CN108165561A - Mycobacterium tuberculosis H37Rv encoding gene and its application - Google Patents

Mycobacterium tuberculosis H37Rv encoding gene and its application Download PDF

Info

Publication number
CN108165561A
CN108165561A CN201711250170.5A CN201711250170A CN108165561A CN 108165561 A CN108165561 A CN 108165561A CN 201711250170 A CN201711250170 A CN 201711250170A CN 108165561 A CN108165561 A CN 108165561A
Authority
CN
China
Prior art keywords
mycobacterium tuberculosis
encoding gene
gene
sequence
tuberculosis h37rv
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
CN201711250170.5A
Other languages
Chinese (zh)
Other versions
CN108165561B (en
Inventor
徐平
张瑶
王富强
孙金帅
武舒佳
常蕾
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Academy of Military Medical Sciences AMMS of PLA
Original Assignee
BEIJING PROTEOME RESEARCH CENTER
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by BEIJING PROTEOME RESEARCH CENTER filed Critical BEIJING PROTEOME RESEARCH CENTER
Priority to CN201711250170.5A priority Critical patent/CN108165561B/en
Publication of CN108165561A publication Critical patent/CN108165561A/en
Application granted granted Critical
Publication of CN108165561B publication Critical patent/CN108165561B/en
Active legal-status Critical Current
Anticipated expiration legal-status Critical

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
    • C12Q1/689—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Health & Medical Sciences (AREA)
  • Analytical Chemistry (AREA)
  • Biophysics (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Wood Science & Technology (AREA)
  • Engineering & Computer Science (AREA)
  • Physics & Mathematics (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)

Abstract

The present invention relates to a kind of encoding genes of Mycobacterium tuberculosis H37Rv, can be used as the standard gene of mycobacterium tuberculosis complex Molecular Identification, for the Molecular Identification and clinical detection of mycobacterium tuberculosis complex.

