CN109402130A - A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application - Google Patents
A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application Download PDFInfo
- Publication number
- CN109402130A CN109402130A CN201811408920.1A CN201811408920A CN109402130A CN 109402130 A CN109402130 A CN 109402130A CN 201811408920 A CN201811408920 A CN 201811408920A CN 109402130 A CN109402130 A CN 109402130A
- Authority
- CN
- China
- Prior art keywords
- kgf
- plasmid
- recombinant
- mobile phase
- growth factor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000002360 preparation method Methods 0.000 title claims description 12
- 230000010261 cell growth Effects 0.000 title abstract description 13
- 239000013612 plasmid Substances 0.000 claims abstract description 24
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 24
- 230000014509 gene expression Effects 0.000 claims abstract description 9
- 230000006378 damage Effects 0.000 claims abstract description 5
- 210000001672 ovary Anatomy 0.000 claims abstract description 5
- 230000002685 pulmonary effect Effects 0.000 claims abstract description 5
- 241000699802 Cricetulus griseus Species 0.000 claims abstract description 4
- 230000003902 lesion Effects 0.000 claims abstract description 4
- 210000004400 mucous membrane Anatomy 0.000 claims abstract description 3
- 230000000451 tissue damage Effects 0.000 claims abstract description 3
- 231100000827 tissue damage Toxicity 0.000 claims abstract description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 claims description 21
- 238000010828 elution Methods 0.000 claims description 14
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 claims description 12
- 102000004169 proteins and genes Human genes 0.000 claims description 11
- 239000006228 supernatant Substances 0.000 claims description 7
- 239000013598 vector Substances 0.000 claims description 7
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 claims description 6
- 238000005571 anion exchange chromatography Methods 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 6
- 239000011780 sodium chloride Substances 0.000 claims description 6
- 238000001514 detection method Methods 0.000 claims description 5
- 229940079593 drug Drugs 0.000 claims description 5
- 239000012634 fragment Substances 0.000 claims description 5
- 239000001963 growth medium Substances 0.000 claims description 5
- 239000002773 nucleotide Substances 0.000 claims description 5
- 125000003729 nucleotide group Chemical group 0.000 claims description 5
- 238000005215 recombination Methods 0.000 claims description 5
- 230000006798 recombination Effects 0.000 claims description 5
- 238000004255 ion exchange chromatography Methods 0.000 claims description 4
- 239000007788 liquid Substances 0.000 claims description 4
- 238000000034 method Methods 0.000 claims description 4
- 238000005277 cation exchange chromatography Methods 0.000 claims description 3
- 239000000843 powder Substances 0.000 claims description 3
- 239000013589 supplement Substances 0.000 claims description 3
- 101100230376 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) celI gene Proteins 0.000 claims description 2
- 208000028990 Skin injury Diseases 0.000 claims description 2
- 238000004458 analytical method Methods 0.000 claims description 2
- 239000000470 constituent Substances 0.000 claims description 2
- 239000006167 equilibration buffer Substances 0.000 claims description 2
- 239000013613 expression plasmid Substances 0.000 claims description 2
- 238000001914 filtration Methods 0.000 claims description 2
- 230000002068 genetic effect Effects 0.000 claims description 2
- 239000000463 material Substances 0.000 claims description 2
- 239000013600 plasmid vector Substances 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 238000005341 cation exchange Methods 0.000 claims 1
- 230000008378 epithelial damage Effects 0.000 claims 1
- 230000004663 cell proliferation Effects 0.000 abstract description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 5
- 201000010099 disease Diseases 0.000 abstract description 4
- 238000000746 purification Methods 0.000 abstract description 3
- 238000004519 manufacturing process Methods 0.000 abstract description 2
- 230000012010 growth Effects 0.000 abstract 1
- 210000002510 keratinocyte Anatomy 0.000 abstract 1
- 210000003491 skin Anatomy 0.000 abstract 1
- 210000004027 cell Anatomy 0.000 description 17
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 15
- 102100028071 Fibroblast growth factor 7 Human genes 0.000 description 13
- 230000029087 digestion Effects 0.000 description 6
- 230000000694 effects Effects 0.000 description 6
- 230000009182 swimming Effects 0.000 description 6
- 239000002609 medium Substances 0.000 description 5
- 150000001413 amino acids Chemical group 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 210000002919 epithelial cell Anatomy 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 108020004414 DNA Proteins 0.000 description 3
- 241000588724 Escherichia coli Species 0.000 description 3
- 241000238631 Hexapoda Species 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 238000010353 genetic engineering Methods 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 238000004064 recycling Methods 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 2
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- 210000001552 airway epithelial cell Anatomy 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 229940098448 fibroblast growth factor 7 Drugs 0.000 description 2
- 239000012535 impurity Substances 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000009776 industrial production Methods 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 239000013558 reference substance Substances 0.000 description 2
