DK132401C - Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf - Google Patents
Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte derafInfo
- Publication number
- DK132401C DK132401C DK301373*A DK301373A DK132401C DK 132401 C DK132401 C DK 132401C DK 301373 A DK301373 A DK 301373A DK 132401 C DK132401 C DK 132401C
- Authority
- DK
- Denmark
- Prior art keywords
- alicyclic
- salts
- preparation
- acid derivatives
- phenoxycarboxylic acid
- Prior art date
Links
- QIIPQYDSKRYMFG-UHFFFAOYSA-N phenyl hydrogen carbonate Chemical class OC(=O)OC1=CC=CC=C1 QIIPQYDSKRYMFG-UHFFFAOYSA-N 0.000 title 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C62/00—Compounds having carboxyl groups bound to carbon atoms of rings other than six—membered aromatic rings and containing any of the groups OH, O—metal, —CHO, keto, ether, groups, groups, or groups
- C07C62/30—Unsaturated compounds
- C07C62/34—Unsaturated compounds containing ether groups, groups, groups, or groups
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C51/00—Preparation of carboxylic acids or their salts, halides or anhydrides
- C07C51/347—Preparation of carboxylic acids or their salts, halides or anhydrides by reactions not involving formation of carboxyl groups
- C07C51/367—Preparation of carboxylic acids or their salts, halides or anhydrides by reactions not involving formation of carboxyl groups by introduction of functional groups containing oxygen only in singly bound form
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07C—ACYCLIC OR CARBOCYCLIC COMPOUNDS
- C07C69/00—Esters of carboxylic acids; Esters of carbonic or haloformic acids
- C07C69/74—Esters of carboxylic acids having an esterified carboxyl group bound to a carbon atom of a ring other than a six-membered aromatic ring
- C07C69/757—Esters of carboxylic acids having an esterified carboxyl group bound to a carbon atom of a ring other than a six-membered aromatic ring having any of the groups OH, O—metal, —CHO, keto, ether, acyloxy, groups, groups, or in the acid moiety
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Engineering & Computer Science (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP5484972A JPS575214B2 (enExample) | 1972-06-01 | 1972-06-01 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DK132401B DK132401B (da) | 1975-12-01 |
| DK132401C true DK132401C (da) | 1976-05-31 |
Family
ID=12982036
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DK301373*A DK132401C (da) | 1972-06-01 | 1973-05-30 | Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf |
Country Status (18)
| Country | Link |
|---|---|
| US (1) | US4082913A (enExample) |
| JP (1) | JPS575214B2 (enExample) |
| AU (1) | AU469089B2 (enExample) |
| BE (1) | BE800243A (enExample) |
| CA (1) | CA1002061A (enExample) |
| CH (1) | CH591412A5 (enExample) |
| CS (2) | CS172392B2 (enExample) |
| DD (1) | DD107015A5 (enExample) |
| DE (1) | DE2327659C2 (enExample) |
| DK (1) | DK132401C (enExample) |
| FI (1) | FI55328C (enExample) |
| FR (1) | FR2186268B1 (enExample) |
| GB (1) | GB1397697A (enExample) |
| HU (1) | HU166642B (enExample) |
| NL (1) | NL7307531A (enExample) |
| NO (1) | NO141553C (enExample) |
| SE (1) | SE390728B (enExample) |
| ZA (1) | ZA733641B (enExample) |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ZA200609870B (en) * | 2004-05-04 | 2009-12-30 | Acadia Pharm Inc | Compounds with activity at estrogen receptor |
