CN108004253A - Mycobacterium tuberculosis H37Rv encoding gene and its application - Google Patents
Mycobacterium tuberculosis H37Rv encoding gene and its application Download PDFInfo
- Publication number
- CN108004253A CN108004253A CN201711249300.3A CN201711249300A CN108004253A CN 108004253 A CN108004253 A CN 108004253A CN 201711249300 A CN201711249300 A CN 201711249300A CN 108004253 A CN108004253 A CN 108004253A
- Authority
- CN
- China
- Prior art keywords
- mycobacterium tuberculosis
- encoding gene
- gene
- sequence
- tuberculosis h37rv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 77
- 241001646725 Mycobacterium tuberculosis H37Rv Species 0.000 title claims abstract description 15
- 108700035964 Mycobacterium tuberculosis HsaD Proteins 0.000 title claims abstract description 14
- 241001302239 Mycobacterium tuberculosis complex Species 0.000 claims abstract description 37
- 238000001514 detection method Methods 0.000 claims abstract description 17
- 201000008827 tuberculosis Diseases 0.000 claims description 13
- 150000001413 amino acids Chemical class 0.000 claims description 9
- 230000003321 amplification Effects 0.000 claims description 8
- 238000004458 analytical method Methods 0.000 claims description 8
- 241000894007 species Species 0.000 claims description 8
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 7
- 238000003745 diagnosis Methods 0.000 claims description 3
- 238000000605 extraction Methods 0.000 claims description 3
- 238000000926 separation method Methods 0.000 claims description 3
- 238000001502 gel electrophoresis Methods 0.000 claims description 2
- 238000012360 testing method Methods 0.000 claims description 2
- 101150030367 cls gene Proteins 0.000 claims 1
- 238000002372 labelling Methods 0.000 claims 1
- 239000002773 nucleotide Substances 0.000 claims 1
- 125000003729 nucleotide group Chemical group 0.000 claims 1
- 230000020509 sex determination Effects 0.000 claims 1
- 108010033276 Peptide Fragments Proteins 0.000 description 31
- 102000007079 Peptide Fragments Human genes 0.000 description 31
- 101100051755 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Rv0609B gene Proteins 0.000 description 23
- 230000001580 bacterial effect Effects 0.000 description 14
- 238000000034 method Methods 0.000 description 14
- 108020004414 DNA Proteins 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 11
- 238000012795 verification Methods 0.000 description 10
- 108700026244 Open Reading Frames Proteins 0.000 description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 238000012163 sequencing technique Methods 0.000 description 5
- 238000001228 spectrum Methods 0.000 description 5
- 241000894006 Bacteria Species 0.000 description 4
- 241000186366 Mycobacterium bovis Species 0.000 description 4
- 241001312372 Mycobacterium canettii Species 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 150000002500 ions Chemical class 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 210000002345 respiratory system Anatomy 0.000 description 4
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 3
- 238000012408 PCR amplification Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- FRXSZNDVFUDTIR-UHFFFAOYSA-N 6-methoxy-1,2,3,4-tetrahydroquinoline Chemical compound N1CCCC2=CC(OC)=CC=C21 FRXSZNDVFUDTIR-UHFFFAOYSA-N 0.000 description 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 241000186359 Mycobacterium Species 0.000 description 2
- 206010057190 Respiratory tract infections Diseases 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 150000001875 compounds Chemical group 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 108010027668 glycyl-alanyl-valine Proteins 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 238000012797 qualification Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 108020004465 16S ribosomal RNA Proteins 0.000 description 1
- WCBVQNZTOKJWJS-ACZMJKKPSA-N Ala-Cys-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(O)=O)C(O)=O WCBVQNZTOKJWJS-ACZMJKKPSA-N 0.000 description 1
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 1
- PBSOQGZLPFVXPU-YUMQZZPRSA-N Arg-Glu-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O PBSOQGZLPFVXPU-YUMQZZPRSA-N 0.000 description 1
- WVNFNPGXYADPPO-BQBZGAKWSA-N Arg-Gly-Ser Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O WVNFNPGXYADPPO-BQBZGAKWSA-N 0.000 description 1
- KZXPVYVSHUJCEO-ULQDDVLXSA-N Arg-Phe-Lys Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(O)=O)CC1=CC=CC=C1 KZXPVYVSHUJCEO-ULQDDVLXSA-N 0.000 description 1
- NUHQMYUWLUSRJX-BIIVOSGPSA-N Asn-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)N)N NUHQMYUWLUSRJX-BIIVOSGPSA-N 0.000 description 1
- QEYJFBMTSMLPKZ-ZKWXMUAHSA-N Asn-Ala-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O QEYJFBMTSMLPKZ-ZKWXMUAHSA-N 0.000 description 1
- GXMSVVBIAMWMKO-BQBZGAKWSA-N Asn-Arg-Gly Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CCCN=C(N)N GXMSVVBIAMWMKO-BQBZGAKWSA-N 0.000 description 1
- HRGGPWBIMIQANI-GUBZILKMSA-N Asp-Gln-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HRGGPWBIMIQANI-GUBZILKMSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- DZLQXIFVQFTFJY-BYPYZUCNSA-N Cys-Gly-Gly Chemical compound SC[C@H](N)C(=O)NCC(=O)NCC(O)=O DZLQXIFVQFTFJY-BYPYZUCNSA-N 0.000 description 1