Description

Mycobacterium tuberculosis H37Rv encoding gene and its application
Technical field
The present invention relates to genetic test fields, and in particular to pathogen species are identified.
Background technology
Mycobacterium tuberculosis (Mycobacterium tuberculosis, MTB) is to cause mankind pathogen lungy. Each organ of whole body can be invaded, but using pulmonary tuberculosis to be most common.Tuberculosis is infectious disease particularly important so far, the serious threat mankind Life and health.According to WHO, every year there are about 8,000,000 new cases generation, at least 3,000,000 people die of the disease.The clinical bacterium of MTB Strain hardly possible cultivates, is slow-growing and other mycobacteria energy cross-infections, tuberculosis and other respiratory tract infection symptom difficulties are distinguished etc. Feature brings great difficulty to clinical quick diagnosis and treatment.Therefore establish quick, accurate, special, sensitive, cheap knot Core disease detection method is the prerequisite and clinical labororatory's mycobacteria detection faces of effective treatment, control tuberculosis sprawling The new challenge faced and new task.
Mycobacterium tuberculosis complex (Mycobacterium tuberculosis complex, MTBC), including M.tuberculosis、M.africanum、M.orygis、M.bovis、M.microti、M.canettii、M.caprae、 The mycobacterias monoid such as M.pinnipedii, M.suricattae, M.mungi, these species can cause people and other life Body tuberculosis.Following three classes are broadly divided into the identification method of MTBC both at home and abroad at present：Traditional isolated culture；Molecular level is examined It surveys (IS6110, restriction fragment length polymorphism analysis, multidigit point variable number repeated fragment polymorphism analysis etc.)；Thalline into Divide (aliphatic acid, mycolic acid) chromatogram analysis method.Though three classes method has the advantages of respective, also there is shortcoming, such as pass System is separately cultured period length, and with thalline can to cultivate rate low；Molecular level detection at present is in terms of specificity, sensitivity and simplicity It is still poorer；Drive member specificity analysis cost is higher, complicated for operation.
MTB H37Rv completed genome sequencing in 1998, were the earliest MTB bacterial strains for completing full figure sequencing.Since then, respectively State researchers are tactful based on algorithm optimization, annotating software update, transcription group and proteomics etc., always in perfect, benefit Fill H37Rv gene annotation databases.However, since MTB belongs to prokaryotes, due to prokaryotic gene group remarking technology in itself Deficiency, in genome annotation still there may be annotation mistake (excessively annotation, genetic borders mistake and ORF starting, stop bit Point mistake, alternative splicing, ribosomes displacement, leakage annotation), to deeply, accurately parse biological mechanism bring puzzlement.To solve This problem, protein gene group (Proteogenomics) though have been used for the correction that H37Rv has annotated gene, however, high Ratio false positive, routine techniques are difficult to annotation predictive genes, new gene verification, new gene functional analysis and its application etc. The problem that the field is faced.
Generally speaking, traditional mycobacterium tuberculosis complex (MTBC) identification strategy has period length, complex steps, specifically The defects of property and sensitivity is not high.H37Rv full-length genomes are annotated again further to improve, find to omit annotation in H37Rv Gene, it is ensured that H37Rv full-length genomes omit annotation gene and its application technology in MTBC Molecular Identifications is effectively protected, It is imperative to develop and use H37Rv new genes fast accurate mirror method for distinguishing in MTBC monoids.
Invention content
It is an object of the present invention to provide a kind of new encoding gene of Mycobacterium tuberculosis H37Rv, which is H37Rv Leakage annotation encoding gene Rv1879c (- | 2130001-2130255 |), it can be used as mycobacterium tuberculosis complex bar code point Son label, for detecting mycobacterium tuberculosis complex, sequence is as shown in SEQ ID NO.1.
Other objects of the present invention include providing Specific PCR primers and the offer that can be used for expanding above-mentioned encoding gene It is a kind of to detect or identify the detection method that whether there is mycobacterium tuberculosis complex in sample；The present invention also provides with above-mentioned volume The application of the detection kit and said gene of code gene-correlation.
According to an aspect of the present invention, by comparing protein gene group investigative technique, it was found that one in H37Rv It is difficult to by the albumen coded sequence of predictive genes software discovery, which can be effectively by MTBC and the other species differentiations belonged to It comes.The gene is the omission annotation base of a mycobacterium tuberculosis (Mycobacterium tuberculosis H37Rv) Cause, i.e. Rv1879c (- | 2130001-2130255 |), it is only compared after NCBI-BLASTP, in database to one plant M.tuberculosis N09901297 have Protein annotation information, but belong to Unknown Function albumen.Through comparative genomics Research finds that the gene order can distinguish other kinds of mycobacterium tuberculosis complex (MTBC) bacterial strain and Mycobacterium Come.