| US7825265B2 (en) * | 2004-05-04 | 2010-11-02 | Acadia Pharmaceuticals Inc. | Compounds with activity at estrogen receptors |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2370256A (en) * | 1940-01-09 | 1945-02-27 | Joseph B Niederl | Alkylated phenolic glycolic acids |
| GB860303A (en) * | 1958-06-20 | 1961-02-01 | Ici Ltd | Pharmaceutical compositions comprising ª‡-aryloxy-aliphatic carboxylic acids and/or ª |
| US3097139A (en) * | 1960-03-10 | 1963-07-09 | Ici Ltd | Hypocholesterolaemia compositions |
| US3332957A (en) * | 1964-09-02 | 1967-07-25 | Ciba Geigy Corp | Amino esters of substituted phenoxy acetic acids |
| US3546273A (en) * | 1967-06-01 | 1970-12-08 | Merck & Co Inc | Ester derivatives of 2-(4-halophenoxy)alkanoic acids |
| FI52570C (fi) * | 1969-04-16 | 1977-10-10 | Sumitomo Chemical Co | Menetelmä veren kolesteroli- tai lipoidipitoisuutta alentavien fenoxia lifaattisten karboksyylihappoyhdisteiden ja -esteriyhdisteiden valmist amiseksi. |
| US4008265A (en) * | 1971-05-22 | 1977-02-15 | Sumitomo Chemical Company, Limited | Novel bisphenoxy carboxylic acid derivatives and their salts |
-
1972
- 1972-06-01 JP JP5484972A patent/JPS575214B2/ja not_active Expired
-
1973
- 1973-05-23 FI FI1671/73A patent/FI55328C/fi active
- 1973-05-29 ZA ZA733641A patent/ZA733641B/xx unknown
- 1973-05-29 SE SE7307620*A patent/SE390728B/xx unknown
- 1973-05-30 BE BE131687A patent/BE800243A/xx not_active IP Right Cessation
- 1973-05-30 DD DD171192A patent/DD107015A5/xx unknown
- 1973-05-30 DK DK301373*A patent/DK132401C/da active
- 1973-05-30 US US05/365,277 patent/US4082913A/en not_active Expired - Lifetime
- 1973-05-30 NO NO2261/73A patent/NO141553C/no unknown
- 1973-05-30 CH CH788273A patent/CH591412A5/xx not_active IP Right Cessation
- 1973-05-30 DE DE2327659A patent/DE2327659C2/de not_active Expired
- 1973-05-30 CS CS5085*A patent/CS172392B2/cs unknown
- 1973-05-30 AU AU56279/73A patent/AU469089B2/en not_active Expired
- 1973-05-30 CS CS3900A patent/CS172391B2/cs unknown
- 1973-05-30 NL NL7307531A patent/NL7307531A/xx not_active Application Discontinuation
- 1973-05-31 GB GB2593773A patent/GB1397697A/en not_active Expired
- 1973-05-31 CA CA172,797A patent/CA1002061A/en not_active Expired
- 1973-05-31 HU HUSU818A patent/HU166642B/hu unknown
- 1973-06-01 FR FR7320029A patent/FR2186268B1/fr not_active Expired
Also Published As
| Publication number | Publication date |
|---|---|
| NO141553B (no) | 1979-12-27 |
| DK132401B (da) | 1975-12-01 |
| HU166642B (enExample) | 1975-04-28 |
| CA1002061A (en) | 1976-12-21 |
| JPS4913156A (enExample) | 1974-02-05 |
| CH591412A5 (enExample) | 1977-09-15 |
| CS172392B2 (enExample) | 1976-12-29 |
| ZA733641B (en) | 1974-04-24 |
| DE2327659C2 (de) | 1984-03-22 |
| FR2186268A1 (enExample) | 1974-01-11 |
| AU5627973A (en) | 1974-12-05 |
| GB1397697A (en) | 1975-06-18 |
| FR2186268B1 (enExample) | 1976-05-14 |
| FI55328C (fi) | 1979-07-10 |
| DD107015A5 (enExample) | 1974-07-12 |
| BE800243A (fr) | 1973-09-17 |
| NO141553C (no) | 1980-04-09 |
| CS172391B2 (enExample) | 1976-12-29 |
| AU469089B2 (en) | 1976-02-05 |
| FI55328B (fi) | 1979-03-30 |
| JPS575214B2 (enExample) | 1982-01-29 |
| DE2327659A1 (de) | 1973-12-20 |
| NL7307531A (enExample) | 1973-12-04 |