- RWAZRMXTVSIVJR-YUMQZZPRSA-N Cys-Gly-His Chemical compound [H]N[C@@H](CS)C(=O)NCC(=O)N[C@@H](CC1=CNC=N1)C(O)=O RWAZRMXTVSIVJR-YUMQZZPRSA-N 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- IOFDDSNZJDIGPB-GVXVVHGQSA-N Gln-Leu-Val Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O IOFDDSNZJDIGPB-GVXVVHGQSA-N 0.000 description 1
- OHWJUIXZHVIXJJ-GUBZILKMSA-N Glu-Lys-Cys Chemical compound C(CCN)C[C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CCC(=O)O)N OHWJUIXZHVIXJJ-GUBZILKMSA-N 0.000 description 1
- JRDYDYXZKFNNRQ-XPUUQOCRSA-N Gly-Ala-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)CN JRDYDYXZKFNNRQ-XPUUQOCRSA-N 0.000 description 1
- UFPXDFOYHVEIPI-BYPYZUCNSA-N Gly-Gly-Asp Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CC(O)=O UFPXDFOYHVEIPI-BYPYZUCNSA-N 0.000 description 1
- HPAIKDPJURGQLN-KBPBESRZSA-N Gly-His-Phe Chemical compound C([C@H](NC(=O)CN)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CNC=N1 HPAIKDPJURGQLN-KBPBESRZSA-N 0.000 description 1
- RGSOCXHDOPQREB-ZPFDUUQYSA-N Ile-Asp-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N RGSOCXHDOPQREB-ZPFDUUQYSA-N 0.000 description 1
- SITWEMZOJNKJCH-UHFFFAOYSA-N L-alanine-L-arginine Natural products CC(N)C(=O)NC(C(O)=O)CCCNC(N)=N SITWEMZOJNKJCH-UHFFFAOYSA-N 0.000 description 1
- LHSGPCFBGJHPCY-UHFFFAOYSA-N L-leucine-L-tyrosine Natural products CC(C)CC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 LHSGPCFBGJHPCY-UHFFFAOYSA-N 0.000 description 1
- 241001467553 Mycobacterium africanum Species 0.000 description 1
- 241000211133 Mycobacterium caprae Species 0.000 description 1
- 241000187919 Mycobacterium microti Species 0.000 description 1
- 241000699502 Mycobacterium mungi Species 0.000 description 1
- 241000656726 Mycobacterium orygis Species 0.000 description 1
- 241001457456 Mycobacterium pinnipedii Species 0.000 description 1
- 241001093674 Mycobacterium suricattae Species 0.000 description 1
- 108010079364 N-glycylalanine Proteins 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- GXXTUIUYTWGPMV-FXQIFTODSA-N Ser-Arg-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(O)=O GXXTUIUYTWGPMV-FXQIFTODSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- DKDHTRVDOUZZTP-IFFSRLJSSA-N Thr-Gln-Val Chemical compound CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(O)=O DKDHTRVDOUZZTP-IFFSRLJSSA-N 0.000 description 1
- KSCVLGXNQXKUAR-JYJNAYRXSA-N Tyr-Leu-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O KSCVLGXNQXKUAR-JYJNAYRXSA-N 0.000 description 1
- JOQSQZFKFYJKKJ-GUBZILKMSA-N Val-Arg-Cys Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CS)C(=O)O)N JOQSQZFKFYJKKJ-GUBZILKMSA-N 0.000 description 1
- VVZDBPBZHLQPPB-XVKPBYJWSA-N Val-Glu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VVZDBPBZHLQPPB-XVKPBYJWSA-N 0.000 description 1
- DLRZGNXCXUGIDG-KKHAAJSZSA-N Val-Thr-Asp Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)O)NC(=O)[C@H](C(C)C)N)O DLRZGNXCXUGIDG-KKHAAJSZSA-N 0.000 description 1
- LNWSJGJCLFUNTN-ZOBUZTSGSA-N Val-Trp-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(=O)N)C(=O)O)N LNWSJGJCLFUNTN-ZOBUZTSGSA-N 0.000 description 1
- WHNSHJJNWNSTSU-BZSNNMDCSA-N Val-Val-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)C(C)C)C(O)=O)=CNC2=C1 WHNSHJJNWNSTSU-BZSNNMDCSA-N 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 108010069926 arginyl-glycyl-serine Proteins 0.000 description 1
- 108010038633 aspartylglutamate Proteins 0.000 description 1
- 238000012550 audit Methods 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 108010016616 cysteinylglycine Proteins 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000000151 deposition Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 239000012154 double-distilled water Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012268 genome sequencing Methods 0.000 description 1
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 1
- HPAIKDPJURGQLN-UHFFFAOYSA-N glycyl-L-histidyl-L-phenylalanine Natural products C=1C=CC=CC=1CC(C(O)=O)NC(=O)C(NC(=O)CN)CC1=CN=CN1 HPAIKDPJURGQLN-UHFFFAOYSA-N 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 108010012058 leucyltyrosine Proteins 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 244000039328 opportunistic pathogen Species 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 208000008128 pulmonary tuberculosis Diseases 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000010183 spectrum analysis Methods 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
- C12Q1/689—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Analytical Chemistry (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Medicinal Chemistry (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The present invention relates to a kind of Mycobacterium tuberculosis H37Rv encoding gene, it can be used as the standard gene of mycobacterium tuberculosis complex Molecular Identification, Molecular Identification and clinical detection for mycobacterium tuberculosis complex.