- 238000004153 renaturation Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- ZSLUVFAKFWKJRC-IGMARMGPSA-N 232Th Chemical compound [232Th] ZSLUVFAKFWKJRC-IGMARMGPSA-N 0.000 description 1
- FAJIYNONGXEXAI-CQDKDKBSSA-N Ala-His-Phe Chemical compound C([C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 FAJIYNONGXEXAI-CQDKDKBSSA-N 0.000 description 1
- LXAARTARZJJCMB-CIQUZCHMSA-N Ala-Ile-Thr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O LXAARTARZJJCMB-CIQUZCHMSA-N 0.000 description 1
- VCSABYLVNWQYQE-SRVKXCTJSA-N Ala-Lys-Lys Chemical compound NCCCC[C@H](NC(=O)[C@@H](N)C)C(=O)N[C@@H](CCCCN)C(O)=O VCSABYLVNWQYQE-SRVKXCTJSA-N 0.000 description 1
- VCSABYLVNWQYQE-UHFFFAOYSA-N Ala-Lys-Lys Natural products NCCCCC(NC(=O)C(N)C)C(=O)NC(CCCCN)C(O)=O VCSABYLVNWQYQE-UHFFFAOYSA-N 0.000 description 1
- JWUZOJXDJDEQEM-ZLIFDBKOSA-N Ala-Lys-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C)C(O)=O)=CNC2=C1 JWUZOJXDJDEQEM-ZLIFDBKOSA-N 0.000 description 1
- RAAWHFXHAACDFT-FXQIFTODSA-N Ala-Met-Asn Chemical compound CSCC[C@H](NC(=O)[C@H](C)N)C(=O)N[C@@H](CC(N)=O)C(O)=O RAAWHFXHAACDFT-FXQIFTODSA-N 0.000 description 1
- VHAQSYHSDKERBS-XPUUQOCRSA-N Ala-Val-Gly Chemical compound C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O VHAQSYHSDKERBS-XPUUQOCRSA-N 0.000 description 1
- XEPSCVXTCUUHDT-AVGNSLFASA-N Arg-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CCCN=C(N)N XEPSCVXTCUUHDT-AVGNSLFASA-N 0.000 description 1
- BVLIJXXSXBUGEC-SRVKXCTJSA-N Asn-Asn-Tyr Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O BVLIJXXSXBUGEC-SRVKXCTJSA-N 0.000 description 1
- LVHMEJJWEXBMKK-GMOBBJLQSA-N Asn-Ile-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)O)NC(=O)[C@H](CC(=O)N)N LVHMEJJWEXBMKK-GMOBBJLQSA-N 0.000 description 1
- RVHGJNGNKGDCPX-KKUMJFAQSA-N Asn-Phe-Lys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N RVHGJNGNKGDCPX-KKUMJFAQSA-N 0.000 description 1
- UZFHNLYQWMGUHU-DCAQKATOSA-N Asp-Lys-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UZFHNLYQWMGUHU-DCAQKATOSA-N 0.000 description 1
- 102400000888 Cholecystokinin-8 Human genes 0.000 description 1
- 101800005151 Cholecystokinin-8 Proteins 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- BYALSSDCQYHKMY-XGEHTFHBSA-N Cys-Arg-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CS)N)O BYALSSDCQYHKMY-XGEHTFHBSA-N 0.000 description 1
- 102000012410 DNA Ligases Human genes 0.000 description 1
- 108010061982 DNA Ligases Proteins 0.000 description 1
- 241000305071 Enterobacterales Species 0.000 description 1
- 241001522296 Erithacus rubecula Species 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- CELXWPDNIGWCJN-WDCWCFNPSA-N Gln-Lys-Thr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)O)C(O)=O CELXWPDNIGWCJN-WDCWCFNPSA-N 0.000 description 1
- VXAIXLOYBPMZPT-JBACZVJFSA-N Gln-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N VXAIXLOYBPMZPT-JBACZVJFSA-N 0.000 description 1
- NADWTMLCUDMDQI-ACZMJKKPSA-N Glu-Asp-Cys Chemical compound C(CC(=O)O)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)N NADWTMLCUDMDQI-ACZMJKKPSA-N 0.000 description 1
- KLJMRPIBBLTDGE-ACZMJKKPSA-N Glu-Cys-Asn Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(O)=O KLJMRPIBBLTDGE-ACZMJKKPSA-N 0.000 description 1
- VGBSZQSKQRMLHD-MNXVOIDGSA-N Glu-Leu-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O VGBSZQSKQRMLHD-MNXVOIDGSA-N 0.000 description 1
- SOEPMWQCTJITPZ-SRVKXCTJSA-N Glu-Met-Lys Chemical compound CSCC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CCC(=O)O)N SOEPMWQCTJITPZ-SRVKXCTJSA-N 0.000 description 1
- MIIGESVJEBDJMP-FHWLQOOXSA-N Glu-Phe-Tyr Chemical compound C([C@H](NC(=O)[C@H](CCC(O)=O)N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 MIIGESVJEBDJMP-FHWLQOOXSA-N 0.000 description 1
- UFPXDFOYHVEIPI-BYPYZUCNSA-N Gly-Gly-Asp Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O UFPXDFOYHVEIPI-BYPYZUCNSA-N 0.000 description 1
- GDOZQTNZPCUARW-YFKPBYRVSA-N Gly-Gly-Glu Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCC(O)=O GDOZQTNZPCUARW-YFKPBYRVSA-N 0.000 description 1
- VEPBEGNDJYANCF-QWRGUYRKSA-N Gly-Lys-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CCCCN VEPBEGNDJYANCF-QWRGUYRKSA-N 0.000 description 1
- OQQKUTVULYLCDG-ONGXEEELSA-N Gly-Lys-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)CN)C(O)=O OQQKUTVULYLCDG-ONGXEEELSA-N 0.000 description 1
- CQMFNTVQVLQRLT-JHEQGTHGSA-N Gly-Thr-Gln Chemical compound [H]NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O CQMFNTVQVLQRLT-JHEQGTHGSA-N 0.000 description 1
- 244000286779 Hansenula anomala Species 0.000 description 1
- 235000014683 Hansenula anomala Nutrition 0.000 description 1
- SWBUZLFWGJETAO-KKUMJFAQSA-N His-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CC2=CN=CN2)N)O SWBUZLFWGJETAO-KKUMJFAQSA-N 0.000 description 1
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 1
- QTUSJASXLGLJSR-OSUNSFLBSA-N Ile-Arg-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H]([C@@H](C)O)C(=O)O)N QTUSJASXLGLJSR-OSUNSFLBSA-N 0.000 description 1
- AZEYWPUCOYXFOE-CYDGBPFRSA-N Ile-Arg-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](C(C)C)C(=O)O)N AZEYWPUCOYXFOE-CYDGBPFRSA-N 0.000 description 1
- PARSHQDZROHERM-NHCYSSNCSA-N Ile-Lys-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)O)N PARSHQDZROHERM-NHCYSSNCSA-N 0.000 description 1
- YJRSIJZUIUANHO-NAKRPEOUSA-N Ile-Val-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)O)N YJRSIJZUIUANHO-NAKRPEOUSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- UILIPCLTHRPCRB-XUXIUFHCSA-N Leu-Arg-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(C)C)N UILIPCLTHRPCRB-XUXIUFHCSA-N 0.000 description 1
