CN110408631A - Mycobacterium tuberculosis H37Rv encoding gene and its application - Google Patents
Mycobacterium tuberculosis H37Rv encoding gene and its application Download PDFInfo
- Publication number
- CN110408631A CN110408631A CN201810403796.3A CN201810403796A CN110408631A CN 110408631 A CN110408631 A CN 110408631A CN 201810403796 A CN201810403796 A CN 201810403796A CN 110408631 A CN110408631 A CN 110408631A
- Authority
- CN
- China
- Prior art keywords
- mycobacterium tuberculosis
- gene
- rv2494c
- encoding gene
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 82
- 241001646725 Mycobacterium tuberculosis H37Rv Species 0.000 title claims abstract description 15
- 108700035964 Mycobacterium tuberculosis HsaD Proteins 0.000 title claims abstract description 14
- 241001302239 Mycobacterium tuberculosis complex Species 0.000 claims abstract description 37
- 238000001514 detection method Methods 0.000 claims abstract description 18
- 201000008827 tuberculosis Diseases 0.000 claims description 15
- 150000001413 amino acids Chemical class 0.000 claims description 9
- 230000003321 amplification Effects 0.000 claims description 8
- 238000004458 analytical method Methods 0.000 claims description 8
- 238000003199 nucleic acid amplification method Methods 0.000 claims description 7
- 241000894007 species Species 0.000 claims description 5
- 238000003745 diagnosis Methods 0.000 claims description 3
- 238000000926 separation method Methods 0.000 claims description 3
- 238000000605 extraction Methods 0.000 claims description 2
- 238000001502 gel electrophoresis Methods 0.000 claims description 2
- 238000012360 testing method Methods 0.000 claims description 2
- 101150030367 cls gene Proteins 0.000 claims 1
- 238000002372 labelling Methods 0.000 claims 1
- 239000002773 nucleotide Substances 0.000 claims 1
- 125000003729 nucleotide group Chemical group 0.000 claims 1
- 238000003752 polymerase chain reaction Methods 0.000 claims 1
- 230000020509 sex determination Effects 0.000 claims 1
- 108010033276 Peptide Fragments Proteins 0.000 description 31
- 102000007079 Peptide Fragments Human genes 0.000 description 31
- 230000001580 bacterial effect Effects 0.000 description 15
- 238000000034 method Methods 0.000 description 14
- 108020004414 DNA Proteins 0.000 description 13
- 102000004169 proteins and genes Human genes 0.000 description 9
- 108091028043 Nucleic acid sequence Proteins 0.000 description 6
- 108700026244 Open Reading Frames Proteins 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 238000012163 sequencing technique Methods 0.000 description 5
- 238000001228 spectrum Methods 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 210000002345 respiratory system Anatomy 0.000 description 4
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 3
- 238000012408 PCR amplification Methods 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 235000013399 edible fruits Nutrition 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 244000052769 pathogen Species 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- YADRBUZBKHHDAO-XPUUQOCRSA-N His-Gly-Ala Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)NCC(=O)N[C@@H](C)C(O)=O YADRBUZBKHHDAO-XPUUQOCRSA-N 0.000 description 2
- 241000186359 Mycobacterium Species 0.000 description 2
- 241000256084 Mycobacterium riyadhense Species 0.000 description 2
- 206010057190 Respiratory tract infections Diseases 0.000 description 2
- ZOHGLPQGEHSLPD-FXQIFTODSA-N Ser-Gln-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O ZOHGLPQGEHSLPD-FXQIFTODSA-N 0.000 description 2
- AZSHAZJLOZQYAY-FXQIFTODSA-N Val-Ala-Ser Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O AZSHAZJLOZQYAY-FXQIFTODSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 244000052616 bacterial pathogen Species 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 150000001875 compounds Chemical group 0.000 description 2
- 238000004925 denaturation Methods 0.000 description 2
- 230000036425 denaturation Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 239000012634 fragment Substances 0.000 description 2
- 108010049041 glutamylalanine Proteins 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 230000001717 pathogenic effect Effects 0.000 description 2
- 238000004321 preservation Methods 0.000 description 2
- 238000012797 qualification Methods 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 108010048818 seryl-histidine Proteins 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012795 verification Methods 0.000 description 2
- 108020004465 16S ribosomal RNA Proteins 0.000 description 1
- CXRCVCURMBFFOL-FXQIFTODSA-N Ala-Ala-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CXRCVCURMBFFOL-FXQIFTODSA-N 0.000 description 1
- BEMGNWZECGIJOI-WDSKDSINSA-N Ala-Gly-Glu Chemical compound [H]N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O BEMGNWZECGIJOI-WDSKDSINSA-N 0.000 description 1
- XMZZGVGKGXRIGJ-JYJNAYRXSA-N Arg-Tyr-Val Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O XMZZGVGKGXRIGJ-JYJNAYRXSA-N 0.000 description 1
- SPCONPVIDFMDJI-QSFUFRPTSA-N Asn-Ile-Val Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(O)=O SPCONPVIDFMDJI-QSFUFRPTSA-N 0.000 description 1