Description
Technical field
The present invention relates to genetic test field, and in particular to pathogen species are identified.
Background technology
Mycobacterium tuberculosis (Mycobacterium tuberculosis, MTB) is to cause mankind pathogen lungy.
Each organ of whole body can be invaded, but using pulmonary tuberculosis to be most common.Tuberculosis is infectious disease particularly important so far, the serious threat mankind
Life and health.According to WHO, 8,000,000 new cases generation there are about every year, at least 3,000,000 people die of the disease.The clinical bacterium of MTB
The culture of strain hardly possible, slow-growing and other mycobacteria energy cross-infections, tuberculosis and the difficult differentiation of other respiratory tract infection symptoms etc.
Feature, great difficulty is brought to clinical quick diagnosis and treatment.Therefore establish quick, accurate, special, sensitive, cheap knot
Core disease detection method, is effective treatment, the prerequisite of control tuberculosis sprawling, and clinical labororatory's mycobacteria detection faces
The new challenge faced and new task.
Mycobacterium tuberculosis complex (Mycobacterium tuberculosis complex, MTBC), including
M.tuberculosis、M.africanum、M.orygis、M.bovis、M.microti、M.canettii、M.caprae、
The mycobacteria monoid such as M.pinnipedii, M.suricattae, M.mungi, these species can cause people and other life
Body tuberculosis.Following three classes are broadly divided into the identification method of MTBC both at home and abroad at present：Traditional isolated culture；Molecular level is examined
Survey (IS6110, restriction fragment length polymorphism analysis, more site variable number repeated fragment polymorphism analysis etc.)；Thalline into
Divide (aliphatic acid, mycolic acid) chromatogram analysis method.Though three classes method has the advantages of respective, also there is shortcoming, such as pass
System is separately cultured cycle length, and with thalline can to cultivate rate low；Molecular level detection at present is in terms of specificity, sensitivity and simplicity
It is still poorer；Drive member specificity analysis cost is higher, complicated.
MTB H37Rv completed genome sequencing in 1998, were the earliest MTB bacterial strains for completing full figure sequencing.Since then, respectively
State researchers are tactful based on algorithm optimization, annotating software renewal, transcription group and proteomics etc., always in perfect, benefit
Fill H37Rv gene annotation databases.However, since MTB belongs to prokaryotes, due to prokaryotic gene group remarking technology in itself
Deficiency, in genome annotation still there may be annotation mistake (excessively annotation, genetic borders mistake and ORF starting, stop bit
Point mistake, alternative splicing, ribosomes displacement, leakage annotation), to deeply, accurately parse biological mechanism bring puzzlement.To solve
This problem, protein gene group (Proteogenomics) though have been used for the correction that H37Rv has annotated gene, however, high
Ratio false positive, routine techniques are difficult to annotation predictive genes, new gene verification, new gene functional analysis and its application etc.
The problem that the field is faced.
Generally speaking, traditional mycobacterium tuberculosis complex (MTBC) identification strategy has cycle length, complex steps, specifically
The defects of property and sensitivity is not high.H37Rv full-length genomes are annotated again further to improve, find to omit annotation in H37Rv
Gene, it is ensured that H37Rv full-length genomes omit annotation gene and its application technology in MTBC Molecular Identifications is effectively protected,
It is imperative to develop H37Rv new genes fast accurate mirror method for distinguishing in MTBC monoids.
The content of the invention
It is an object of the present invention to provide a kind of new encoding gene of Mycobacterium tuberculosis H37Rv, which is H37Rv
Leakage annotation encoding gene Rv0609B (- | 704475-704672 |), it can be used as mycobacterium tuberculosis complex bar code molecule
Mark, for detecting mycobacterium tuberculosis complex, its sequence is as shown in SEQ ID NO.1.
Other objects of the present invention include providing Specific PCR primers and the offer that can be used for expanding above-mentioned encoding gene
It is a kind of to detect or identify the detection method that whether there is mycobacterium tuberculosis complex in sample；The present invention also provides with above-mentioned volume
The application of the detection kit and said gene of code gene-correlation.