- RFUBXQQFJFGJFV-GUBZILKMSA-N Leu-Asn-Gln Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O RFUBXQQFJFGJFV-GUBZILKMSA-N 0.000 description 1
- YVKSMSDXKMSIRX-GUBZILKMSA-N Leu-Glu-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O YVKSMSDXKMSIRX-GUBZILKMSA-N 0.000 description 1
- QONKWXNJRRNTBV-AVGNSLFASA-N Leu-Pro-Met Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)O)N QONKWXNJRRNTBV-AVGNSLFASA-N 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- GCMWRRQAKQXDED-IUCAKERBSA-N Lys-Glu-Gly Chemical compound [NH3+]CCCC[C@H]([NH3+])C(=O)N[C@@H](CCC([O-])=O)C(=O)NCC([O-])=O GCMWRRQAKQXDED-IUCAKERBSA-N 0.000 description 1
- DTUZCYRNEJDKSR-NHCYSSNCSA-N Lys-Gly-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN DTUZCYRNEJDKSR-NHCYSSNCSA-N 0.000 description 1
- VUTWYNQUSJWBHO-BZSNNMDCSA-N Lys-Leu-Tyr Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VUTWYNQUSJWBHO-BZSNNMDCSA-N 0.000 description 1
- 241000282560 Macaca mulatta Species 0.000 description 1
- HUURTRNKPBHHKZ-JYJNAYRXSA-N Met-Phe-Val Chemical compound CSCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C(C)C)C(O)=O)CC1=CC=CC=C1 HUURTRNKPBHHKZ-JYJNAYRXSA-N 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- WWXNZNWZNZPDIF-SRVKXCTJSA-N Pro-Val-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]1CCCN1 WWXNZNWZNZPDIF-SRVKXCTJSA-N 0.000 description 1
- GSCVDSBEYVGMJQ-SRVKXCTJSA-N Ser-Tyr-Asp Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](CO)N)O GSCVDSBEYVGMJQ-SRVKXCTJSA-N 0.000 description 1
- 229910052776 Thorium Inorganic materials 0.000 description 1
- VUSAEKOXGNEYNE-PBCZWWQYSA-N Thr-His-Asn Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CC(=O)N)C(=O)O)N)O VUSAEKOXGNEYNE-PBCZWWQYSA-N 0.000 description 1
- MGJLBZFUXUGMML-VOAKCMCISA-N Thr-Lys-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MGJLBZFUXUGMML-VOAKCMCISA-N 0.000 description 1
- LGEYOIQBBIPHQN-UWJYBYFXSA-N Tyr-Ala-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 LGEYOIQBBIPHQN-UWJYBYFXSA-N 0.000 description 1
- XDGPTBVOSHKDFT-KKUMJFAQSA-N Tyr-Met-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O XDGPTBVOSHKDFT-KKUMJFAQSA-N 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- COYSIHFOCOMGCF-UHFFFAOYSA-N Val-Arg-Gly Natural products CC(C)C(N)C(=O)NC(C(=O)NCC(O)=O)CCCN=C(N)N COYSIHFOCOMGCF-UHFFFAOYSA-N 0.000 description 1
- OQWNEUXPKHIEJO-NRPADANISA-N Val-Glu-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)O)N OQWNEUXPKHIEJO-NRPADANISA-N 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000008382 alveolar damage Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 108010080488 arginyl-arginyl-leucine Proteins 0.000 description 1
- 108010068265 aspartyltyrosine Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 210000000424 bronchial epithelial cell Anatomy 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- 208000020670 canker sore Diseases 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 238000005660 chlorination reaction Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 239000000284 extract Substances 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 239000007789 gas Substances 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 108010015792 glycyllysine Proteins 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 102000057239 human FGF7 Human genes 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 108010009298 lysylglutamic acid Proteins 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005374 membrane filtration Methods 0.000 description 1
- 108010056582 methionylglutamic acid Proteins 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 230000004899 motility Effects 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000003076 paracrine Effects 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- IZTQOLKUZKXIRV-YRVFCXMDSA-N sincalide Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](N)CC(O)=O)C1=CC=C(OS(O)(=O)=O)C=C1 IZTQOLKUZKXIRV-YRVFCXMDSA-N 0.000 description 1
- 206010040882 skin lesion Diseases 0.000 description 1
- 231100000444 skin lesion Toxicity 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000026676 system process Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 239000003440 toxic substance Substances 0.000 description 1
- 231100000397 ulcer Toxicity 0.000 description 1
- 230000002620 ureteric effect Effects 0.000 description 1
- IBIDRSSEHFLGSD-UHFFFAOYSA-N valinyl-arginine Natural products CC(C)C(N)C(=O)NC(C(O)=O)CCCN=C(N)N IBIDRSSEHFLGSD-UHFFFAOYSA-N 0.000 description 1
- 108010073969 valyllysine Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/02—Drugs for disorders of the urinary system of urine or of the urinary tract, e.g. urine acidifiers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Urology & Nephrology (AREA)
- Toxicology (AREA)
- Pulmonology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dermatology (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Abstract
The present invention relates to a kind of recombinant human horny cell growth factor-2-1 (KGF-1) production methods.The recombinant plasmid of the gene containing recombinant human horny cell growth factor-2-1 is also disclosed, the expression and purification step of the plasmid electrotransfection rear human horny cell growth factor-2 in Chinese hamster ovary line (CHO).The present inventor's keratinocyte growth factor-1 can remarkably promote 4MBr-5 cell Proliferation, suitable for treatment is because of skin and mucous membrane tissue damages relevant disease, pulmonary lesion related disease and treatment bladder or urothelial damages relevant disease.
Description
Technical field
The present invention relates to genetic engineering fields, and in particular to recombinant human horny cell growth factor-2-1 (rhKGF-1) and its
Preparation method and purposes.