Specifically, design can realize specific amplification to the Rv1879c of MTBC (- | 2130001-2130255 |) gene Primer, primer as proposed by the invention, primer sequence F:5 '-CCCAGGTAGTGCACACTCAA-3 ' and R:5’- TTACAGGATCGGGTTCTGCT-3’.The presence or absence of gene DNA sequence PCR product in sample to be tested or DNA sequence dna Difference, can quick and precisely identification of M TBC.
According to another aspect of the present invention, based on the new standard code gene of above-mentioned Mycobacterium tuberculosis H37Rv, this hair The bright method for specifically establishing detection or identifying mycobacterium tuberculosis complex, step are as follows：
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) DNA obtained using step (1) carries out PCR amplification as template using following primer：
F:5’-CCCAGGTAGTGCACACTCAA-3’(SEQ ID NO.4)；
R:5’-TTACAGGATCGGGTTCTGCT-3’(SEQ ID NO.5)。
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) result of step (3) and bar code gene Rv1879c (- | 2130001-2130255 |) are compared, such as Fruit homology is more than 99%, and judgement sample to be tested contains mycobacterium tuberculosis complex.
Further, above-mentioned detection method according to DNA bar code principle, tentatively carries out electrophoretic analysis, such as to PCR product Fruit strain to be tested does not have target stripe, and it is not MTBC to illustrate the bacterial strain；If there is band, then can further sequence verification, will survey The standard sequence that sequence obtains series and the Rv1879c of H37Rv (- | 2130001-2130255 |) carries out Homology search and comparison, obtains The similitude between sequence is obtained, if sequence homology is more than 99%, you can judgement bacterial strain may be MTBC；According to identification bacterium to be identified The DNA bar code sequence of strain and standard sequence cluster situation are common to distinguish MTBC families and non-tuberculous mycobacteria, respiratory tract Pathogen and common respiratory tract virus.
The detection method can be used to the strain idenfication research to mycobacterium tuberculosis complex, may can also be used for clinic It is quick to examine.Sample to be tested can be from H37Rv bacterial strains, other MTBC, non-tuberculous mycobacteria, respiratory tract encountered pathogenic bacteria, Common respiratory tract virus bacterial strain；Either directly using tuberculosis and other respiratory tract patient sputums, saliva or blood.
Based on the above method, the present invention also provides detection kit, and kit containers are built-in to detect knot The reagent of standard code gene new core mycobacteria H37Rv, what is concurrently provided can be through governmental drug management organization Manufacture, use and sales informations audit, in relation to drug or biological products.For example, after using PCR amplification, sample is directly detected The reagent of Rv1879c in product (- | 2130001-2130255 |) gene, for example, containing amplimer, for the DNA of PCR reactions Polymerase and its buffer solution, endonuclease reaction and/or reagent needed for sequencing reaction etc. it is one or more.Those skilled in the art are Know, more than component is only illustrative, for example, above-mentioned Specific PCR primers may be used in the primer, described is used for The archaeal dna polymerase of PCR reactions can be used for the enzyme of PCR amplification.The example that the detection of the encoding gene of the present invention can also integrate Mode such as genetic chip provides.
Advantageous effect：The present invention provides one kind to be used as mycobacterium tuberculosis complex (Mycobacterium Tuberculosis complex, MTBC) Molecular Identification standard gene and method for identifying molecules, the gene can effectively by MTBC comes with the other species differentiations belonged to, and existing mycobacterium tuberculosis complex is overcome using the identification method of the gene The shortcomings of design of primers multiplicity in qualification process, result poor repeatability, has the characteristics that general, easy amplification, easily compares, can Accurately to identify to come from the close other mycobacterias of affiliation or other respiratory tract infection germs by the monoid, it is Tuberculosis epidemiological survey and clinical tuberculosis patient quick diagnosis differentiate the strong technological means of offer and research tool.
Description of the drawings
Fig. 1：Support the peptide spectrum matching evidence of the newly encoded gene found；
Fig. 2：Section of synthesized peptide IGLVQISVPVAK mass spectrograms are compared with former identification peptide fragment mass spectrogram；
Fig. 3：Peptide fragment is located the protein sequence corresponding diagram of region ORF codings；It is identified for proteomics underscore part And it is synthesized the peptide fragment of peptide fragment verification；
Fig. 4：Protein sequence BLASTP knots corresponding to H37Rv bacterial strains Rv1879c (- | 2130001-2130255 |) gene Fruit；
Fig. 5：Rv1879c (- | 2130001-2130255 |) standard gene sequence homology compares；
Fig. 6：Rv1879c (- | 2130001-2130255 |) specific primer PCR amplified production agarose gel electrophoresis result；
Wherein, each Lane Sample information is shown in Table 1；
Fig. 7：Rv1879c (- | 2130001-2130255 |) gene PCR expands sequencing result and standard sequence compares.
Specific embodiment
The present invention will be further described With reference to embodiment, but does not limit scope of the invention as claimed. Agents useful for same of the present invention is commercially available.
Embodiment 1：Find the leakage annotation encoding gene of H37Rv strain gene groups
The high covering protein group verification of 1.1 pairs of H37Rv strain gene groups