According to an aspect of the present invention, comparison protein genomics investigative technique is passed through, it was found that one in H37Rv
It is difficult to by the albumen coded sequence of predictive genes software discovery, which can be effectively by MTBC and the other species differentiations belonged to together
Come.The gene is the omission annotation base of a mycobacterium tuberculosis (Mycobacterium tuberculosis H37Rv)
Cause, i.e. Rv0609B (- | 704475-704672 |), after NCBI-BLASTP, with M.bovis RefSeq (WP_
003403191.1) similitude with M.tuberculosis Bir189 is 98%, M.canettii CIPT, 140070017 phases
It is 94% like property, other species similarities are below 34%, and belong to Unknown Function albumen.Study and send out through comparative genomics
Now other kinds of mycobacterium tuberculosis complex (MTBC) bacterial strain and Mycobacterium can be distinguished by the gene order.
Specifically, design can realize specificity amplification primer to the Rv0609B of MTBC (- | 704475-704672 |) gene,
Primer as proposed by the invention, primer sequence are：
F:5’-GACCGACGAGAAGTGCGT-3’；
R:5’-GGCACGGCTTTCGAGATA-3’。
The difference of the presence or absence of gene DNA sequence PCR product in sample to be tested or DNA sequence dna, can be quickly accurate
True identification of M TBC.
According to another aspect of the present invention, based on the new standard code gene of above-mentioned Mycobacterium tuberculosis H37Rv, this hair
The bright method for specifically establishing detection or identifying mycobacterium tuberculosis complex, step are as follows：
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) DNA obtained using step (1) carries out PCR amplification as template using following primer：
F:5’-GACCGACGAGAAGTGCGT-3’(SEQ ID NO.4)；
R:5’-GGCACGGCTTTCGAGATA-3’(SEQ ID NO.5)。
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) result of step (3) and bar code gene Rv0609B (- | 704475-704672 |) are compared, if
Homology is more than 99%, judges that sample to be tested contains mycobacterium tuberculosis complex.
Further, above-mentioned detection method, according to DNA bar code principle, tentatively carries out electrophoretic analysis, such as to PCR product
Fruit strain to be tested does not have target stripe, and it is not MTBC to illustrate the bacterial strain；If band, then can further sequence verification, will survey
The standard sequence that sequence obtains series and the Rv0609B of H37Rv (- | 704475-704672 |) carries out Homology search and comparison, obtains
Similitude between sequence, if sequence homology is more than 99%, you can judge that bacterial strain may be MTBC；According to identification bacterial strain to be identified
DNA bar code sequence and standard sequence cluster situation distinguish MTBC families and non-tuberculous mycobacteria, respiratory tract common disease
Opportunistic pathogen and common respiratory tract virus.
The detection method can be used to the strain idenfication research to mycobacterium tuberculosis complex, it can also be used to clinical quick
Examine.Sample to be tested can be from H37Rv bacterial strains, other MTBC, non-tuberculous mycobacteria, respiratory tract encountered pathogenic bacteria, breathing
Road common virus bacterial strain；Either directly use tuberculosis and other respiratory tract patient sputum, saliva or blood.
Based on the above method, the present invention also provides detection kit, and kit containers are built-in to detect knot
The reagent of standard code gene new core mycobacteria H37Rv, what is concurrently provided can be through governmental drug management organization
Manufacture, use and sales informations audit, in relation to medicine or biological products.For example, after using PCR amplification, sample is directly detected
The reagent of Rv0609B in product (- | 704475-704672 |) gene, for example, containing amplimer, dNTP, for PCR reactions
The one or more of archaeal dna polymerase and its buffer solution, endonuclease reaction and/or reagent needed for sequencing reaction etc..People in the art
Member is it is known that above component is only illustrative, for example, the primer can use above-mentioned Specific PCR primers, described is used for
The archaeal dna polymerase of PCR reactions can be used for the enzyme of PCR amplification.The detection of the encoding gene of the present invention can also be with integrated
Such as the mode of genetic chip provides.
Beneficial effect：The present invention provides one kind to be used as mycobacterium tuberculosis complex (Mycobacterium
Tuberculosis complex, MTBC) Molecular Identification standard gene and method for identifying molecules, the gene can effectively by
MTBC comes with the other species differentiations belonged to together, and existing mycobacterium tuberculosis complex is overcome using the identification method of the gene
The shortcomings of design of primers multiplicity in qualification process, result poor repeatability, have the characteristics that general, easy amplification, easily compare, can
To identify to come from the close other mycobacterias of affiliation or other respiratory tract infection germs by the monoid exactly, it is
Tuberculosis epidemiology survey and clinical tuberculosis patient quick diagnosis, differentiate the strong technological means of offer and research tool.
Brief description of the drawings
Fig. 1：Support the peptide spectrum matching evidence of newly encoded gene found；
Fig. 2：Section of synthesized peptide mass spectrogram is contrasted with former identification peptide fragment mass spectrogram；
Fig. 3：Peptide fragment is located the protein sequence corresponding diagram of region ORF codings；Identified for proteomics underscore part
And it is synthesized the peptide fragment of peptide fragment verification；
Fig. 4：Rv0609B (- | 704475-704672 |) standard gene sequence homology compares；
Fig. 5：Protein sequence BLASTP results corresponding to H37Rv bacterial strains Rv0609B (- | 704475-704672 |) gene；
Fig. 6：Rv0609B (- | 704475-704672 |) specific primer PCR amplified production agarose gel electrophoresis result；
Wherein, each Lane Sample specifying information is shown in Table 1；
Fig. 7：Rv0609B (- | 704475-704672 |) gene PCR expands sequencing result and standard sequence compares.