Background technique
Human horny cell growth factor-2-1 (KGF-1 or KGF), also referred to as fibroblast growth factor-7 (FGF-7) are
People's Thorium Lung Burden proliferation, migration and a kind of important paracrine confactor of differentiation, pass through junctional epithelium cell
Receptor KGFR plays critical function.In the bronchial epithelial cell cultivated in vitro, KGF can accelerate epithelial cell to heal, enhancing
The reparation of human airway epithelial cells and the mobilization and migration for recycling epithelial cell.KGF promotes human airway epithelial cells proliferation and to activity
The removing toxic substances of oxygen is of great significance.In animal model, KGF can reduce alveolar damage and the death rate, can also reduce acute
Influence of the injury of lungs to gas exchanges region.In addition, cell division will be whole when primary urothelial lacks KGF culture
Only;It is knocked out in mouse in KGF, ureteric bud occurs, and kidney aggregation system is significantly less than the wild-type mice of control;KGF strikes
The bladder of mouse or urothelial thickness are also more considerably thinner than wild-type mice out.In the rat ulcer wing of cyclophosphamide induction
Guang inflammation model can almost improve exedens symptom with recombination KGF treatment completely.These prompt KGF in treatment pulmonary lesion phase
Related disorders, and treatment bladder or urothelial damage relevant disease.
Recombined human KGF (rhKGF) is a kind of KGF mutant or the like by N-terminal missing, the missing of N-terminal by
Proof has the function of enhancing protein stability, was ratified to list (Chinese by FDA as therapeutic recombinant proteins in 2004
Name: Pa Lifuming), for treating the serious canker sore because of high dose caused by radiotherapy and chemotherapy.The rhKGF of approved listing is by big
The production preparation of enterobacteria expression system, the system process is simple, low in cost, but extracts KGF from Escherichia coli and usually require
Active soluble protein can be just obtained by complex processes such as renaturation.Moreover, there is also potential for coli expression system
Safety problem.Chinese patent application (201210032424.7 and 201610458957.X) successively discloses and utilizes insect cell
With Pichia pastoris as host, KGF is recombinantly expressed.Relative to Escherichia coli, insect cell and Pichia anomala expression system it is excellent
Gesture is posttranslational modification and the product purification without protein renaturation.But either insect cell or Pichia pastoris, it is purified
KGF and native protein between still have activity difference.
Summary of the invention
To solve the above-mentioned problems, the present invention provides a kind of recombinant human horny cell growth factor-2s -1 (rhKGF-1).
The present invention provides a kind of nucleotide sequences as shown in SEQ ID NO:1.
A kind of recombinant vector is additionally provided, it includes nucleotide sequence shown in SEQ ID NO:1.Preferably, described
Recombinant vector is recombination pCMV plasmid.
A kind of recombinant cell is additionally provided, it includes recombinant vector above-mentioned.Preferably, the recombinant cell is recombination
Chinese hamster ovary Chinese hamster ovary celI.
Recombinant human horny cell growth factor-2-1 (rhKGF-1) provided by the invention, its core as shown in SEQ ID NO:1
Nucleotide sequence coding.Its amino acid sequence is as shown in SEQ ID NO:2.
The present invention also provides a kind of method for preparing aforementioned recombinant human horny cell growth factor-2-1 (rhKGF-1), packets
Containing following steps:
(1) recombinant cell above-mentioned is taken, business is inoculated in and is cultivated with suspending in serum-free addition culture medium A cti Pro, the phase
Between flow feeding Cell Boost 7a powder supplement twice, 37 DEG C of cultivation temperature, feed time be the 3rd day and
5th day, culture solution being collected under the conditions of 4 DEG C within the 7th day, being centrifuged, filtering obtains supernatant;
(2) take supernatant, isolated and purified with ion-exchange chromatography: first with anion-exchange chromatography, cation is exchanged again
Chromatography;
Mobile phase A is detected as equilibration buffer for rinsing tomographic system flow velocity 1.5mL/min when anion chromatography
Wavelength 254nm and 280nm;Gradient elution is carried out to its destination protein with Mobile phase B, collects elution samples, the gradient elution
Mode are as follows: 100-50%A, 0-50%B, elute 20min;
Mobile phase A when cation chromatography are as follows: 20mM citric acid, pH6.0;Mobile phase B are as follows: 20mM citric acid, chlorination containing 1M
Sodium, pH6.0;Flow velocity 1.5mL/min, Detection wavelength 254nm and 280nm;Gradient is carried out to its destination protein with Mobile phase B to wash
It is de-, collect elution samples to get;The mode of the gradient elution are as follows: 100-70%A, 0-30%B elute 20min;
The mobile phase A is the Tris-HCl solution of 20mM;The Mobile phase B is the Tris-HCl of the 20mM of 1M sodium chloride
Solution.
The present invention also provides aforementioned rhKGF-1 on preparation skin injury, mucous membrane tissue damage, pulmonary lesion, bladder
Purposes in skin lesion wound or the drug of urothelial damage.
The present invention also provides a kind of drugs, it is using rhKGF-1 as active constituent, in addition pharmaceutically acceptable auxiliary material
The preparation being prepared.
Sterling rhKGF-1 has been prepared in the present invention by way of genetic engineering, and bioactivity is good, and preparation method
Simply, it can be achieved that big industrial production, has good market application prospect.
Under the premise of not departing from the above-mentioned basic fundamental thought of the present invention, modification, the replacement of other diversified forms can also be made
Or change.
Detailed description of the invention
Fig. 1 plasmid pCMV schematic diagram.
Fig. 2 recombinant plasmid pCMV-KGF-1 schematic diagram.
Fig. 3 DNA gel electrophoretic analysis.1-9 swimming lane is the pCMV-KGF-1 monoclonal recombinant bacterial strain PCR product selected,
In, 2 and 9 swimming lanes are the recombinant clone bacterial strain of the sequence containing KGF-1.
Fig. 4 SDS-PAGE analysis.1 swimming lane is fermentation liquid, and M swimming lane is Marker, and 2 swimming lanes are to penetrate liquid, and 3-5 swimming lane is
Eluent.