- NYQHSUGFEWDWPD-ACZMJKKPSA-N Asp-Gln-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC(=O)O)N NYQHSUGFEWDWPD-ACZMJKKPSA-N 0.000 description 1
- RSMIHCFQDCVVBR-CIUDSAMLSA-N Asp-Gln-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(O)=O)CCCNC(N)=N RSMIHCFQDCVVBR-CIUDSAMLSA-N 0.000 description 1
- JJQGZGOEDSSHTE-FOHZUACHSA-N Asp-Thr-Gly Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O JJQGZGOEDSSHTE-FOHZUACHSA-N 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 206010011409 Cross infection Diseases 0.000 description 1
- BPHKULHWEIUDOB-FXQIFTODSA-N Cys-Gln-Gln Chemical compound SC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O BPHKULHWEIUDOB-FXQIFTODSA-N 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 108010042407 Endonucleases Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- OGNJZUXUTPQVBR-BQBZGAKWSA-N Glu-Gly-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O OGNJZUXUTPQVBR-BQBZGAKWSA-N 0.000 description 1
- FSPVILZGHUJOHS-QWRGUYRKSA-N Gly-His-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CNC=N1 FSPVILZGHUJOHS-QWRGUYRKSA-N 0.000 description 1
- IDAHFEPYTJJZFD-PEFMBERDSA-N Ile-Asp-Glu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)O)N IDAHFEPYTJJZFD-PEFMBERDSA-N 0.000 description 1
- YCKPUHHMCFSUMD-IUKAMOBKSA-N Ile-Thr-Asp Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O)N YCKPUHHMCFSUMD-IUKAMOBKSA-N 0.000 description 1
- YOKVEHGYYQEQOP-QWRGUYRKSA-N Leu-Leu-Gly Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YOKVEHGYYQEQOP-QWRGUYRKSA-N 0.000 description 1
- BMHIFARYXOJDLD-WPRPVWTQSA-N Met-Gly-Val Chemical compound [H]N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O BMHIFARYXOJDLD-WPRPVWTQSA-N 0.000 description 1
- 241001467553 Mycobacterium africanum Species 0.000 description 1
- 241000186366 Mycobacterium bovis Species 0.000 description 1
- 241001312372 Mycobacterium canettii Species 0.000 description 1
- 241000211133 Mycobacterium caprae Species 0.000 description 1
- 241000187919 Mycobacterium microti Species 0.000 description 1
- 241000699502 Mycobacterium mungi Species 0.000 description 1
- 241000656726 Mycobacterium orygis Species 0.000 description 1
- 241001457456 Mycobacterium pinnipedii Species 0.000 description 1
- 241001093674 Mycobacterium suricattae Species 0.000 description 1
- 206010036790 Productive cough Diseases 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- DJIJBQYBDKGDIS-JYJNAYRXSA-N Tyr-Val-Val Chemical compound CC(C)[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(O)=O DJIJBQYBDKGDIS-JYJNAYRXSA-N 0.000 description 1
- VVZDBPBZHLQPPB-XVKPBYJWSA-N Val-Glu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VVZDBPBZHLQPPB-XVKPBYJWSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 108010040443 aspartyl-aspartic acid Proteins 0.000 description 1
- 238000012550 audit Methods 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000012268 genome sequencing Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 238000007689 inspection Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000007726 management method Methods 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 208000008128 pulmonary tuberculosis Diseases 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000010183 spectrum analysis Methods 0.000 description 1
- 210000003802 sputum Anatomy 0.000 description 1
- 208000024794 sputum Diseases 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/35—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Mycobacteriaceae (F)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6869—Methods for sequencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6876—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
- C12Q1/6888—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms
- C12Q1/689—Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for detection or identification of organisms for bacteria
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Health & Medical Sciences (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Analytical Chemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The present invention relates to a kind of Mycobacterium tuberculosis H37Rv and its applications, more particularly to new leakage annotation encoding gene Rv2494c (- | 2808520-2808696 |), its standard gene that can be used as mycobacterium tuberculosis complex Molecular Identification, Molecular Identification and clinical detection for mycobacterium tuberculosis complex.
Description
Technical field
The present invention relates to genetic test fields, and in particular to identifies pathogen species.
Background technique
Mycobacterium tuberculosis (Mycobacterium tuberculosis, MTB) is to cause mankind pathogen lungy.
Each organ of whole body can be invaded, but is most common with pulmonary tuberculosis.Tuberculosis is infectious disease particularly important so far, seriously threatens the mankind
Life and health.According to WHO, every year there are about 8,000,000 new cases generation, at least 3,000,000 people die of the disease.The clinical bacterium of MTB
The difficult culture of strain, slow growth, with other mycobacteria energy cross-infections, tuberculosis and the differentiation of other symptoms of respiratory tract infection difficulties etc.