The depth that protein group has been carried out to H37Rv bacterial strains using high covering protein technique covers research.It is based on Tuberculosis (20160307) database has carried out its genome using 3 engines of pFind the verification of annotation encoding gene. In order to find new protein-coding region, we are based on protein gene omics technology, and H37Rv is sent out in NCBI with pAnno softwares Full-length genome (NC_000962.3) file of table carries out six reading frame data base interpretations, and using this database to spectra count According to the identification for having carried out new peptide fragment and novel protein.In order to reduce false positive rate, we have used 3 during data filtering Kind separately estimates the filter method of classification FDR to having annotated peptide fragment and new peptide fragment, is S-FDR, T-FDR I and T-FDR respectively II。
Through data analysis, we identify 3238 H37Rv and have annotated gene altogether, coverage be up to the 80% of the bacterial strain with On, this is to report maximum H37Rv protein spectrum data so far.In addition, after being filtered through 3 kinds of FDR≤1, we obtain new peptide fragment. In order to further ensure that new peptide fragment quality, the spectrogram corresponding to our new peptide fragments remaining to above-mentioned filtering has carried out spectrogram quality Screening, finally remains the high-quality peptide fragment of some spectrograms.For further investigate the higher peptide fragment of these spectrogram quality not by Caused by having annotated peptide fragment and single amino acids mutation occurs, We conducted amino acid mutation verifications, it is ensured that these new peptide fragments are H37Rv newly identifies peptide fragment.
The coding albumen and database authentication of 1.2 couples of Rv1879c (- | 2130001-2130255 |) gene
After excessively high covering protein group verification, it has been found that some doubtful new leakage annotation peptide fragments, it can to above-mentioned height Doubtful new peptide fragment progress peptide fragment synthesis verification is believed to obtain, according to new peptide fragment original spectrum and peptide fragment synthesis spectrum similarity >=0.8 conduct of marking Similarity threshold after marking is screened, has several peptide fragments by verification, corresponding to new open reading frame (Open Reading Frame, ORF), i.e., the potential leakage annotation gene of current H37Rv bacterial strains.
Wherein, it has been found that new leakage annotation gene Rv1879c (- | 2130001-2130255 |), compare through BLASTP, Only being compared in database to one plant of M.tuberculosis N09901297 has Protein annotation information, but belongs to function not Know albumen.The coding peptide section sequence that we are identified is IGLVQISVPVAK (SEQ ID NO.6), as shown in Figure 1, spectrogram ion Signal is strong, most b/y ions continuous couplings, as a result very credible.
Further to confirm this qualification result, we newly identify the amino acid sequence of peptide fragment IGLVQISVPVAK according to us The row chemical synthesis peptide fragment, and produce the two level of the section of synthesized peptide using the mass spectral analysis condition of above-mentioned IGLVQISVPVAK Spectrogram.
The high energy collision MS that we generate section of synthesized peptide2It is verified, level-one parent ion and two level daughter ion are equal Meet theoretical value, show that the peptide section sequence that we synthesize is correct；On this basis, we are had checked according to large-scale protein by hand The MS of the section of synthesized peptide of new peptide section sequence that matter group data authentication arrives2With the new peptide fragment spectrogram of Large scale identification, the two is almost Unanimously, the cosin values obtained using daughter ion similitude is 0.86, it was demonstrated that the new peptide section sequence that we identify from H37Rv is just True errorless (Fig. 2).
After the sequence for confirming above-mentioned leakage annotation peptide fragment, according to the gene location where above-mentioned peptide fragment, with previous termination The region that codon and the latter terminator codon include is boundary, obtains including the open reading frame of above-mentioned new leakage annotation peptide fragment (ORF) DNA sequence dna, as shown in SEQ ID NO.2.
TAGTCGGCCGATGAAGGCCGGCGACCGGGCCCCCAGGTAGTGCACACTCAACCCGCCGTCAAGATAGACGTTGTTGA AGGCTTGTGCCAGATAACCGGCTTCTCGTTCGTAGGGATAGCAGTGCAGCAACACGATTGGGGTATTGCCGGACTGC CGCAGGAAGTCGAGCAGATACAGCGGATTGGCCTTGTGCAGATCAGCGTCCCGGTCGCCAAATCCGACGTGGAACTG CAGCGGCTTGCCCAGGCGCAACGCCTGATGCAACCCGAAGCGCAGCAGAACCCGATCCTGTAA(SEQ ID NO.2)
Open reading frame coding is as shown in Figure 3 with the correspondence of amino acid sequence.
Further translation verification, finds true gene order (SEQ ID NO.1) from above-mentioned open reading frame DNA (SEQ ID NO.2) inGTGStart, common 255bp, 85 amino acid of coding, theoretical molecular weight 9.21kDa, as Rv1879c (- | 2130001-2130255 |) gene.
GTGCACACTCAACCCGCCGTCAAGATAGACGTTGTTGAAGGCTTGTGCCAGATAACCGGCTTCTCGTTCGTAGGGAT AGCAGTGCAGCAACACGATTGGGGTATTGCCGGACTGCCGCAGGAAGTCGAGCAGATACAGCGGATTGGCCTTGTGC AGATCAGCGTCCCGGTCGCCAAATCCGACGTGGAACTGCAGCGGCTTGCCCAGGCGCAACGCCTGATGCAACCCGAA GCGCAGCAGAACCCGATCCTGTAA(SEQ ID NO.1)
The gene theory coded product amino acid sequence is as shown in SEQ ID NO.3：
VHTQPAVKIDVVEGLCQITGFSFVGIAVQQHDWGIAGLPQEVEQIQRIGLVQISVPVAKSDVELQRLAQAQRLMQPE AQQNPIL(SEQ ID NO.3)