Embodiment
With reference to embodiment, the present invention will be further described, but does not limit scope of the invention as claimed.
Agents useful for same of the present invention is commercially available.
Embodiment 1：Find the leakage annotation encoding gene of H37Rv strain gene groups
The high covering protein group verification of 1.1 pairs of H37Rv strain gene groups
The depth that protein group has been carried out to H37Rv bacterial strains using high covering protein technique covers research.It is based on
Tuberculosis (20160307) database, has carried out its genome using 3 engines of pFind the verification of annotation encoding gene.
In order to find new protein-coding region, we are based on protein gene omics technology, and H37Rv is sent out in NCBI with pAnno softwares
Full-length genome (NC_000962.3) file of table carries out six reading frame data base interpretations, and using this database to spectra count
According to the identification for having carried out new peptide fragment and novel protein.In order to reduce false positive rate, we have used 3 during data filtering
Kind separately estimates the filter method of classification FDR to having annotated peptide fragment and new peptide fragment, is S-FDR, T-FDR I and T-FDR respectively
II。
Through data analysis, we identify 3238 H37Rv and have annotated gene altogether, coverage be up to the 80% of the bacterial strain with
On, this is the H37Rv protein spectrum data for reporting maximum so far.In addition, after being filtered through 3 kinds of FDR≤1, we obtain new peptide fragment.
In order to further ensure that new peptide fragment quality, the spectrogram corresponding to our new peptide fragments remaining to above-mentioned filtering has carried out spectrogram quality
Screening, finally remains some measured peptide fragments of spectrogram matter.For further investigate the higher peptide fragment of these spectrogram quality not by
Caused by having annotated peptide fragment and single amino acids mutation occurs, We conducted amino acid mutation verification, it is ensured that these new peptide fragments are
H37Rv newly identifies peptide fragment.
The encoding proteins and database authentication of 1.2 couples of Rv0609B (- | 704475-704672 |) gene
After excessive covering protein group verification, it has been found that some doubtful new leakage annotation peptide fragments, can to above-mentioned height
Doubtful new peptide fragment progress peptide fragment synthesis verification is believed to obtain, according to new peptide fragment original spectrum and peptide fragment synthesis spectrum similarity >=0.8 conduct of marking
Similarity threshold, after marking is screened, has several peptide fragments by verification, corresponding to new open reading frame (Open Reading
Frame, ORF), i.e., the potential leakage annotation gene of current H37Rv bacterial strains.
Wherein, it has been found that new leakage annotation gene Rv0609B (- | 704475-704672 |), compare through BLASTP, with
The similitude of M.bovis RefSeq (WP_003403191.1) and M.tuberculosis Bir 189 is 98%,
140070017 similitudes of M.canettii CIPT are 94%, and other species similarities are below 34%, and belong to function not
Know albumen.We detect peptide fragment CGGDQLVEGAVVWNAPLR (SEQ ID NO.6), and corresponding to new gene Rv0609B (- |
704475-704672 |), as shown in Figure 1, spectrogram quality is fine, b/y ion continuous couplings, miscellaneous peak signal is very low, as a result very may be used
Letter.
Further to confirm this qualification result, we newly identify that the amino acid sequence chemistry of peptide fragment is synthesized according to us
The peptide fragment, and generate using above-mentioned mass spectral analysis condition the two level spectrogram of the section of synthesized peptide.
The high energy collision MS that we produce section of synthesized peptide2Verified, level-one parent ion and two level daughter ion are equal
Meet theoretical value, show that the peptide section sequence that we synthesize is correct；On this basis, we checked according to large-scale protein by hand
The MS of the section of synthesized peptide for the new peptide section sequence that matter group data authentication arrives2With the new peptide fragment spectrogram of Large scale identification, both are almost
The one cosin values for showing the acquisition of daughter ion similitude are 0.97, it was demonstrated that the correct nothing of new peptide fragment that we identify from H37Rv
By mistake.(Fig. 2).
After the sequence of above-mentioned leakage annotation peptide fragment is confirmed, according to the gene location where above-mentioned peptide fragment, with previous termination
The region that codon and the latter terminator codon include is boundary, obtains including the open reading frame of above-mentioned new leakage annotation peptide fragment
(ORF) DNA sequence dna, as shown in SEQ ID NO.2.
TAGCCTGGCCAGCCGCAGAGAAGGGGAGGCGTCGTGACCGACGAGAAGTGCGTGAGATGCGGGGGCGACCAGCTCGT
CGAAGGGGCCGTCGTCTGGAACGCGCCGCTGCGTTTCAAGCGCGAAGGTGCCGGCCACTTCAATCGCGGCACCCAGG
TCAACGCCGTTGCCTGCGAGACTTGTGGGCATATCGACCTCTATCTCGAAAGCCGTGCCCGCGGCTCGACGAAGTGA
(SEQ ID NO.2)
Open reading frame coding is as shown in Figure 3 with the correspondence of amino acid sequence.