Feature brings great difficulty to clinical quick diagnosis and treatment.Therefore establish quick, accurate, special, sensitive, cheap knot
Core disease detection method is the prerequisite and clinical labororatory's mycobacteria detection faces of effective treatment, control tuberculosis sprawling
The new challenge and new task faced.
Mycobacterium tuberculosis complex (Mycobacterium tuberculosis complex, MTBC), including
M.tuberculosis、M.africanum、M.orygis、M.bovis、M.microti、M.canettii、M.caprae、
The mycobacterias monoid such as M.pinnipedii, M.suricattae, M.mungi, these species can cause people and other life
Body tuberculosis.Following three classes are broadly divided into the identification method of MTBC both at home and abroad at present: traditional isolated culture；Molecular level inspection
It surveys (IS6110, restriction fragment length polymorphism analysis, multidigit point variable number repeated fragment polymorphism analysis etc.)；Thallus at
Divide (fatty acid, mycolic acid) chromatogram analysis method.Though three classes method has the advantages that respective, also there is shortcoming, such as passes
System is separately cultured the period, and long with thallus can to cultivate rate low；Molecular level detection at present is in terms of specificity, sensitivity and simplicity
It is still poorer；It is drive member specificity analysis higher cost, complicated for operation.
MTB H37Rv is the earliest MTB bacterial strain for completing full figure sequencing in completion genome sequencing in 1998.Since then, respectively
State researchers are tactful based on algorithm optimization, annotating software update, transcription group and proteomics etc., always in perfect, benefit
Fill H37Rv gene annotation database.However, since MTB belongs to prokaryotes, due to prokaryotic gene group remarking technology itself
Deficiency, the fine energy in genome annotation
In the presence of annotation mistake (excessively annotation, genetic borders mistake and ORF starting, termination site mistake, alternative splicing, core
Sugared body displacement, leakage annotation), to deeply, accurately parsing biological mechanism brings puzzlement.To solve this problem, protein gene
Group learns (Proteogenomics) though having been used for the correction that H37Rv has annotated gene, however, high proportion false positive, conventional skill
Art is difficult to carry out annotation predictive genes, new gene verifying, new gene functional analysis and its application etc. to be the difficulty that the field is faced
Topic.
Generally speaking, traditional mycobacterium tuberculosis complex (MTBC) identification strategy has period length, complex steps, specifically
The defects of property and sensitivity is not high.H37Rv full-length genome is annotated again further to improve, finds to omit annotation in H37Rv
Gene, it is ensured that H37Rv full-length genome omits annotation gene and its application technology in MTBC Molecular Identification is effectively protected,
It is imperative to develop and use H37Rv new gene fast accurate mirror method for distinguishing in MTBC monoid.
Summary of the invention
It is an object of the present invention to provide a kind of encoding gene that Mycobacterium tuberculosis H37Rv is new, which is H37Rv
Leakage annotation encoding gene Rv2494c (- | 2808520-2808696 |), it can be used as mycobacterium tuberculosis complex bar code point
Son label, for detecting mycobacterium tuberculosis complex, sequence is as shown in SEQ ID NO.1.
Other objects of the present invention include providing the Specific PCR primers and the offer that can be used for expanding above-mentioned encoding gene
It is a kind of to detect or identify the detection method that whether there is mycobacterium tuberculosis complex in sample；The present invention also provides with above-mentioned volume
The application of the detection kit and said gene of code gene-correlation.
According to an aspect of the present invention, by comparing protein gene group investigative technique, it was found that one in H37Rv
It is difficult to by the albumen coded sequence of predictive genes software discovery, which can be effectively by MTBC and the other species differentiations belonged to
It comes.The gene is the omission annotation base of mycobacterium tuberculosis (Mycobacterium tuberculosis H37Rv)
Cause, i.e. Rv2494c (- | 2808520-2808696 |), after NCBI-BLASTP, any sequence is arrived without comparing in database,
Belong to Unknown Function albumen.It is studied through comparative genomics and finds that the gene order can be by mycobacterium tuberculosis complex (MTBC)
Other kinds of bacterial strain and Mycobacterium, which distinguish, to be come.
Specifically, design can Rv2494c (- | 2808520-2808696 |) gene to MTBC realize that specific amplification draws
Object, primer as proposed by the invention, primer sequence are as follows:
F:5'-TTGTTGGGCGAGGGTGAA-3'；
R:5’-CGATGACGATGTTCCGTTGAT-3’。
It, can be quickly quasi- according to the presence or absence of the gene DNA sequence PCR product in sample to be tested or the difference of DNA sequence dna
True identification of M TBC.