NCBI-BLASTP analyses are carried out to the amino acid sequence of gene encoding production theoretical shown in the SEQ ID NO.3, Sequence does not have conserved protein domain, CFS50726.1 of the protein sequence only with M.tuberculosis N09901297 bacterial strains Albumen similarity highest is 100%, and sequence coverage 100% belongs to Unknown Function albumen (see Fig. 4).Show that we detect Rv1879c (- | the 2130001-2130255 |) gene outcome arrived is CFS50726.1 homologous proteins, this is in H37Rv bacterial strain data Annotation is missed in library.
The DNA sequence dna of the Rv1879c (- | 2130001-2130255 |) gene is compared genome local by us BLAST is analyzed, as shown in Figure 5, the results showed that Rv1879c (- | 2130001-2130255 |) gene order belongs to MTBC families spy Specific gene, the sequence for not having homology higher in other species, this shows what we had found in H37Rv bacterial strains Rv1879c (- | 2130001-2130255 |) gene order has preferable sequence-specific, can be interior other with belonging to by MTBC Mycobacteria and other Bacteria infecting respiratories distinguish.
Embodiment 2：The method for establishing the compound groups of identification of M TBC
(1) primer is designed：
Based on the CDS sequences of Rv1879c (- | 2130001-2130255 |) gene as shown in SEQ ID NO.1, use Oligo7.0 devises PCR primer, and primer sequence is as follows：
F:5’-CCCAGGTAGTGCACACTCAA-3’(SEQ ID NO.4)；
R:5’-TTACAGGATCGGGTTCTGCT-3’(SEQ ID NO.5)
Above-mentioned two pairs of primers as follows with the position relationship of Rv1879c (- | 2130001-2130255 |) gene, Middle primer corresponding position subscript list scribing line.
TAGTCGGCCGATGAAGGCCGGCGACCGGGCCCCCAGGTAGTGCACACTCAACCCGCCGTCAAGATAGACGTTGTTGA AGGCTTGTGCCAGATAACCGGCTTCTCGTTCGTAGGGATAGCAGTGCAGCAACACGATTGGGGTATTGCCGGACTGC CGCAGGAAGTCGAGCAGATACAGCGGATTGGCCTTGTGCAGATCAGCGTCCCGGTCGCCAAATCCGACGTGGAACTG CAGCGGCTTGCCCAGGCGCAACGCCTGATGCAACCCGAAGCGCAGCAGAACCCGATCCTGTAA(SEQ ID NO.2)
(2) total DNA of strain to be tested of the extraction including M.tuberculosis H37Rv, 40 plants of Mycobacterium marks For quasi- bacterial strain by Chinese medicine bacteria culture preservation administrative center (CMCC) preservation, remaining 16 plants of non-tuberculous mycobacteria is Chinese 309 hospital clinical separation strains of people's liberation army have completed the sequencing of strain 16S rna genes, comparison and NCBI sequences and have submitted work, Strain to be tested is as shown in table 1：
The related strain that table 1. is selected
(3) amplification of DNA fragments carries out polymerase chain (PCR) and reacts, and above-mentioned F/R primers used are expanded.
PCR system (25 μ L) is dd H2O (9.5 μ L), 2XTaq PCR MasterMix (TIANGEN, 12.5 μ L) primers F (10 μM, 1 μ L), primer R (10 μM, 1 μ L), DNA profiling (1 μ L)；
Amplification program：94 DEG C of pre-degeneration 3min, 94 DEG C denaturation 30s, 58 DEG C annealing 30s, 72 DEG C extension 1min, 35 follow Ring, 72 DEG C of extension 5min.
(4) amplified production electrophoresis detection, the electrophoresis detection in Ago-Gel, 1 × TBE electrophoresis liquids.As a result such as Fig. 6 institutes Show, MTBC groups and positive control have band to be detected at 263bp, and without miscellaneous band, and primers F/R amplified productions are theoretical Amplified fragments are 263bp, and practical amplification is consistent with expection.
(5) in order to further verify the sequence of the DNA of amplification, we have carried out extension increasing sequence sequencing and and former sequence ratio Compared with as shown in fig. 7, result is consistent completely with expection, sequence is correct, this further demonstrates depositing for new leakage annotation gene .
This shows that the method that the compound group's identifications of MTBC are carried out based on Rv1879c (- | 2130001-2130255 |) gene is true Reliably.
SEQUENCE LISTING
<110>Beijing Proteome Research Center
<120>Mycobacterium tuberculosis H37Rv encoding gene and its application
<130> BJ1936-17P121596
<160> 6
<170> PatentIn version 3.3
<210> 1
<211> 255
<212> DNA
<213> Artificial
<220>
<223>The sequence of Rv1879c (- | 2130001-2130255 |) gene
<400> 1
gtgcacactc aacccgccgt caagatagac gttgttgaag gcttgtgcca gataaccggc 60
ttctcgttcg tagggatagc agtgcagcaa cacgattggg gtattgccgg actgccgcag 120
gaagtcgagc agatacagcg gattggcctt gtgcagatca gcgtcccggt cgccaaatcc 180
gacgtggaac tgcagcggct tgcccaggcg caacgcctga tgcaacccga agcgcagcag 240
aacccgatcc tgtaa 255
<210> 2
<211> 294
<212> DNA
<213> Artificial
<220>
<223>Include the open reading frame DNA sequence dna of leakage annotation peptide fragment
<400> 2
tagtcggccg atgaaggccg gcgaccgggc ccccaggtag tgcacactca acccgccgtc 60
aagatagacg ttgttgaagg cttgtgccag ataaccggct tctcgttcgt agggatagca 120
gtgcagcaac acgattgggg tattgccgga ctgccgcagg aagtcgagca gatacagcgg 180
attggccttg tgcagatcag cgtcccggtc gccaaatccg acgtggaact gcagcggctt 240
gcccaggcgc aacgcctgat gcaacccgaa gcgcagcaga acccgatcct gtaa 294
<210> 3
<211> 84
<212> PRT
<213> Artificial
<220>
<223>Orf | 0 |-| 2130001-2130255 | the theoretical code product amino acid sequence of gene
<400> 3
Val His Thr Gln Pro Ala Val Lys Ile Asp Val Val Glu Gly Leu Cys
1 5 10 15
Gln Ile Thr Gly Phe Ser Phe Val Gly Ile Ala Val Gln Gln His Asp
20 25 30
Trp Gly Ile Ala Gly Leu Pro Gln Glu Val Glu Gln Ile Gln Arg Ile
35 40 45
Gly Leu Val Gln Ile Ser Val Pro Val Ala Lys Ser Asp Val Glu Leu
50 55 60
Gln Arg Leu Ala Gln Ala Gln Arg Leu Met Gln Pro Glu Ala Gln Gln
65 70 75 80
Asn Pro Ile Leu
<210> 4
<211> 20
<212> DNA
<213> Artificial
<220>
<223>F primer sequences
<400> 4
cccaggtagt gcacactcaa 20
<210> 5
<211> 20
<212> DNA
<213> Artificial
<220>
<223>R primer sequences
<400> 5
ttacaggatc gggttctgct 20
<210> 6
<211> 12
<212> PRT
<213> Artificial
<220>
<223>Leakage annotation peptide fragment
<400> 6
Ile Gly Leu Val Gln Ile Ser Val Pro Val Ala Lys
1 5 10