Further translation verification, finds real gene order (SEQ ID NO.1) from above-mentioned open reading frame DNA (SEQ
ID NO.2) inGTGStart, common 198bp, 65 amino acid of coding, its theoretical molecular 7.08kDa, as Rv0609B (- |
704475-704672 |) gene.
GTGACCGACGAGAAGTGCGTGAGATGCGGGGGCGACCAGCTCGTCGAAGGGGCCGTCGTCTGGAACGCGCCGCTGCG
TTTCAAGCGCGAAGGTGCCGGCCACTTCAATCGCGGCACCCAGGTCAACGCCGTTGCCTGCGAGACTTGTGGGCATA
TCGACCTCTATCTCGAAAGCCGTGCCCGCGGCTCGACGAAGTGA(SEQ ID NO.1)
The gene theory coded product amino acid sequence is as shown in SEQ ID NO.3：
VTDEKCVRCGGDQLVEGAVVWNAPLRFKREGAGHFNRGTQVNAVACETCGHIDLYLESRARGSTK(SEQ
ID NO.3)
NCBI-BLASTP analyses are carried out to the amino acid sequence of theoretical gene encoding production shown in the SEQ ID NO.3, with
The similitude of M.bovis RefSeq (WP_003403191.1) and M.tuberculosis Bir189 is 98%,
140070017 similitudes of M.canettii CIPT are 94%, and other species similarities are below 34%, and belong to function not
Know albumen (see Fig. 4).Show Rv0609B that we detect (- | 704475-704672 |) gene outcome in H37Rv bacterial strain numbers
According to being missed annotation in storehouse.
The DNA sequence dna of the Rv0609B (- | 704475-704672 |) gene is compared genome Local BLAST by us
Analysis, as shown in Figure 5, the results showed that Rv0609B (- | 704475-704672 |) gene order belongs to MTBC family specificity bases
Cause, does not have the higher sequence of homology in other species, this show Rv0609B that we have found in H37Rv bacterial strains (- |
704475-704672 |) gene order has preferable sequence-specific, can by MTBC and belong to together interior other mycobacterias and its
Its Bacteria infecting respiratory distinguishes.
Embodiment 2：The method for establishing the compound groups of identification of M TBC
(1) primer is designed：
Based on the CDS sequences of Rv0609B (- | 704475-704672 |) gene as shown in SEQ ID NO.1, use
Oligo7.0 devises PCR primer, and primer sequence is as follows：
F:5’-GACCGACGAGAAGTGCGT-3’(SEQ ID NO.4)；
R:5’-GGCACGGCTTTCGAGATA-3’(SEQ ID NO.5)
Above-mentioned primer is as follows with the position relationship of Rv0609B (- | 704475-704672 |) gene, wherein primer
Correspondence position subscript list is rule.
GTGACCGACGAGAAGTGCGTGAGATGCGGGGGCGACCAGCTCGTCGAAGGGGCCGTCGTCTGGAACGCGCCGCTGCG
TTTCAAGCGCGAAGGTGCCGGCCACTTCAATCGCGGCACCCAGGTCAACGCCGTTGCCTGCGAGACTTGTGGGCATA
TCGACCTCTATCTCGAAAGCCGTGCCCGCGGCTCGACGAAGTGA(SEQ ID NO.1)
(2) STb gene of strain to be tested of the extraction including M.tuberculosis H37Rv, 40 plants of Mycobacterium marks
For quasi- bacterial strain by Chinese medicine bacteria culture preservation administrative center (CMCC) preservation, remaining 16 plants of non-tuberculous mycobacteria is Chinese
309 hospital clinical separation strains of people's liberation army, have completed the sequencing of strain 16S rna genes, comparison and NCBI sequences and have submitted work,
Strain to be tested is as shown in table 1：
The related strain that table 1. is selected
(3) amplification of DNA fragments, carries out polymerase chain (PCR) reaction, and above-mentioned F/R primers used are expanded.
PCR system (25 μ L) is ddH2O (9.5 μ L), 2XTaq PCR MasterMix (TIANGEN, 12.5 μ L) primers F
(10 μM, 1 μ L), primer R (10 μM, 1 μ L), DNA profiling (1 μ L)；
Amplification program：94 DEG C of pre-degeneration 3min, 94 DEG C denaturation 30s, 58 DEG C annealing 30s, 72 DEG C extension 1min, 35 follow
Ring, 72 DEG C of extension 5min.
(4) amplified production electrophoresis detection, the electrophoresis detection in Ago-Gel, 1 × TBE electrophoresis liquids.As a result such as Fig. 6 institutes
Show, amplified band occur at 178bp in MTBC and positive controls, and actual amplification is consistent with expection, and specificity is
95%.
