DK147404C - Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid - Google Patents
Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydridInfo
- Publication number
- DK147404C DK147404C DK392080A DK392080A DK147404C DK 147404 C DK147404 C DK 147404C DK 392080 A DK392080 A DK 392080A DK 392080 A DK392080 A DK 392080A DK 147404 C DK147404 C DK 147404C
- Authority
- DK
- Denmark
- Prior art keywords
- thiocarboxyan
- anhyride
- preparing
- asparaginic acid
- asparaginic
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D277/00—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
- C07D277/02—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
- C07D277/20—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
- C07D277/32—Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
- C07D277/34—Oxygen atoms
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Peptides Or Proteins (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Thiazole And Isothizaole Compounds (AREA)
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US06/089,641 US4256897A (en) | 1979-10-29 | 1979-10-29 | Process for the preparation of L-aspartic acid N-thiocarboxyanhydride |
| US8964179 | 1979-10-29 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| DK392080A DK392080A (da) | 1981-04-30 |
| DK147404B DK147404B (da) | 1984-07-23 |
| DK147404C true DK147404C (da) | 1985-02-04 |
Family
ID=22218775
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK392080A DK147404C (da) | 1979-10-29 | 1980-09-16 | Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid |
Country Status (17)
| Country | Link |
|---|---|
| US (1) | US4256897A (de) |
| EP (1) | EP0029305B1 (de) |
| JP (1) | JPS5679682A (de) |
| AR (1) | AR222911A1 (de) |
| AT (1) | ATE4207T1 (de) |
| AU (1) | AU517075B2 (de) |
| CA (1) | CA1142528A (de) |
| DE (1) | DE3064309D1 (de) |
| DK (1) | DK147404C (de) |
| ES (1) | ES8204429A1 (de) |
| GR (1) | GR70310B (de) |
| IE (1) | IE50363B1 (de) |
| IN (1) | IN154694B (de) |
| PH (1) | PH15077A (de) |
| PL (1) | PL126831B1 (de) |
| YU (1) | YU41008B (de) |
| ZA (1) | ZA806613B (de) |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4797298A (en) * | 1980-01-21 | 1989-01-10 | Pfizer, Inc. | Branched amides of L-aspartyl-D-amino acid dipeptides |
| US4870190A (en) * | 1980-01-21 | 1989-09-26 | Pfizer Inc. | Branched amides of L-aspartyl-D-amino acid dipeptides |
| US4321391A (en) * | 1980-11-05 | 1982-03-23 | Pfizer, Inc. | Preparation of L-aspartic acid N-thiocarboxyanhydride |
| IT1196167B (it) * | 1984-06-27 | 1988-11-10 | Chemi Spa | Procedimento per la preparazione di n-tiocarbossianidridi di amminoacidi |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| BE703384A (de) * | 1966-12-30 | 1968-03-01 | ||
| NL6808552A (de) * | 1967-06-30 | 1968-12-31 | ||
| US3846398A (en) * | 1969-04-17 | 1974-11-05 | Merck & Co Inc | Method for controlled stepwise synthesis of polypeptides utilizing n-thiocarboxy anhydrides of amino acids as reagents |
-
1979
- 1979-10-29 US US06/089,641 patent/US4256897A/en not_active Expired - Lifetime
-
1980
- 1980-09-15 IN IN674DE1980 patent/IN154694B/en unknown
- 1980-09-16 DK DK392080A patent/DK147404C/da not_active IP Right Cessation
- 1980-10-11 GR GR63145A patent/GR70310B/el unknown
- 1980-10-22 EP EP80303746A patent/EP0029305B1/de not_active Expired
- 1980-10-22 AT AT80303746T patent/ATE4207T1/de not_active IP Right Cessation
- 1980-10-22 DE DE8080303746T patent/DE3064309D1/de not_active Expired
- 1980-10-24 PL PL1980227474A patent/PL126831B1/pl unknown
- 1980-10-27 YU YU2748/80A patent/YU41008B/xx unknown
- 1980-10-27 AR AR283010A patent/AR222911A1/es active
- 1980-10-28 CA CA000363433A patent/CA1142528A/en not_active Expired
- 1980-10-28 ES ES496350A patent/ES8204429A1/es not_active Expired
- 1980-10-28 JP JP15131180A patent/JPS5679682A/ja active Granted
- 1980-10-28 PH PH24778A patent/PH15077A/en unknown
- 1980-10-28 IE IE2221/80A patent/IE50363B1/en not_active IP Right Cessation
- 1980-10-28 AU AU63764/80A patent/AU517075B2/en not_active Expired
- 1980-10-28 ZA ZA00806613A patent/ZA806613B/xx unknown
Also Published As
| Publication number | Publication date |
|---|---|
| PL126831B1 (en) | 1983-09-30 |
| DE3064309D1 (en) | 1983-08-25 |
| AU6376480A (en) | 1981-05-07 |
| YU274880A (en) | 1982-10-31 |
| IE802221L (en) | 1981-04-29 |
| JPS5679682A (en) | 1981-06-30 |
| IN154694B (de) | 1984-12-08 |
| IE50363B1 (en) | 1986-04-02 |
| CA1142528A (en) | 1983-03-08 |
| DK147404B (da) | 1984-07-23 |
| ATE4207T1 (de) | 1983-08-15 |
| US4256897A (en) | 1981-03-17 |
| AR222911A1 (es) | 1981-06-30 |
| GR70310B (de) | 1982-09-08 |
| EP0029305A1 (de) | 1981-05-27 |
| AU517075B2 (en) | 1981-07-09 |
| ZA806613B (en) | 1981-10-28 |
| PL227474A1 (de) | 1981-09-18 |
| PH15077A (en) | 1982-05-31 |
| EP0029305B1 (de) | 1983-07-20 |
| JPS6145988B2 (de) | 1986-10-11 |
| DK392080A (da) | 1981-04-30 |
| ES496350A0 (es) | 1982-05-01 |
| ES8204429A1 (es) | 1982-05-01 |
| YU41008B (en) | 1986-10-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
| DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
| DK277880A (da) | Fremgangsmaade til fremstilling af dipeptider | |
| DK479981A (da) | Fremgangsmaade til fremstilling af 3-aryl-3-hydroxyphthalimidiner | |
| DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
| DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
| DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
| DK147404C (da) | Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid | |
| DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer | |
| DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
| DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
| DK341980A (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
| DK144280A (da) | Fremgangsmaade til fremstilling af 2-aminopyraziner | |
| DK149472C (da) | Fremgangsmaade til fremstilling af phosphorchloridthiolater | |
| DK158038C (da) | Fremgangsmaade til fremstilling af di-n-propylacetonitril | |
| DK274480A (da) | Fremgangsmaade til fremstilling af pyrenzepin | |
| DK147420C (da) | Fremgangsmaade til fremstilling af acylcyanider | |
| DK160294C (da) | Fremgangsmaade til fremstilling af 3-oxycyclopentener | |
| DK545280A (da) | Fremgangsmaade til fremstilling af nitrothiazolinforbindelser | |
| DK158678A (da) | Fremgangsmaade til fremstilling af d-homosteroider | |
| DK159262C (da) | Fremgangsmaade til fremstilling af phenylethanolaminer | |
| DK146533C (da) | Fremgangsmaade til fremstilling af 4-nitrothioanisol | |
| DK87180A (da) | Fremgangsmaade til fremstilling af 3-formylcyproheptadiner | |
| DK195979A (da) | Fremgangsmaade til fremstilling af d-homosteroider | |
| DK153146C (da) | Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PUP | Patent expired |