Claims (10)

1. a kind of Mycobacterium tuberculosis H37Rv encoding gene, the nucleotide sequence such as SEQ ID NO.1 institutes of the encoding gene Show.
2. Mycobacterium tuberculosis H37Rv encoding gene described in claim 1, it is characterised in that the gene code such as SEQ ID Amino acid shown in NO.3 sequences.
3. a kind of bar code molecular labeling, as detecting and/or identifying mycobacterium tuberculosis complex, it includes examined as standard The Mycobacterium tuberculosis H37Rv encoding gene described in claim 1 of cls gene.
A 4. species-specific PCR primers, for expanding Mycobacterium tuberculosis H37Rv encoding gene described in claim 1.
5. the PCR primer described in claim 4, which is characterized in that the sequence of the primer is：
F:5’-CCCAGGTAGTGCACACTCAA-3’；
R:5’-TTACAGGATCGGGTTCTGCT-3’。
6. a kind of detection method of mycobacterium tuberculosis complex identification, includes the following steps：
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) DNA obtained using step (1) adds in amplimer as template, carries out PCR；
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) result of step (3) is compared with encoding gene described in claim 1, it is to be measured according to its homologous sex determination It whether there is mycobacterium tuberculosis complex in sample.
7. the amplimer sequence described in the detection method described in claim 6, wherein step (2) is：
F:5’-CCCAGGTAGTGCACACTCAA-3’；
R:5’-TTACAGGATCGGGTTCTGCT-3’。
8. the detection method described in claim 6, wherein in step (4), if homology is more than 99%, test sample is treated in judgement Contain mycobacterium tuberculosis complex in product.
9. a kind of detection kit, will comprising Mycobacterium tuberculosis H37Rv encoding gene described in claim 1 and/or right Seek the Specific PCR primers described in 4.
10. Mycobacterium tuberculosis H37Rv encoding gene described in claim 1 is in tuberculosis epidemiological survey and/or clinical knot Application in the fast quick-break of core patient and discriminating.
CN201711250170.5A 2017-12-01 2017-12-01 Mycobacterium tuberculosis H37Rv encoding gene and application thereof Active CN108165561B (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201711250170.5A CN108165561B (en) 2017-12-01 2017-12-01 Mycobacterium tuberculosis H37Rv encoding gene and application thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201711250170.5A CN108165561B (en) 2017-12-01 2017-12-01 Mycobacterium tuberculosis H37Rv encoding gene and application thereof