According to another aspect of the present invention, the standard code gene new based on above-mentioned Mycobacterium tuberculosis H37Rv, this hair
The bright method for specifically establishing detection or identifying mycobacterium tuberculosis complex, steps are as follows:
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) DNA obtained using step (1) carries out PCR amplification using following primer as template:
F:5'-TTGTTGGGCGAGGGTGAA-3'(SEQ ID NO.4)；
R:5’-CGATGACGATGTTCCGTTGAT-3’(SEQ ID NO.5)。
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) result of step (3) and bar code gene Rv2494c (- | 2808520-2808696 |) are compared, such as
Fruit homology is greater than 99%, determines that sample to be tested contains mycobacterium tuberculosis complex.
Further, above-mentioned detection method tentatively carries out electrophoretic analysis to PCR product, such as according to DNA bar code principle
Fruit strain to be tested does not have target stripe, illustrates that the bacterial strain is not MTBC；If there is band, then can further sequence verification, will survey
The standard sequence that sequence obtains series and the Rv2494c of H37Rv (- | 2808520-2808696 |) carries out Homology search and comparison, obtains
The similitude between sequence is obtained, if sequence homology is greater than 99%, that is, can determine that bacterial strain may be MTBC；According to identification bacterium to be identified
The DNA bar code sequence of strain and standard sequence cluster situation are common to distinguish MTBC family and non-tuberculous mycobacteria, respiratory tract
Pathogen and common respiratory tract virus.
The detection method can be used to the strain idenfication research to mycobacterium tuberculosis complex, it can also be used to clinical quick
It examines.Sample to be tested can be from H37Rv bacterial strain, other MTBC, non-tuberculous mycobacteria, respiratory tract encountered pathogenic bacteria, breathing
Road common virus bacterial strain；Either directly use tuberculosis and other respiratory tract patient sputums, saliva or blood.
Based on the above method, the present invention also provides detection kit, and kit containers are provided with to detect knot
The reagent of core mycobacteria H37Rv new standard code gene, what is concurrently provided can be through governmental drug management organization
Manufacture, use and sales informations audit, in relation to drug or biological products.For example, directly detecting sample after using PCR amplification
The reagent of Rv2494c in product (- | 2808520-2808696 |) gene, such as can be reacted containing amplimer, dNTP, for PCR
Archaeal dna polymerase and its buffer, endonuclease reaction and/or sequencing reaction needed for reagent etc. it is one or more.Art technology
Personnel are it is known that the above component is only illustrative, for example, the primer can use above-mentioned Specific PCR primers, the use
It can be used for the enzyme of PCR amplification in the archaeal dna polymerase of PCR reaction.The detection of encoding gene of the invention can also be with integrated
The mode of such as genetic chip provide.
The utility model has the advantages that the present invention provides one kind to be used as mycobacterium tuberculosis complex (Mycobacterium
Tuberculosis complex, MTBC) Molecular Identification standard gene and method for identifying molecules, the gene can effectively by
MTBC comes with the other species differentiations belonged to, overcomes existing mycobacterium tuberculosis complex using the identification method of the gene
The disadvantages of design of primers multiplicity in qualification process, result poor repeatability, has the characteristics that general, easy amplification, easily compares, can
Come with accurately identifying the monoid from the close other mycobacterias of affiliation or other respiratory tract infection germs, is
Tuberculosis epidemiological survey and clinical tuberculosis patient quick diagnosis identify offer strong technological means and research tool.
Detailed description of the invention
Fig. 1: the peptide spectrum matching evidence of the newly encoded gene of discovery is supported；
Fig. 2: section of synthesized peptide mass spectrogram and former identification peptide fragment mass spectrogram comparison；
Fig. 3: peptide fragment is located the protein sequence corresponding diagram of region ORF coding；Underscore part is proteomics identification
And it is synthesized the peptide fragment of peptide fragment verifying；
Fig. 4: Rv2494c (- | 2808520-2808696 |) standard gene sequence homology compares；
Protein sequence BLASTP knot corresponding to Fig. 5: H37Rv bacterial strain Rv2494c (- | 2808520-2808696 |) gene
Fruit；
Fig. 6: Rv2494c (- | 2808520-2808696 |) specific primer PCR amplified production agarose gel electrophoresis results；
Wherein, each Lane Sample specifying information is shown in Table 1.
Fig. 7: Rv2494c (- | 2808520-2808696 |) gene PCR expands sequencing result and standard sequence compares.
Specific embodiment
The present invention will be further described With reference to embodiment, but does not limit scope of the invention as claimed.
Agents useful for same of the present invention is commercially available.
Embodiment 1: the leakage for finding H37Rv strain gene group annotates encoding gene
The high covering protein group verifying of 1.1 pairs of H37Rv strain gene groups
The depth covering research of protein group has been carried out to H37Rv bacterial strain using high covering protein technique.It is based on
Tuberculosis (20160307) database has carried out annotation encoding gene to its genome using 3 engine of pFind and has verified.