Specific embodiment
The specific embodiment of form by the following examples makees further specifically above content of the invention
It is bright.But this should not be interpreted as to the scope of the above subject matter of the present invention is limited to the following embodiments.It is all above-mentioned interior based on the present invention
Hold realized technology to all belong to the scope of the present invention.
The preparation of the recombinant protein of the present invention of embodiment 1
1, the building of recombinant plasmid
(1) synthesis of human horny cell growth factor-2-1 (KGF-1) gene
Gene sequencing
Carry out KGF-1 coding region gene sequence (GenBank :) optimization, obtain KGF-1 gene order (SEQ ID NO:
1) and KGF-1 gene expression after amino acid sequence (SEQ ID NO:2).By Shanghai, Sheng Gong bioengineering Co., Ltd is synthesized,
The gene order of synthesis is recombinated into plasmid vector pUC57, and obtaining the plasmid comprising target gene is pUC57-KGF-1.
KGF-1 gene order (SEQ ID NO:1):
AGCTATGACTACATGGAAGGAGGCGATATCAGAGTGAGAAGACTGTTCTGTCGGACACAGTGGTACCTG
AGGATCGACAAGAGAGGCAAGGTGAAGGGCACCCAGGAGATGAAGAATAACTACAACATCATGGAAATCAGGACAGT
GGCCGTCGGAATCGTGGCCATCAAAGGAGTGGAAAGTGAATTCTATCTCGCCATGAACAAGGAAGGAAAGCTCTATG
CTAAGAAGGAGTGCAATGAAGATTGTAACTTCAAGGAACTCATTCTGGAAAACCATTACAACACATATGCCTCTGCT
AAGTGGACACACAACGGAGGCGAAATGTTCGTCGCCTTGAATCAGAAGGGCATTCCTGTCAGAGGAAAGAAAACCAA
GAAAGAACAGAAGACAGCCCACTTTCTGCCTATGGCTATCACTTAA
Amino acid sequence (SEQ ID NO:2) after KGF-1 gene expression
SYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNK
EGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
The plasmid portion sequence fragment (SEQ ID NO:3) of raw work biosynthesis gene order containing KGF-1:
GCAGATCTCCTAGGGCCACCATGGCCTGGATGATGCTTCTCCTCGGACTCCTTGCTTATGGATCAGGAG
TCGACTCTAGCTATGACTACATGGAAGGAGGCGATATCAGAGTGAGAAGACTGTTCTGTCGGACACAGTGGTACCTG
AGGATCGACAAGAGAGGCAAGGTGAAGGGCACCCAGGAGATGAAGAATAACTACAACATCATGGAAATCAGGACAGT
GGCCGTCGGAATCGTGGCCATCAAAGGAGTGGAAAGTGAATTCTATCTCGCCATGAACAAGGAAGGAAAGCTCTATG
CTAAGAAGGAGTGCAATGAAGATTGTAACTTCAAGGAACTCATTCTGGAAAACCATTACAACACATATGCCTCTGCT
AAGTGGACACACAACGGAGGCGAAATGTTCGTCGCCTTGAATCAGAAGGGCATTCCTGTCAGAGGAAAGAAAACCAA
GAAAGAACAGAAGACAGCCCACTTTCTGCCTATGGCTATCACTTGATTAATTAAGCG
(2) building of recombinant expression carrier
Double digestion is carried out to pCMV plasmid (as shown in Figure 1) and pUC57-KGF-1 plasmid, digestion system is centrifuged in 1.5ml
Following ingredient is established in pipe: above-mentioned 40 μ l of plasmid, 10 Cutsmart μ l, Avr II and each 5 μ l of Pac I (A/P), 50 μ of aqua sterilisa
L, 37 DEG C of reactions overnight, are recycled using QIAGEN Product Purification Kit after mixing, and recycling obtains vector linearization plasmid pCMV
(A/P) and target gene fragment KGF-1 (A/P).
Under the action of T4 ligase, plasmid pCMV (A/P) and KGF-1 (A/P) base that above-mentioned digestion recycling is obtained
Because segment connects, formed recombinant plasmid pCMV-KGF-1 (as shown in Figure 2).Such as lower body is established in connection reaction in 1.5mlEP pipe
System: 1 μ l of pCMV (A/P), 7 μ l of KGF-1 (A/P) genetic fragment, 10 × T4Buffer, 1 μ l, 1 T4DNAligase μ l, after mixing
4h or more is reacted under room temperature (20 DEG C or so), connection product is converted into Top10 competent escherichia coli cell, is applied to 2YT
(AMP) on plating medium, 37 DEG C of static overnight incubations of constant incubator, plate number is respectively pCMV-KGF-1.
By culture, the plasmid for carrying out recombinant bacterium is extracted, is then carried out the several recombination single colonies of picking from above-mentioned bacterium colony
Digestion, digestion system are that following ingredient is added in 1.5ml EP pipe: 7 μ l of plasmid, 1 Cutsmart μ l, Avr II and Pac I
(A/P) each 0.2 μ l, benefit aqua sterilisa react 4h at 37 DEG C after mixing to 10 μ l.Agarose gel electrophoresis analyzes result (as schemed
3).After digestion identification is correct, expression plasmid is largely extracted using QIAGEN Plasmid Midi Kit, and save backup.
2, it recombinantly expresses
Recombinant plasmid pCMV-KGF-1 (such as Fig. 2) is transfected through electric robin into CHO DG44 cell, cell after electricity is turned
Mixed liquor is transferred in the 6 orifice plates of the culture medium containing SFM4, is placed in 37 DEG C of incubators and is cultivated, and MTX (10nM) is added after 48h and is added
Pressure screening, restores to increase to 100nM to 90% or more, MTX to Cell viability;MTX to 500nM is added in cell, restores to motility rate
To after 90% or more, cell is transferred to shaking flask and suspended in business serum-free addition culture medium A cti Pro and is cultivated.Yu Pei
Support the 3rd and the 5th day respectively flow feeding Cell Boost 7a powder supplement continue to cultivate, the 7th day harvest is cultivated
Liquid is centrifuged 15min under the conditions of 4 DEG C, with 5000rpm, collects supernatant and is purified after 0.45 μm of membrane filtration.