(5) in order to further verify the sequence of the DNA of amplification, we have carried out extension increasing sequence sequencing and and former sequence ratio
Compared with as shown in fig. 7, result is consistent completely with expection, sequence is correct, this further demonstrates depositing for new leakage annotation gene
.
This method for showing to be carried out the compound group's identifications of MTBC based on Rv0609B (- | 704475-704672 |) gene truly may be used
Lean on.
SEQUENCE LISTING
<110>Beijing Proteome Research Center
<120>Mycobacterium tuberculosis H37Rv encoding gene and its application
<130> BJ1936-17P121792
<160> 6
<170> PatentIn version 3.3
<210> 1
<211> 198
<212> DNA
<213> Artificial
<220>
<223>Mycobacterium tuberculosis H37Rv encoding gene Rv0609B (- | 704475-704672 |)
<400> 1
gtgaccgacg agaagtgcgt gagatgcggg ggcgaccagc tcgtcgaagg ggccgtcgtc 60
tggaacgcgc cgctgcgttt caagcgcgaa ggtgccggcc acttcaatcg cggcacccag 120
gtcaacgccg ttgcctgcga gacttgtggg catatcgacc tctatctcga aagccgtgcc 180
cgcggctcga cgaagtga 198
<210> 2
<211> 231
<212> DNA
<213> Artificial
<220>
<223>Include the open reading frame DNA sequence dna of leakage annotation peptide fragment
<400> 2
tagcctggcc agccgcagag aaggggaggc gtcgtgaccg acgagaagtg cgtgagatgc 60
gggggcgacc agctcgtcga aggggccgtc gtctggaacg cgccgctgcg tttcaagcgc 120
gaaggtgccg gccacttcaa tcgcggcacc caggtcaacg ccgttgcctg cgagacttgt 180
gggcatatcg acctctatct cgaaagccgt gcccgcggct cgacgaagtg a 231
<210> 3
<211> 65
<212> PRT
<213> Artificial
<220>
<223>Rv0609B (- | 704475-704672 |) gene theory coded product amino acid sequence
<400> 3
Val Thr Asp Glu Lys Cys Val Arg Cys Gly Gly Asp Gln Leu Val Glu
1 5 10 15
Gly Ala Val Val Trp Asn Ala Pro Leu Arg Phe Lys Arg Glu Gly Ala
20 25 30
Gly His Phe Asn Arg Gly Thr Gln Val Asn Ala Val Ala Cys Glu Thr
35 40 45
Cys Gly His Ile Asp Leu Tyr Leu Glu Ser Arg Ala Arg Gly Ser Thr
50 55 60
Lys
65
<210> 4
<211> 18
<212> DNA
<213> Artificial
<220>
<223>F primer sequences
<400> 4
gaccgacgag aagtgcgt 18
<210> 5
<211> 18
<212> DNA
<213> Artificial
<220>
<223>R primer sequences
<400> 5
ggcacggctt tcgagata 18
<210> 6
<211> 18
<212> PRT
<213> Artificial
<220>
<223>Leakage annotation peptide fragment
<400> 6
Cys Gly Gly Asp Gln Leu Val Glu Gly Ala Val Val Trp Asn Ala Pro
1 5 10 15
Leu Arg
Claims (10)
1. a kind of Mycobacterium tuberculosis H37Rv encoding gene, the nucleotide sequence such as SEQ ID NO.1 institutes of the encoding gene
Show.
2. the Mycobacterium tuberculosis H37Rv encoding gene described in claim 1, it is characterised in that the gene code such as SEQ ID
Amino acid shown in NO.3 sequences.
3. a kind of bar code molecular labeling, as detecting and/or identifying mycobacterium tuberculosis complex, it includes examined as standard
Mycobacterium tuberculosis H37Rv encoding gene described in the claim 1 of cls gene.
A 4. species-specific PCR primers, for expanding the Mycobacterium tuberculosis H37Rv encoding gene described in claim 1.
5. the PCT primers described in claim 4, it is characterised in that the sequence of the primer is：
F:5’-GACCGACGAGAAGTGCGT-3’；
R:5’-GGCACGGCTTTCGAGATA-3’。
6. a kind of detection method of mycobacterium tuberculosis complex identification, includes the following steps：
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) DNA obtained using step (1) adds amplimer as template, carries out PCR；
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) result of step (3) is compared with the encoding gene described in claim 1, it is to be measured according to its homologous sex determination
It whether there is mycobacterium tuberculosis complex in sample.
7. the amplimer sequence described in the detection method described in claim 6, wherein step (2) is：
F:5’-GACCGACGAGAAGTGCGT-3’；
R:5’-GGCACGGCTTTCGAGATA-3’。
8. the detection method described in claim 6, wherein in step (4), if homology is more than 99%, test sample is treated in judgement
Contain mycobacterium tuberculosis complex in product.
9. a kind of detection kit, will comprising the Mycobacterium tuberculosis H37Rv encoding gene described in claim 1 and/or right
Seek the Specific PCR primers described in 4.