In order to find new protein-coding region, we are based on protein gene omics technology, are sent out in NCBI with pAnno software H37Rv
Full-length genome (NC_000962.3) file of table carries out six reading frame data base interpretations, and using this database to spectra count
According to the identification for having carried out new peptide fragment and novel protein.In order to reduce false positive rate, we have used 3 during data filtering
It is S-FDR, T-FDR I and T-FDR respectively kind to peptide fragment has been annotated and new peptide fragment separately estimates the filter method of classification FDR
II。
Analyzed through data, we identify 3238 H37Rv altogether and have annotated gene, coverage be up to the 80% of the bacterial strain with
On, this is to report maximum H37Rv protein spectrum data so far.In addition, we obtain new peptide fragment after 3 kinds of FDR≤1 are filtered.
In order to further ensure that new peptide fragment quality, spectrogram corresponding to our new peptide fragments remaining to above-mentioned filtering has carried out spectrogram quality
Screening, finally remains the high-quality peptide fragment of some spectrograms.For further check these higher peptide fragments of spectrogram quality not by
Caused by having annotated peptide fragment and single amino acids mutation occurs, We conducted amino acid mutation verifications, it is ensured that these new peptide fragments are
H37Rv newly identifies peptide fragment.
The coding albumen and database authentication of 1.2 couples of Rv2494c (- | 2808520-2808696 |) gene
After the verifying of excessively high covering protein group, it has been found that some doubtful new leakages annotate peptide fragment, can to above-mentioned height
Doubtful new peptide fragment progress peptide fragment synthesis verifying is believed to obtain, according to new peptide fragment original spectrum and peptide fragment synthesis spectrum similarity >=0.9 conduct of marking
Similarity threshold has 1 peptide fragment by verifying, corresponds to new open reading frame (Open Reading after marking screening
Frame, ORF), i.e., the potential leakage of current H37Rv bacterial strain annotates gene.
Wherein, it has been found that new leakage annotation gene Rv2494c (- | 2808520-2808696 |), compare through BLASTP,
Its similar sequences is in M.tuberculosis N09901618, M.riyadhense and DSM 451764M.tuberculosis
Unknown Function albumen is noted as in 179 bacterial strain of Bir, therefore the gene belongs to leakage annotation gene in H37Rv.We examine
It measures peptide fragment YVVSQEAVASHGA (SEQ ID NO.6), and corresponds to new gene Rv2494c (- | 2808520-2808696 |),
As shown in Figure 1, spectrogram quality is fine, b/y ion continuous coupling, miscellaneous peak signal is lower, as a result very credible.
Further to confirm this qualification result, we newly identify that the amino acid sequence chemistry of peptide fragment synthesizes according to us
The peptide fragment, and the second level spectrogram of the section of synthesized peptide is produced using above-mentioned mass spectral analysis condition.
The high energy collision MS that we generate section of synthesized peptide2It is verified, level-one parent ion and second level daughter ion are equal
Meet theoretical value, the peptide section sequence for showing that we synthesize is correct；On this basis, we have checked according to large-scale protein by hand
The MS of the section of synthesized peptide for the new peptide section sequence that matter group data authentication arrives2With the new peptide fragment spectrogram of Large scale identification, the two is almost
Unanimously, YVVSQEAVASHGA similitude cosin value is 0.99, it was demonstrated that the correct nothing of new peptide fragment that we identify from H37Rv
Accidentally.(Fig. 2).
After the sequence for confirming above-mentioned leakage annotation peptide fragment, according to the gene location where above-mentioned peptide fragment, with previous termination
The region that codon and the latter terminator codon include is boundary, obtains the open reading frame comprising above-mentioned new leakage annotation peptide fragment
(ORF) DNA sequence dna, as shown in SEQ ID NO.2.
TGATCGAGTCGCCGGAGACCGCGCTGTTGGATCTGTAGCCGGGCGGGCTGGCAGCTTTGGTTAGAGGATGGTCAGCA
GCTCCACTGGCGTCTTGGGGCGTTGTTGGGCGAGGGTGAAGACACCGGCGTCGAAGGTGACCAGGCGGACGCCGCGC
CGGCGGGCGAGTGTCAGCAGATGGGCGTCGGTCACCTGGCGATAACCGACGATCAACGGAACATCGTCATCGACGAG
CGATACGTCGTCAGCCAGGAAGCGGTGGCCTCCCACGGCGCGTAG(SEQ ID NO.2)
Open reading frame coding is as shown in Figure 3 with the corresponding relationship of amino acid sequence.
Further translation verifying, finds true gene order (SEQ ID NO.1) from above-mentioned open reading frame DNA (SEQ
ID NO.2) inTTGStarting, total 177bp encodes 58 amino acid, theoretical molecular weight 5.99kDa, as Rv2494c (- |
2808520-2808696 |) gene.