3, it isolates and purifies:
It is purified using supernatant of the ion-exchange chromatography to above-mentioned expression cell, concrete operations are as follows:
Anion-exchange chromatography: 1mL HiTrapTM Q HP prepacked column is connected with AKTA purifier tomographic system.
Mobile phase A are as follows: 20mM Tris-HCl, pH 8.0;Mobile phase B are as follows: 20mM Tris-HCl, sodium chloride containing 1M, pH 8.0;Flow velocity
1.5mL/min, Detection wavelength 254nm and 280nm.Chromatographic column 5-10CV first is balanced with mobile phase A, to the cell for having collected processing
Supernatant carries out loading, and destination protein is incorporated on medium, and partial impurities penetrate.After end of the sample, using mobile phase A cleaning layer
Column 3-5CV is analysed, finally its destination protein is carried out gradient elution (100-50%A, 0-50%B, 20min) with Mobile phase B, is collected
Elution samples and by buffer exchange into 20mM citric acid (pH6.0).Chromatographic column is regenerated with the 1M sodium chloride of 3-5CV, is used in combination
0.1M sodium hydroxide is cleaned.
Cation-exchange chromatography: 1ml HitrapTM SP HP prepacked column is connected with AKTA purifier tomographic system.
Mobile phase A are as follows: 20mM citric acid, pH6.0;Mobile phase B are as follows: 20mM citric acid, sodium chloride containing 1M, pH6.0;Flow velocity 1.5mL/
Min, Detection wavelength 254nm and 280nm.Chromatographic column 5-10CV first is balanced with mobile phase A, anion chromatography is dialysed on sample
Sample, destination protein are incorporated on medium, and partial impurities penetrate.After end of the sample, chromatographic column 3- is rinsed using mobile phase A
5CV, linear gradient elution 100-70%A, 0-30%B, 20min.
The recombined human KGF-1 (rhKGF-1) that purifying is obtained using ion-exchange chromatography is examined according to SDS-PAGE electrophoresis
It surveys, as a result rhKGF-1 molecular weight of the invention meets expected (Fig. 4) about in 19-20KD.
The bioactivity of the recombined human KGF-1 (rhKGF-1) of the present invention of embodiment 2 detects
Recombined human KGF-1 and commercially available KGF-1 prepared by Example 1, compares their bioactivity:
Using F-12 culture medium culture 4MBr-5 rhesus macaque pulmonary branches tracheal epithelial cell, be then transferred to 96 well culture plates after
Continuous culture, is added the rhKGF-1 of beforehand dilution for 24 hours, makes its final concentration in 1-100ng/mL range, and total volume is 100 μ L,
Continue culture 48 hours in 37 DEG C of constant incubators.CCK8 solution is added after culture, 37 DEG C of incubation 1.5h set multifunctional examining
It surveys instrument and measures absorbance in 450nm, draw curve graph and calculate EC50 (medium effective concentration to stimulate cellular proliferation).
Testing result see the table below shown, and the present invention has in 1-100ng/mL concentration range obvious promotees 4MBr-5 cell Proliferation
Effect, effect present concentration dependent.RhKGF-1 of the invention, which is calculated, according to the result of 3 repetition experiments promotes 4MBr-
The medium effective concentration EC50 of 5 cell Proliferations is about 2.87 ± 0.32ng/mL, lower than reference substance KGF-1 (R&D company, activity
Unit is 1.3 × 106IU/mg EC50 (3.29 ± 0.28ng/mL)) shows the rhKGF biology using expressing cho cell
It is active high, there is good market application prospect.
RhKGF-1 of the invention is compared with the bioactivity of reference substance rhKGF-1
The experiment results show that the recombined human KGF-1 that the present invention is prepared, promotes the activity of epithelial cell growth excellent
It is good, hence it is evident that be better than commercially available KGF-1.
Sterling rhKGF-1 has been prepared in the present invention by way of genetic engineering, and bioactivity is good, and preparation method
Simply, it can be achieved that big industrial production, has good market application prospect.
SEQUENCE LISTING
<110>Hospital Affiliated To Chengdu Traditional Chinese Medicine Univ
<120>a kind of recombinant human horny cell growth factor-2-1 and its preparation method and application
<130> GY025-18P1711
<160> 3
<170> PatentIn version 3.5
<210> 1
<211> 423
<212> DNA
<213> Artificial Sequence
<220>
<223>KGF-1 gene
<400> 1
agctatgact acatggaagg aggcgatatc agagtgagaa gactgttctg tcggacacag 60
tggtacctga ggatcgacaa gagaggcaag gtgaagggca cccaggagat gaagaataac 120
tacaacatca tggaaatcag gacagtggcc gtcggaatcg tggccatcaa aggagtggaa 180
agtgaattct atctcgccat gaacaaggaa ggaaagctct atgctaagaa ggagtgcaat 240