Publications (2)

Publication Number Publication Date
CN108165561A true CN108165561A (en) 2018-06-15
CN108165561B CN108165561B (en) 2021-06-18

Family

ID=62524955

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201711250170.5A Active CN108165561B (en) 2017-12-01 2017-12-01 Mycobacterium tuberculosis H37Rv encoding gene and application thereof

Country Status (1)

Country Link
CN (1) CN108165561B (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110343706A (en) * 2019-01-25 2019-10-18 北京蛋白质组研究中心 Mycobacterium tuberculosis H37Rv encoding gene and its application
CN113249502A (en) * 2021-05-08 2021-08-13 上海康黎诊断技术有限公司 Related gene, method, primer group and kit for mycobacterium tuberculosis complex flora identification and drug resistance detection

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006035317A2 (en) * 2004-09-30 2006-04-06 Institut Pasteur Immunogenic glycopeptides for diagnosing pathogenic microorganisms infections
WO2009017902A2 (en) * 2007-06-22 2009-02-05 Ibis Biosciences, Inc. Compositions and methods for identification of subspecies characteristics of mycobacterium tuberculosis
CN101421415A (en) * 2004-07-12 2009-04-29 阿维斯塔金格兰技术有限公司 Construction of a comparative database and identification of virulence factors through comparison of polymorphic regions in clinical isolates of infectious organisms
WO2012135815A2 (en) * 2011-04-01 2012-10-04 Occam Biolabs, Inc. Methods and kits for detecting cell-free pathogen-specific nucleic acids
WO2014115747A1 (en) * 2013-01-25 2014-07-31 独立行政法人国立国際医療研究センター Method for identifying strain of mycobacterium tuberculosis and method for detecting gene variation
CN104561245A (en) * 2013-10-16 2015-04-29 复旦大学 Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex)