TTGTTGGGCGAGGGTGAAGACACCGGCGTCGAAGGTGACCAGGCGGACGCCGCGCCGGCGGGCGAGTGTCAGCAGAT
GGGCGTCGGTCACCTGGCGATAACCGACGATCAACGGAACATCGTCATCGACGAGCGATACGTCGTCAGCCAGGAAG
CGGTGGCCTCCCACGGCGCGTAG(SEQ ID NO.1)
The gene theory coded product amino acid sequence is as shown in SEQ ID NO.3:
LLGEGEDTGVEGDQADAAPAGECQQMGVGHLAITDDQRNIVIDERYVVSQEAVASHGA(SEQ ID
NO.3)
NCBI-BLASTP analysis is carried out to the amino acid sequence of theory gene encoding production shown in the SEQ ID NO.3,
Similar sequences are in M.tuberculosis N09901618, M.riyadhense DSM 451764, M.tuberculosis Bir
Unknown Function albumen has been noted as in 179 bacterial strains (see Fig. 5).Sufficiently show Rv2494c that we detect (- | 2808520-
2808696 |) gene product is missed annotation in H37Rv bacterial strain database.
The DNA sequence dna of the Rv2494c (- | 2808520-2808696 |) gene is compared genome local by us
BLAST analysis, as shown in Figure 5, the results showed that Rv2494c (- | 2808520-2808696 |) gene order belongs to MTBC family spy
Specific gene does not have the higher sequence of homology, it is meant that we had found in H37Rv bacterial strain in other species
Rv2494c (- | 2808520-2808696 |) gene order has preferable sequence-specific, can by MTBC with belong to it is interior other
Mycobacteria and other Bacteria infecting respiratories distinguish.
Embodiment 2: the method for establishing the compound group of identification of M TBC
(1) design primer:
Based on the CDS sequence of the Rv2494c as shown in SEQ ID NO.1 (- | 2808520-2808696 |) gene, use
Oligo7.0 devises PCR primer, and primer sequence is as follows:
F:5'-TTGTTGGGCGAGGGTGAA-3'(SEQ ID NO.4)；
R:5’-CGATGACGATGTTCCGTTGAT-3’(SEQ ID NO.5)
Above-mentioned primer is as follows with the positional relationship of Rv2494c (- | 2808520-2808696 |) gene, wherein drawing
The scribing line of object corresponding position subscript list.
TTGTTGGGCGAGGGTGAAGACACCGGCGTCGAAGGTGACCAGGCGGACGCCGCGCCGGCGGGCGAGTGTCAGCAGAT
GGGCGTCGGTCACCTGGCGATAACCGACGATCAACGGAACATCGTCATCGACGAGCGATACGTCGTCAGCCAGGAAG
CGGTGGCCTCCCACGGCGCGTAG(SEQ ID NO.1)
(2) total DNA of the strain to be tested including M.tuberculosis H37Rv, 40 plants of Mycobacterium marks are extracted
For quasi- bacterial strain by Chinese medicine bacteria culture preservation administrative center (CMCC) preservation, remaining 16 plants of non-tuberculous mycobacteria is Chinese
309 hospital clinical separation strains of people's liberation army have completed the sequencing of strain 16S rna gene, comparison and NCBI sequence and have submitted work,
Strain to be tested is as shown in table 1:
The related strain that table 1. is selected
(3) amplification of DNA fragments, carries out polymerase chain (PCR) reaction, and above-mentioned F/R primer used is expanded.
PCR system (25 μ L) is dd H2O (9.5 μ L), 2XTaq PCR MasterMix (TIANGEN, 12.5 μ L), primer
F (10 μM, 1 μ L), primer R (10 μM, 1 μ L), DNA profiling (1 μ L)；
Amplification program: 94 DEG C of initial denaturation 3min, 94 DEG C of denaturation 30s, 58 DEG C of annealing 30s, 72 DEG C of extension 1min, 35 follow
Ring, 72 DEG C of extension 5min.
(4) amplified production electrophoresis detection, the electrophoresis detection in Ago-Gel, 1 × TBE electrophoresis liquid.As a result such as Fig. 6 institute
Show, specific band amplified band, and amplification and expected phase occur at only 127bp in MTBC and positive controls
Symbol, specificity are 96.7%.
(5) in order to further verify amplification DNA sequence, we to extension increasing sequence carried out sequencing and and leakage annotation sequence
Column compare, as shown in fig. 7, result is consistent completely with expection, sequence is correct, this further demonstrates new leakage annotation gene
In the presence of.This shows that the method that the compound group's identification of MTBC is carried out based on Rv2494c (- | 2808520-2808696 |) gene really may be used
It leans on.