gaagattgta acttcaagga actcattctg gaaaaccatt acaacacata tgcctctgct 300
aagtggacac acaacggagg cgaaatgttc gtcgccttga atcagaaggg cattcctgtc 360
agaggaaaga aaaccaagaa agaacagaag acagcccact ttctgcctat ggctatcact 420
taa 423
<210> 2
<211> 140
<212> PRT
<213> Artificial Sequence
<220>
<223>amino acid sequence after KGF-1 gene expression
<400> 2
Ser Tyr Asp Tyr Met Glu Gly Gly Asp Ile Arg Val Arg Arg Leu Phe
1 5 10 15
Cys Arg Thr Gln Trp Tyr Leu Arg Ile Asp Lys Arg Gly Lys Val Lys
20 25 30
Gly Thr Gln Glu Met Lys Asn Asn Tyr Asn Ile Met Glu Ile Arg Thr
35 40 45
Val Ala Val Gly Ile Val Ala Ile Lys Gly Val Glu Ser Glu Phe Tyr
50 55 60
Leu Ala Met Asn Lys Glu Gly Lys Leu Tyr Ala Lys Lys Glu Cys Asn
65 70 75 80
Glu Asp Cys Asn Phe Lys Glu Leu Ile Leu Glu Asn His Tyr Asn Thr
85 90 95
Tyr Ala Ser Ala Lys Trp Thr His Asn Gly Gly Glu Met Phe Val Ala
100 105 110
Leu Asn Gln Lys Gly Ile Pro Val Arg Gly Lys Lys Thr Lys Lys Glu
115 120 125
Gln Lys Thr Ala His Phe Leu Pro Met Ala Ile Thr
130 135 140
<210> 3
<211> 511
<212> DNA
<213> Artificial Sequence
<220>
<223>the plasmid portion sequence fragment of raw work biosynthesis gene order containing KGF-1
<400> 3
gcagatctcc tagggccacc atggcctgga tgatgcttct cctcggactc cttgcttatg 60
gatcaggagt cgactctagc tatgactaca tggaaggagg cgatatcaga gtgagaagac 120
tgttctgtcg gacacagtgg tacctgagga tcgacaagag aggcaaggtg aagggcaccc 180
aggagatgaa gaataactac aacatcatgg aaatcaggac agtggccgtc ggaatcgtgg 240
ccatcaaagg agtggaaagt gaattctatc tcgccatgaa caaggaagga aagctctatg 300
ctaagaagga gtgcaatgaa gattgtaact tcaaggaact cattctggaa aaccattaca 360
acacatatgc ctctgctaag tggacacaca acggaggcga aatgttcgtc gccttgaatc 420
agaagggcat tcctgtcaga ggaaagaaaa ccaagaaaga acagaagaca gcccactttc 480
tgcctatggc tatcacttga ttaattaagc g 511
Claims (10)
1. a kind of genetic fragment of recombined human KGF-1, it is characterised in that: its nucleotide sequence is as shown in SEQ ID NO:1.
2. a kind of recombinant vector, it is characterised in that: include nucleotide sequence shown in SEQ ID NO:1.
3. recombinant vector according to claim 2, it is characterised in that: the recombinant vector is pCMV plasmid.
4. a kind of recombinant plasmid, it is characterised in that: it includes nucleotide sequence and plasmid vector described in claim 2 and 3,
Be characterized in: the recombinant plasmid is expression plasmid pCMV-KGF-1.
5. a kind of recombinant cell for expressing recombined human KGF-1 gene, it is characterised in that include recombination described in claim 2 and 3
Plasmid.
6. requiring the expression cell according to right 4, it is characterised in that: the recombinant cell is the Chinese storehouse containing recombinant plasmid
Mouse ovary Chinese hamster ovary celI.
7. a kind of recombined human KGF-1, it is characterised in that: its amino acid sequence is as shown in SEQ ID NO:2.
8. a kind of method for preparing the recombined human KGF-1 of claim 1 or 7, it is characterised in that: comprise the following steps:
(1) recombinant cell described in claim 5 or 6 is taken, business is inoculated in and is hanged in serum-free addition culture medium A cti Pro
Floating culture, during which flow feeding Cell Boost 7a powder supplement twice, 37 DEG C of cultivation temperature, feed time
For the 3rd day and the 5th day, culture solution being collected under the conditions of 4 DEG C within the 7th day, being centrifuged, filtering obtains supernatant;
(2) supernatant is taken, is isolated and purified with ion-exchange chromatography: first with anion-exchange chromatography cation exchange layer again
Analysis;
Mobile phase A is as equilibration buffer when anion chromatography, for rinsing tomographic system flow velocity 1.5mL/min, Detection wavelength
254nm and 280nm;Gradient elution is carried out to its destination protein with Mobile phase B, collects elution samples, the side of the gradient elution
Formula are as follows: 100-50%A, 0-50%B elute 20min;
Mobile phase A when cation chromatography are as follows: 20mM citric acid, pH6.0;Mobile phase B are as follows: 20mM citric acid, sodium chloride containing 1M,
pH6.0;Flow velocity 1.5mL/min, Detection wavelength 254nm and 280nm;Gradient elution is carried out to its destination protein with Mobile phase B, is received
Collect elution samples to get;The mode of the gradient elution are as follows: 100-70%A, 0-30%B elute 20min;
The mobile phase A is the Tris-HCl solution of 20mM;The Mobile phase B is that the Tris-HCl of the 20mM of 1M sodium chloride is molten
Liquid.
9. the recombined human KGF-1 of claim 7 or 8 treats skin injury, mucous membrane tissue damage, pulmonary lesion, wing in preparation
Purposes in Guang epithelial damage or the drug of urothelial damage.