| US4082913A (en) | 1978-04-04 |
| SE390728B (sv) | 1977-01-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DK132119C (da) | Analogifremgangsmade til fremstilling af cephalosporansyrederivater eller farmaceutisk acceptable salte deraf | |
| DK149893C (da) | Analogifremgangsmaade til fremstilling af thiazolderivater eller farmaceutisk acceptable salte deraf | |
| DK131725C (da) | Analogifremgangsmade til fremstilling af 2,4-diaminoquinazoliner eller salte deraf | |
| DK135585C (da) | Analogifremgangsmade til fremstilling af cycloheptenderivatereller syreadditionssalte deraf | |
| DK139387C (da) | Analogifremgangsmaade til fremstilling af apovincaminsyrederivater eller syreadditionssalte deraf | |
| DK134400B (da) | Analogifremgangsmade til fremstilling af (1-p-chlorbenzoyl)-5-methoxy-2-methyl-3-indol)acetoxyeddikesyre eller salte deraf | |
| DK138855C (da) | Analogifremgangsmaade til fremstilling af penicilliner eller ikke-toksiske farmaceutisk acceptable salte deraf | |
| DK149230C (da) | Analogifremgangsmaade til fremstilling af 5-benzoyl-6-hydroxy-indan-1-carboxylsyrederivater eller farmaceutisk acceptable salte deraf | |
| DK136468C (da) | Analogifremgangsmade til fremstilling af 1-ethylimidazoler eller salte deraf | |
| DK131778C (da) | Fremgangsmade til fremstilling af substituerede 3-hydroksymetylisokinolinderivater eller syreadditionssalte heraf | |
| DK131857C (da) | Analogifremgangsmade til fremstilling af 4-hydroxymethyl-1-phthalazonderivater eller syreadditionssalte deraf | |
| DK133153C (da) | Analogifremgangsmade til fremstilling af tetrahydrocyklopropadibenzazepinderivater eller salte deraf | |
| DK133980C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive diphenylalkyllactamimidderivater eller syreadditionssalte deraf | |
| DK137011B (da) | Analogifremgangsmade til fremstilling af oxazoler eller salte heraf | |
| DK134438C (da) | Analogifremgangsmade til fremstilling af pencilliner eller salte deraf | |
| DK133004C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive benzomorphanderivater eller salte deraf | |
| DK132401C (da) | Analogifremgangsmade til fremstilling af alicycliske phenoxycarboxylsyrederivater eller salte deraf | |
| DK135941C (da) | Analogifremgangsmaade til fremstilling af 1-cyclopropyl-1-phenyl-3-amino-1-propanoler eller syreaddittionssalte deraf | |
| SE402452B (sv) | Forfarande for framstellning av n-(dietylaminoetyl)-2-metoxi-4-amino-5-klorbensamid eller syraadditionssalter eller kvarternera ammoniumsalter derav | |
| DK132662C (da) | Analogifremgangsmade til fremstilling af 2beta,16beta-bis-(4-metyl-piperazino)-3alfa,17beta-diacetoxy-5alfa-androstan eller kvaternere salte deraf | |
| DK134517C (da) | Analogifremgangsmade til fremstilling af indolcarboxylsyrer eller estere eller salte heraf | |
| DK139427C (da) | Fremgangsmaade til fremstilling af benzensulfonylurinstoffer eller salte deraf | |
| DK133005C (da) | Analogifremgangsmade til fremstilling af racemisk eller optisk aktiv 1-cyclohexenyl-glycinamidopenicillansyre eller -cephalosporansyrer eller salte deraf | |
| DK132551C (da) | Analogifremgangsmade til fremstilling af racemiske eller optisk aktive carbamoylalkoxyphenoxyisopropanolaminderivater eller syreadditionssalte deraf | |
| DK132076C (da) | Fremgangsmade til fremstilling af benzomorphanderivater ellerdisses syreadditionssalte |