SEQUENCE LISTING
<110>Beijing Proteome Research Center
<120>Mycobacterium tuberculosis H37Rv encoding gene and its application
<130> BJ1936-18P121915
<160> 6
<170> PatentIn version 3.3
<210> 1
<211> 177
<212> DNA
<213> Artificial
<220>
<223>Mycobacterium tuberculosis H37Rv encoding gene Rv2494c (- | 2808520-2808696 |)
<400> 1
ttgttgggcg agggtgaaga caccggcgtc gaaggtgacc aggcggacgc cgcgccggcg 60
ggcgagtgtc agcagatggg cgtcggtcac ctggcgataa ccgacgatca acggaacatc 120
gtcatcgacg agcgatacgt cgtcagccag gaagcggtgg cctcccacgg cgcgtag 177
<210> 2
<211> 276
<212> DNA
<213> Artificial
<220>
<223>the open reading frame DNA sequence dna of leakage annotation peptide fragment
<400> 2
tgatcgagtc gccggagacc gcgctgttgg atctgtagcc gggcgggctg gcagctttgg 60
ttagaggatg gtcagcagct ccactggcgt cttggggcgt tgttgggcga gggtgaagac 120
accggcgtcg aaggtgacca ggcggacgcc gcgccggcgg gcgagtgtca gcagatgggc 180
gtcggtcacc tggcgataac cgacgatcaa cggaacatcg tcatcgacga gcgatacgtc 240
gtcagccagg aagcggtggc ctcccacggc gcgtag 276
<210> 3
<211> 58
<212> PRT
<213> Artificial
<220>
<223>Rv2494c (- | 2808520-2808696 |) gene theory coded product amino acid sequence
<400> 3
Leu Leu Gly Glu Gly Glu Asp Thr Gly Val Glu Gly Asp Gln Ala Asp
1 5 10 15
Ala Ala Pro Ala Gly Glu Cys Gln Gln Met Gly Val Gly His Leu Ala
20 25 30
Ile Thr Asp Asp Gln Arg Asn Ile Val Ile Asp Glu Arg Tyr Val Val
35 40 45
Ser Gln Glu Ala Val Ala Ser His Gly Ala
50 55
<210> 4
<211> 18
<212> DNA
<213> Artificial
<220>
<223>F primer sequence
<400> 4
ttgttgggcg agggtgaa 18
<210> 5
<211> 21
<212> DNA
<213> Artificial
<220>
<223>R primer sequence
<400> 5
cgatgacgat gttccgttga t 21
<210> 6
<211> 13
<212> PRT
<213> Artificial
<220>
<223>leakage annotation peptide fragment
<400> 6
Tyr Val Val Ser Gln Glu Ala Val Ala Ser His Gly Ala
1 5 10
Claims (10)
1. a kind of Mycobacterium tuberculosis H37Rv encoding gene Rv2494c (- | 2808520-2808696 |), the encoding gene
Nucleotide sequence is as shown in SEQ ID NO.1.
2. Mycobacterium tuberculosis H37Rv encoding gene Rv2494c described in claim 1 (- | 2808520-2808696 |),
It is characterized in that gene coding amino acid as shown in SEQ ID NO.3 sequence.
3. a kind of bar code molecular labeling is used as and detects and/or identify mycobacterium tuberculosis complex, it includes examine as standard
The Mycobacterium tuberculosis H37Rv encoding gene Rv2494c described in claim 1 (- | 2808520-2808696 |) of cls gene.
4. a species-specific PCR primers, for expanding Mycobacterium tuberculosis H37Rv encoding gene described in claim 1
Rv2494c(-|2808520-2808696|)。
5. PCR primer as claimed in claim 4, which is characterized in that the sequence of the primer are as follows:
F:5'-TTGTTGGGCGAGGGTGAA-3'；
R:5’-CGATGACGATGTTCCGTTGAT-3’。
6. a kind of detection method of mycobacterium tuberculosis complex identification, includes the following steps:
(1) the separation and Extraction genomic DNA from sample to be tested；
(2) amplimer is added as template in the DNA obtained using step (1), carries out polymerase chain reaction；
(3) DNA product obtained to step (2) amplification carries out gel electrophoresis analysis or is sequenced；
(4) by the result of step (3) and it is described in claim 1 as standard detection gene Rv2494c (- | 2808520-
2808696 |) be compared, according in its homologous sex determination sample to be tested whether there is mycobacterium tuberculosis complex.
7. detection method as claimed in claim 6, wherein amplimer sequence described in step (2) are as follows:
F:5'-TTGTTGGGCGAGGGTGAA-3'；
R:5’-CGATGACGATGTTCCGTTGAT-3’。
8. detection method as claimed in claim 6, wherein if homology is greater than 99%, determining to test sample in step (4)
Contain mycobacterium tuberculosis complex in product.
9. a kind of detection kit, comprising Mycobacterium tuberculosis H37Rv encoding gene Rv2494c described in claim 1 (- |
2808520-2808696 |) and/or Specific PCR primers as claimed in claim 4.
