CN107372913A - A kind of compound based on Rana nigromaculata activity extract - Google Patents
A kind of compound based on Rana nigromaculata activity extract Download PDFInfo
- Publication number
- CN107372913A CN107372913A CN201710544876.6A CN201710544876A CN107372913A CN 107372913 A CN107372913 A CN 107372913A CN 201710544876 A CN201710544876 A CN 201710544876A CN 107372913 A CN107372913 A CN 107372913A
- Authority
- CN
- China
- Prior art keywords
- parts
- rana nigromaculata
- compound
- activity extract
- compound based
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23F—COFFEE; TEA; THEIR SUBSTITUTES; MANUFACTURE, PREPARATION, OR INFUSION THEREOF
- A23F3/00—Tea; Tea substitutes; Preparations thereof
- A23F3/06—Treating tea before extraction; Preparations produced thereby
- A23F3/14—Tea preparations, e.g. using additives
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Food Science & Technology (AREA)
- Polymers & Plastics (AREA)
- Medicines Containing Plant Substances (AREA)
Abstract
The present invention discloses a kind of compound based on Rana nigromaculata activity extract, including the extraction of Rana nigromaculata active material, the preparation of compound, sterilization, cooling and inspection, and formula is in the preparation process of compound：60 110 parts of Rana nigromaculata activity extract, 30 48 parts of tealeaves, 10 25 parts of Radix Codonopsis, 15 30 parts of the Radix Astragali, 80 120 parts of jujube, 10 20 parts of pomelo peel, 15 45 parts of pot marigold, 10 20 parts of ginkgo leaf, 60 95 parts of Chinese yam, 60 82 parts of sea-buckthorn, 8 20 parts of red Grape Skin, 13 parts of pilose antler, 8 20 parts of fructus hordei germinatus, 41 68 parts of matrimony vine, 0.4 0.8 parts of active peptides, 15 35 parts of orange endo-endothelial layer white endothelium.The present invention compound have the function that reducing blood lipid and protection cell normal function, it is nutritious comprehensively, be easily absorbed by the body, unique flavor, compound economic value height.
Description
Technical field
The invention belongs to technical field of health-care, more particularly to a kind of compounding based on Rana nigromaculata activity extract
Thing.
Background technology
Biologist has found to have an operation to the frog, do not do any sterilization even it is obvious it is infected under the conditions of, its internal organ and
Infection phenomenons will not occur for skin, and wound healing is good, prompt people in the skin of the frog there is it is some can produce antibacterial,
The active material of antiinflammation.Mainly more skin class materials are had now found that, they can protect batrachia not encroached on by microorganism.Mesh
A kind of more skin rivers of the less antibacterial of molecular weight are extracted in the preceding skin for having creeped frog Xenupres laezin from America.East
The skin of ana guentheri that bio-engineering corporation introduces from the U.S. (l } rtaguenthcra) obtains some activity through separation and Extraction
Extract (RGAE).Research has shown that RGAE has a stronger bioactivity, including anti-inflammatory, antibacterial, reducing blood lipid, protection liver are thin
Born of the same parents' normal function etc..
Along with the enhancing of people's health consciousness, nutrient health-care beverage market expands rapidly, Chinese herbal health-caring beverage development
Rapidly.Health drink using Chinese traditional herbs as main component has turned into the new highlight on drinking markets.Predicted according to relevant department,
The coming five years Global Health beverage will be increased with speed of more than one times higher than common beverages growth rate.Establish in China's tradition
The nutrient health-care beverage product of salubrity and healthcare function that has on traditional Chinese medicine and pharmacy and modern healthy theoretical foundation is even more by city
Welcome on field, its prospect are become better and better.The beverage of these healthcare functions has catered to the increasingly stronger consumption of people's health care consciousness
Demand, had deep love for by modern, but the effect of existing health drink reducing blood lipid and protection liver cell is less desirable.