10. a kind of drug, it is characterised in that: it is using the recombined human KGF-1 of claim 7 or 8 as active constituent, in addition medicine
The preparation that acceptable auxiliary material is prepared on.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201811408920.1A CN109402130A (en) | 2018-11-23 | 2018-11-23 | A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201811408920.1A CN109402130A (en) | 2018-11-23 | 2018-11-23 | A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application |
Publications (1)
Publication Number | Publication Date |
---|---|
CN109402130A true CN109402130A (en) | 2019-03-01 |
Family
ID=65455368
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201811408920.1A Pending CN109402130A (en) | 2018-11-23 | 2018-11-23 | A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN109402130A (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110183529A (en) * | 2019-05-23 | 2019-08-30 | 重庆派金生物科技有限公司 | A kind of recombination and preparation of deletion human keratinocyte growth factor-1 |
CN110339345A (en) * | 2019-07-30 | 2019-10-18 | 重庆派金生物科技有限公司 | A kind of recombined human truncated-type keratinocyte growth factor-1 eye drops and its preparation method and application |
KR20220028520A (en) * | 2020-08-28 | 2022-03-08 | 한국해양과학기술원 | Thermally stable fgf7 polypeptide and use of the same |
Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1169733A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Analogs of keratinocyte growth factor |
CN1169734A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Method for purifying keratinocyte growth factors |
CN1169732A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Keratinocyte growth factor analogs |
CN1234071A (en) * | 1996-08-13 | 1999-11-03 | 人类基因组科学公司 | Keratinocyte grouth factor -2(KGF-2 or fibroblast growth factor-12, FGF-12) |
US7265089B2 (en) * | 2001-08-21 | 2007-09-04 | Chiron Corporation | KGF polypeptide compositions |
CN101084008A (en) * | 2004-12-15 | 2007-12-05 | 安姆根有限公司 | Therapeutic formulations of keratinocyte growth factor |
US8906681B2 (en) * | 2011-08-02 | 2014-12-09 | The Scripps Research Institute | Reliable stabilization of N-linked polypeptide native states with enhanced aromatic sequons located in polypeptide tight turns |
CN106350523A (en) * | 2016-11-25 | 2017-01-25 | 奥普金生物科技(深圳)有限公司 | Human epididymis protein 4 (HE4) gene sequence, HE4 protein and preparation method |
-
2018
- 2018-11-23 CN CN201811408920.1A patent/CN109402130A/en active Pending
Patent Citations (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1169733A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Analogs of keratinocyte growth factor |
CN1169734A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Method for purifying keratinocyte growth factors |
CN1169732A (en) * | 1994-10-13 | 1998-01-07 | 安姆根有限公司 | Keratinocyte growth factor analogs |
CN1234071A (en) * | 1996-08-13 | 1999-11-03 | 人类基因组科学公司 | Keratinocyte grouth factor -2(KGF-2 or fibroblast growth factor-12, FGF-12) |
US7265089B2 (en) * | 2001-08-21 | 2007-09-04 | Chiron Corporation | KGF polypeptide compositions |
CN101084008A (en) * | 2004-12-15 | 2007-12-05 | 安姆根有限公司 | Therapeutic formulations of keratinocyte growth factor |
US8906681B2 (en) * | 2011-08-02 | 2014-12-09 | The Scripps Research Institute | Reliable stabilization of N-linked polypeptide native states with enhanced aromatic sequons located in polypeptide tight turns |
CN106350523A (en) * | 2016-11-25 | 2017-01-25 | 奥普金生物科技(深圳)有限公司 | Human epididymis protein 4 (HE4) gene sequence, HE4 protein and preparation method |
Non-Patent Citations (1)
Title |
---|
PRABIR RAY ET AL.: "Inducible expression of keratinocyte growth factor (KGF) in mice inhibits lung epithelial cell death induced by hyperoxia", 《PNAS》 * |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110183529A (en) * | 2019-05-23 | 2019-08-30 | 重庆派金生物科技有限公司 | A kind of recombination and preparation of deletion human keratinocyte growth factor-1 |
CN110183529B (en) * | 2019-05-23 | 2023-06-02 | 重庆派金生物科技有限公司 | Recombinant preparation method of deletion type human keratinocyte growth factor-1 |
CN110339345A (en) * | 2019-07-30 | 2019-10-18 | 重庆派金生物科技有限公司 | A kind of recombined human truncated-type keratinocyte growth factor-1 eye drops and its preparation method and application |
CN110339345B (en) * | 2019-07-30 | 2022-11-29 | 重庆派金生物科技有限公司 | Recombinant human truncated keratinocyte growth factor-1 eye drops and preparation method and application thereof |
KR20220028520A (en) * | 2020-08-28 | 2022-03-08 | 한국해양과학기술원 | Thermally stable fgf7 polypeptide and use of the same |
KR102440312B1 (en) | 2020-08-28 | 2022-09-05 | 한국해양과학기술원 | Thermally stable fgf7 polypeptide and use of the same |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2005283025B2 (en) | Muteins of fibroblast growth factor 21 | |
CN110845603A (en) | Human collagen 17-type polypeptide, production method and use thereof | |
CN106632682A (en) | Fusion protein IFN-ELP and application thereof | |
CN109402130A (en) | A kind of recombinant human horny cell growth factor-2-1 and its preparation method and application | |
CN111217903B (en) | Recombinant human fibronectin III 1-C and preparation method and application thereof | |
CN108610398A (en) | One section of functional sequence and the application in secretory protein expression | |
CN102295695B (en) | Recombinant human follicle stimulating hormone and preparation thereof | |
CN102219848B (en) | Purification method for recombinant human interferon beta-1a | |
CN101514229B (en) | Human interferon alpha derivative and polyethylene glycol modified substance thereof | |
CN113735960B (en) | Application of FGF recombinant protein in treating NASH | |
CN112500472B (en) | Cat omega interferon mutant and preparation method and application thereof | |
CN113150173A (en) | Recombinant human collagen peptide and preparation method and application thereof | |
CN109251896A (en) | The cell strain and its preparation method and application of one Expression of Plant Height hKLs-his albumen | |
SK43097A3 (en) | Method for purifying keratinocyte growth factors | |
CN113292656A (en) | Fusion protein of mesencephalon astrocyte-derived neurotrophic factor for preventing and treating obesity | |
CN104558199B (en) | A kind of fusion protein preparation for treating hypercholesterolemia and application thereof | |
CN108484749A (en) | A kind of recombinant soluble human source Bone targeting gamma interferon 1-b and preparation method thereof | |
CN101875699A (en) | Fusion protein of human epidermal growth factor and metallothionein and preparation method and application thereof | |
CN108456681A (en) | The assortment of genes of efficiently expressing recombinant human nerve growth factor | |
JP3104178B2 (en) | Functional polypeptide | |
CN103898123B (en) | Recombined human IFN-β -1a and its production and purification process | |
CN104211808B (en) | A kind of preparation method of tumor necrosin relative death inducing ligand fusion protein | |
CN112646044A (en) | TFF2-Fc fusion protein and high-efficiency expression production method thereof | |
CN114621327A (en) | GLP-1, GIP and Gcg multi-receptor agonist proteins | |
CN100500844C (en) | High secretion expression of recombination thymosin-alpha 1 in Escherichia coli and separation and purification therefor |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
RJ01 | Rejection of invention patent application after publication |
Application publication date: 20190301 |
|
RJ01 | Rejection of invention patent application after publication |