10. Mycobacterium tuberculosis H37Rv encoding gene Rv2494c described in claim 1 (- | 2808520-2808696 |) In
Application in tuberculosis epidemiological survey and/or clinical tuberculosis patient quick diagnosis and identification.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201810403796.3A CN110408631B (en) | 2018-04-28 | 2018-04-28 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201810403796.3A CN110408631B (en) | 2018-04-28 | 2018-04-28 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN110408631A true CN110408631A (en) | 2019-11-05 |
| CN110408631B CN110408631B (en) | 2021-04-20 |
Family
ID=68357188
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201810403796.3A Active CN110408631B (en) | 2018-04-28 | 2018-04-28 | Mycobacterium tuberculosis H37Rv encoding gene and application thereof |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN110408631B (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1715422A (en) * | 2004-06-30 | 2006-01-04 | 中国农业科学院哈尔滨兽医研究所 | Novel Mycobacterium bovis and the method for quick identification of mycobacterium tuberculosis and application |
| CN103014135A (en) * | 2011-09-22 | 2013-04-03 | 上海市肺科医院 | Method for identifying mycobacterium tuberculosis |
| CN104561245A (en) * | 2013-10-16 | 2015-04-29 | 复旦大学 | Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex) |
-
2018
- 2018-04-28 CN CN201810403796.3A patent/CN110408631B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1715422A (en) * | 2004-06-30 | 2006-01-04 | 中国农业科学院哈尔滨兽医研究所 | Novel Mycobacterium bovis and the method for quick identification of mycobacterium tuberculosis and application |
| CN103014135A (en) * | 2011-09-22 | 2013-04-03 | 上海市肺科医院 | Method for identifying mycobacterium tuberculosis |
| CN104561245A (en) * | 2013-10-16 | 2015-04-29 | 复旦大学 | Rapid identification method and kit for MTBC (mycobacterium tuberculosis complex) |
Non-Patent Citations (3)
| Title |
|---|
| GENBANK: "COX80968.1", 《GENBANK》 * |
| 毛欣茹 等: "建立基于gyrB 基因检测结核分枝杆菌复合物的荧光", 《临床检验杂志》 * |
| 赵加玲 等: "结核分枝杆菌H37Rv 新基因Rv2742 克隆表达及纯化", 《生物工程学报》 * |
Also Published As
| Publication number | Publication date |
|---|---|
| CN110408631B (en) | 2021-04-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Matsumoto et al. | Comprehensive subspecies identification of 175 nontuberculous mycobacteria species based on 7547 genomic profiles | |
| JP5317430B2 (en) | Probe set, probe carrier, and fungal discrimination identification method | |
| Jensen et al. | Candida palmioleophila: characterization of a previously overlooked pathogen and its unique susceptibility profile in comparison with five related species | |
| Ikryannikova et al. | Misidentification of alpha-hemolytic streptococci by routine tests in clinical practice | |
| CN110408629A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110408630A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| KR101954392B1 (en) | Molecular marker for detecting Erwinia amylovora and uses thereof | |
| CN108165562A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108004253A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165561A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110408632A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165564A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165565A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN108165560A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110423835A (en) | Primer composition for lower respiratory tract the pathogenic microorganism examination | |
| CN110408631A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110343706A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| Salehi et al. | Internal Transcribed Spacer rDNA and TEF-1α Gene Sequencing of Pathogenic Dermatophyte Species and Differentiation of Closely Related Species Using PCR-RFLP of The Topoisomerase II | |
| CN108165563A (en) | Mycobacterium tuberculosis H37Rv encoding gene and its application | |
| CN110499380A (en) | A kind of primer pair and detection method detecting Flavobacterium | |
| Zhu et al. | Metataxonomics of Internal Transcribed Spacer amplicons in cerebrospinal fluid for diagnosing and genotyping of cryptococcal meningitis | |
| CN113174443B (en) | Mycobacterium identification method and biological material thereof | |
| CN117230090A (en) | Encoding gene of mycobacterium abscessus and application thereof | |
| Dadar et al. | Molecular Survey of Brucella melitensis Field Isolates using Sequence-Based PCR of Outer Membrane Protein 31 | |
| Savelkoul et al. | High density whole genome fingerprinting of methicillin-resistant and-susceptible strains of Staphylococcus aureus in search of phenotype-specific molecular determinants |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| GR01 | Patent grant | ||
| GR01 | Patent grant | ||
| TR01 | Transfer of patent right | ||
| TR01 | Transfer of patent right |
Effective date of registration: 20240131 Address after: 100850 No. 27 Taiping Road, Beijing, Haidian District Patentee after: ACADEMY OF MILITARY MEDICAL SCIENCES Country or region after: China Address before: Building 1, No.33, kekeyuan Road, Changping District, Beijing Patentee before: BEIJING PROTEOME RESEARCH CENTER Country or region before: China |