10. the Mycobacterium tuberculosis H37Rv encoding gene described in claim 1 is in tuberculosis epidemiology survey and/or clinical knot
Application in core patient quick diagnosis and discriminating.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711249300.3A CN108004253B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201711249300.3A CN108004253B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN108004253A true CN108004253A (en) | 2018-05-08 |
| CN108004253B CN108004253B (en) | 2021-04-20 |
Family
ID=62055853
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201711249300.3A Active CN108004253B (en) | 2017-12-01 | 2017-12-01 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN108004253B (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110343706A (en) * | 2019-01-25 | 2019-10-18 | 北京蛋白质组研究中心 | Mycobacterium tuberculosis H37Rv encoding gene and its application |
| CN111269857A (en) * | 2020-02-19 | 2020-06-12 | 首都医科大学附属北京胸科医院 | Application of Rv0253 protein in separation of mycobacterium tuberculosis |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1715422A (en) * | 2004-06-30 | 2006-01-04 | 中国农业科学院哈尔滨兽医研究所 | Novel Mycobacterium bovis and the method for quick identification of mycobacterium tuberculosis and application |
| CN103014135A (en) * | 2011-09-22 | 2013-04-03 | 上海市肺科医院 | Method for identifying mycobacterium tuberculosis |
| CN104561245A (en) * | 2013-10-16 | 2015-04-29 | 复旦大学 | Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex) |
-
2017
- 2017-12-01 CN CN201711249300.3A patent/CN108004253B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1715422A (en) * | 2004-06-30 | 2006-01-04 | 中国农业科学院哈尔滨兽医研究所 | Novel Mycobacterium bovis and the method for quick identification of mycobacterium tuberculosis and application |
| CN103014135A (en) * | 2011-09-22 | 2013-04-03 | 上海市肺科医院 | Method for identifying mycobacterium tuberculosis |
| CN104561245A (en) * | 2013-10-16 | 2015-04-29 | 复旦大学 | Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex) |
Non-Patent Citations (3)
| Title |
|---|
| COLE,S.T.,ET AL: "UniProtKB/Swiss-Prot: P0DN33.1", 《GENBANK》 * |
| 毛欣茹 等: "建立基于gyrB 基因检测结核分枝杆菌复合物的荧光定量PCR法", 《临床检验杂志》 * |
| 赵加玲 等: "结核分枝杆菌H37Rv 新基因Rv2742 克隆表达及纯化", 《生物工程学报》 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110343706A (en) * | 2019-01-25 | 2019-10-18 | 北京蛋白质组研究中心 | Mycobacterium tuberculosis H37Rv encoding gene and its application |
| CN111269857A (en) * | 2020-02-19 | 2020-06-12 | 首都医科大学附属北京胸科医院 | Application of Rv0253 protein in separation of mycobacterium tuberculosis |
Also Published As
| Publication number | Publication date |
|---|---|
| CN108004253B (en) | 2021-04-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Ikryannikova et al. | Discrimination between Streptococcus pneumoniae and Streptococcus mitis based on sorting of their MALDI mass spectra | |
| Ikryannikova et al. | Misidentification of alpha-hemolytic streptococci by routine tests in clinical practice | |
| US20140162260A1 (en) | Primers, snp markers and method for genotyping mycobacterium tuberculosis | |
| CN110408629B (en) | Mycobacterium tuberculosis H37Rv encoding gene and application thereof | |
| CN110408630A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN106811530A (en) | Kit and primer based on HRM technology for detection Drug Resistance of Mycobacterium Tuberculosis | |
| CN107083443B (en) | Primer combination for PCR detection of Elizabeth meningitis and septica | |
| CN108004253A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| Krawczyk et al. | Molecular identification and genotyping of staphylococci: Genus, species, strains, clones, lineages, and interspecies exchanges | |
| CN105420392B (en) | One group of gene new mutation relevant to newborn's Tendon defection phenotype and detection kit | |
| CN108165562A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165561A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN102094077A (en) | Kit for detecting genotype of mycobacterium tuberculosis clinical isolation strain quickly | |
| CN108165565A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN115976235B (en) | Identification method of Lactobacillus delbrueckii CICC6047 strain, and primer, kit and application thereof | |
| CN108165564A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165560A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110408632A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110423835A (en) | Primer composition for lower respiratory tract the pathogenic microorganism examination | |
| CN108165563A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110408631A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110343706A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| JP4379308B2 (en) | Genotyping method of methicillin-resistant Staphylococcus aureus and primer set used therefor | |
| KR100568702B1 (en) | DNA microarray for species identification of microorganism and its manufacture method | |
| Zhu et al. | Metataxonomics of Internal Transcribed Spacer amplicons in cerebrospinal fluid for diagnosing and genotyping of cryptococcal meningitis |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20240201 Address after: 100850 No. 27 Taiping Road, Beijing, Haidian District Patentee after: ACADEMY OF MILITARY MEDICAL SCIENCES Country or region after: China Address before: Building 1, No.33, kekeyuan Road, Changping District, Beijing Patentee before: BEIJING PROTEOME RESEARCH CENTER Country or region before: China |
|
| TR01 | Transfer of patent right |