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN101421415A (en) * 2004-07-12 2009-04-29 阿维斯塔金格兰技术有限公司 Construction of a comparative database and identification of virulence factors through comparison of polymorphic regions in clinical isolates of infectious organisms
WO2006035317A2 (en) * 2004-09-30 2006-04-06 Institut Pasteur Immunogenic glycopeptides for diagnosing pathogenic microorganisms infections
WO2009017902A2 (en) * 2007-06-22 2009-02-05 Ibis Biosciences, Inc. Compositions and methods for identification of subspecies characteristics of mycobacterium tuberculosis
WO2012135815A2 (en) * 2011-04-01 2012-10-04 Occam Biolabs, Inc. Methods and kits for detecting cell-free pathogen-specific nucleic acids
WO2014115747A1 (en) * 2013-01-25 2014-07-31 独立行政法人国立国際医療研究センター Method for identifying strain of mycobacterium tuberculosis and method for detecting gene variation
CN104561245A (en) * 2013-10-16 2015-04-29 复旦大学 Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex)

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
COLE,S.T. ET AL.: ""Mycobacterium tuberculosis H37Rv complete genome，ACCESSION：AL123456.3"", 《GENBANK》 *
NCBI: ""Uncharacterised protein [Mycobacterium tuberculosis]，ACCESSION：CFS50726.1"", 《GENPEPT》 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110343706A (en) * 2019-01-25 2019-10-18 北京蛋白质组研究中心 Mycobacterium tuberculosis H37Rv encoding gene and its application
CN113249502A (en) * 2021-05-08 2021-08-13 上海康黎诊断技术有限公司 Related gene, method, primer group and kit for mycobacterium tuberculosis complex flora identification and drug resistance detection

Also Published As

Publication number Publication date
CN108165561B (en) 2021-06-18

Similar Documents

Publication Publication Date Title
Struelens Consensus guidelines for appropriate use and evaluation of microbial epidemiologic typing systems
Ikryannikova et al. Misidentification of alpha-hemolytic streptococci by routine tests in clinical practice
CN104995314A (en) Primers, snp markers and method for genotyping mycobacterium tuberculosis
CN110408629A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN110408630A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
KR101954392B1 (en) Molecular marker for detecting Erwinia amylovora and uses thereof
CN108165561A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN108165562A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN108004253A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN108165564A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN108165565A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN115976235B (en) Identification method of Lactobacillus delbrueckii CICC6047 strain, and primer, kit and application thereof
CN108165560A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN110408632A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN110423835A (en) Primer composition for lower respiratory tract the pathogenic microorganism examination
CN108165563A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN110923349B (en) Species-specific detection molecular tags 3283 and 3316 of yersinia enterocolitica and rapid detection method thereof
Salehi et al. Internal Transcribed Spacer rDNA and TEF-1α Gene Sequencing of Pathogenic Dermatophyte Species and Differentiation of Closely Related Species Using PCR-RFLP of The Topoisomerase II
CN110408631A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
CN110343706A (en) Mycobacterium tuberculosis H37Rv encoding gene and its application
KR100568702B1 (en) DNA microarray for species identification of microorganism and its manufacture method
de Souza Methods for the identification, characterization, and tracking the spread of Staphylococcus aureus
Savelkoul et al. High density whole genome fingerprinting of methicillin-resistant and-susceptible strains of Staphylococcus aureus in search of phenotype-specific molecular determinants
JP4379308B2 (en) Genotyping method of methicillin-resistant Staphylococcus aureus and primer set used therefor
US7135283B1 (en) Topoisomerase type II gene polymorphisms and their use in identifying drug resistance and pathogenic strains of microorganisms

Legal Events

Date Code Title Description
PB01 Publication
SE01 Entry into force of request for substantive examination
SE01 Entry into force of request for substantive examination
GR01 Patent grant
GR01 Patent grant
TR01 Transfer of patent right

Effective date of registration: 20230522

Address after: 100850 No. 27 Taiping Road, Beijing, Haidian District

Patentee after: ACADEMY OF MILITARY MEDICAL SCIENCES

Address before: Building 1, No.33, kekeyuan Road, Changping District, Beijing

Patentee before: BEIJING PROTEOME RESEARCH CENTER

TR01 Transfer of patent right