 | 2023-05-12 | 成都欧林生物科技股份有限公司 | 一种用于抵御幽门螺杆菌在胃内定植的唾液酸酶 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5949226A (en) * | 1995-04-10 | 1999-09-07 | Kabushiki Kaisha Toyoda Jidoshokki Seisakush | DC/DC converter with reduced power consumpton and improved efficiency |
-
2002
- 2002-12-13 DE DE10258400A patent/DE10258400A1/de not_active Withdrawn
-
2003
- 2003-12-11 CA CA002509070A patent/CA2509070A1/en not_active Abandoned
- 2003-12-11 AU AU2003294833A patent/AU2003294833A1/en not_active Abandoned
- 2003-12-11 WO PCT/EP2003/014079 patent/WO2004055176A2/de not_active Ceased
- 2003-12-11 JP JP2004559814A patent/JP2006509515A/ja active Pending
- 2003-12-11 EP EP03785794A patent/EP1570054A2/de not_active Withdrawn
- 2003-12-11 US US10/538,840 patent/US7655784B2/en not_active Expired - Fee Related
- 2003-12-11 RU RU2005122020/13A patent/RU2393222C2/ru not_active IP Right Cessation
- 2003-12-11 CN CNA2003801060029A patent/CN1726279A/zh active Pending
Non-Patent Citations (1)
| Title |
|---|
| See references of WO2004055176A2 * |
Also Published As
| Publication number | Publication date |
|---|---|
| RU2005122020A (ru) | 2006-01-27 |
| RU2393222C2 (ru) | 2010-06-27 |
| CA2509070A1 (en) | 2004-07-01 |
| AU2003294833A8 (en) | 2004-07-09 |
| US20070004656A1 (en) | 2007-01-04 |
| WO2004055176A3 (de) | 2005-05-26 |
| CN1726279A (zh) | 2006-01-25 |
| US7655784B2 (en) | 2010-02-02 |
| JP2006509515A (ja) | 2006-03-23 |
| AU2003294833A1 (en) | 2004-07-09 |
| DE10258400A1 (de) | 2004-06-24 |
| WO2004055176A2 (de) | 2004-07-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Traving et al. | Structure, function and metabolism of sialic acids | |
| Schauer | Sialic acids: fascinating sugars in higher animals and man | |
| Varki et al. | Sialic acids | |
| DE69928121T2 (de) | Verwendungen von sulfatierten fuko-oligosacchariden zum pflanzenschutz | |
| EP2437769B1 (de) | Rekombinante herstellung von peptiden | |
| EP1570054A2 (de) | Trans-sialidasen aus trypanosoma congolense | |
| DE69729449T2 (de) | Rekombinante alpha-2,3-sialyltransferasen und deren verwendung | |
| Zhu et al. | Tissue-specific expression of phospholipase C encoded by the norpA gene of Drosophila melanogaster | |
| DE69835929T2 (de) | Beta-galaktosid alpha-2,6-sialyltransferase kodierendes gen | |
| EP0786004B1 (de) | Klonierung, expression und charakterisierung einer neuen form der phosphatidylinositol-3-kinase | |
| Haksar et al. | Neuraminidase treatment of adrenal cells increases their response to cholera enterotoxin | |
| US6936448B2 (en) | Nucleic acids and proteins of a rat ganglioside GM1-specific α1-2fucosyltransferase and uses thereof | |
| Iguchi et al. | Isolation and characterization of a novel protein toxin from fire coral | |
| DE2930604A1 (de) | Doppelstrangige ribonucleinsaeure, verfahren zu ihrer herstellung und diese enthaltende interferon-induktoren | |
| Fukano et al. | Preparation of GM1 ganglioside with sialidase-producing marine bacteria as a microbial biocatalyst | |
| Bora et al. | Cloning and characterization of a putative mouse acetyl-CoA transporter cDNA | |
| Mulligan-Tuttle et al. | Expression of the small heat shock protein gene, hsp30, in Rana catesbeiana fibroblasts | |
| DE19935140A1 (de) | Neue Glykosyltransferase, ihre Herstellung und Verwendung | |
| Modi et al. | Functional relationship between ammonia and gangliosides in brain | |
| KR20040015343A (ko) | 아쉬비아 고쉬피로부터의 스트레스-관련 유전자 산물 | |
| EP1419254A2 (de) | Genprodukte aus ashbya gossypii, die mit dem transmembran-transport assoziiert sind | |
| DE19949595A1 (de) | CTAGE-Genfamilie | |
| EP1414962A1 (de) | Neue genprodukte aus ashbya gossypii, die mit den mechanismen der signaltransduktion und insbesondere mit der verbesserung der vitamin b2-produktion assoziiert sind | |
| EP1423420A2 (de) | Neue genprodukte aus ashbya gossypii, die mit den mechanismen der transkription, rna-prozessierung und/oder translation assoziert sind | |
| DE10139455A1 (de) | Neue Genprodukte aus Ashbya gossypii, die mit dem Transmembran-Transport assoziiert sind |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUAI | Public reference made under article 153(3) epc to a published international application that has entered the european phase |
Free format text: ORIGINAL CODE: 0009012 |
|
| 17P | Request for examination filed |
Effective date: 20050627 |
|
| AK | Designated contracting states |
Kind code of ref document: A2 Designated state(s): AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IT LI LU MC NL PT RO SE SI SK TR |
|
| AX | Request for extension of the european patent |
Extension state: AL LT LV MK |
|
| DAX | Request for extension of the european patent (deleted) | ||
| 17Q | First examination report despatched |
Effective date: 20061116 |
|
| STAA | Information on the status of an ep patent application or granted ep patent |
Free format text: STATUS: THE APPLICATION IS DEEMED TO BE WITHDRAWN |
|
| 18D | Application deemed to be withdrawn |
Effective date: 20130702 |