Prior art such as, Chinese invention granted patent document, Authorization Notice No.：The B of CN 102715300, the invention are related to
A kind of strengthening spleen and nourishing blood health drink, it is characterised in that the strengthening spleen and nourishing blood health drink includes following component：Tealeaves 75~
100g, 10~25g of Radix Codonopsis, 15~30g of the Radix Astragali, 80~120g of jujube, 60~95g of Chinese yam, 55~85g of sea-buckthorn,
Red 8~20g of Grape Skin, 8~20g of fructus hordei germinatus, 45~55g of matrimony vine, orange endo-endothelial layer white 15~35g of endothelium, add water
2500 milliliters of strengthening spleen and nourishing blood health drink is made, its preparation method is as follows：Take above-mentioned composition in addition to water to mix to mix
Material, compound are boiled with 5000~5500 milliliters of decoctings, and boiling is filtered after 30~45 minutes, are clarified, are taken supernatant 2500
Milliliter produces strengthening spleen and nourishing blood health drink.The strengthening spleen and nourishing blood health drink of the invention has good nourishes taste, regulation human body
The function of interior vim and vigour and the very mouthfeel of fragrant alcohol, but the beverage in reducing blood lipid, protect in terms of the effect of liver cell also not
It is highly desirable, and the mouthfeel of the beverage also has room for promotion.
The content of the invention
It is nutritious comprehensive, easy it is an object of the invention to provide a kind of compound based on Rana nigromaculata activity extract
It is absorbed by the body, unique flavor, there is reducing blood lipid, anti-inflammatory and protection hepatocyte function.
The scheme taken to achieve the above object of the present invention is：A kind of compound based on Rana nigromaculata activity extract,
Extracted including Rana nigromaculata active material, the preparation of compound, sterilization, cooling and inspection, formula is in the preparation process of compound：
Rana nigromaculata activity extract 60-110 parts, tealeaves 30-48 parts, Radix Codonopsis 10-25 parts, Radix Astragali 15-30 parts, jujube 80-120 parts, shaddock
Sub- skin 10-20 parts, pot marigold 15-45 parts, ginkgo leaf 10-20 parts, Chinese yam 60-95 parts, sea-buckthorn 60-82 parts, red Grape Skin 8-20
Part, pilose antler 1-3 parts, fructus hordei germinatus 8-20 parts, matrimony vine 41-68 parts, active peptides 0.4-0.8 parts, orange endo-endothelial layer white endothelium 15-
35 parts.
Preferably, the active peptides amino acid sequence in compounding composition formula is: MKGLSFVLLVLLLMMPDGEGTDPE
MQYWTCGYRGLCRRFYAEVGHGCRRYRCCAIRA, the active peptides can stimulate thyroid hormone secretion to increase, and promote courage to consolidate
The bile acidification of alcohol, make the increase of excrement excretion of cholesterol, have the function that significantly to reduce cholesterol, and only to cholesterol value
High people plays the role of to reduce cholesterol, and the work(that active peptides can make compound have reducing blood lipid is added in composition formula is compounded
Effect, the economic value of compound is improved, also help the health of drinking person.
Preferably, Rana nigromaculata active material extraction step is：Rana nigromaculata is slaughtered, takes its thoracic cavity, abdominal cavity to leg
Skin freezing is homogenized in sodium acetate buffer, and sodium acetate buffer concentration is 0.2mol/L, pH 4.0, centrifugal treating, is taken
Clear liquid freezes 46 ~ 49h after adding 2mol/L tosylate chlorides, takes out and is dissolved in 37 DEG C, centrifuges, takes sephadex G- on supernatant
100 posts, are eluted with sodium acetate, collect A280nmThere is the part of absorption, merge, clean, freeze-drying, obtain Rana nigromaculata activity extraction
Thing, Rana nigromaculata activity extract have the function that anti-inflammatory, antibacterial, reducing blood lipid and protection cell normal function, can significantly improve this
The health-care effect of compound, body immunity, prevention disease are improved, and active ingredient easily absorbs.
Preferably, the preparation process of compound is：By weight, take tealeaves, Radix Codonopsis, the Radix Astragali, jujube, pomelo peel,
Add after pot marigold, ginkgo leaf, Chinese yam, sea-buckthorn, red Grape Skin, pilose antler, fructus hordei germinatus, matrimony vine, the mixing of orange endo-endothelial layer white endothelium
Water Ultrasonic Wave-Assisted Extraction, 50-75min is cooked by slow fire, filtered, centrifugation, take supernatant to add Rana nigromaculata activity extraction after sterilizing
Thing and active peptides, stir, and obtain compound, and preparing compound by above-mentioned steps has good nourishes taste, regulation
The function of blood in human body in gas, and mentioned component is by reasonably combining and weight proportion, make it have unusual fragrant alcohol
Mouthfeel, has a light shaddock taste, and unique flavor is suitable for people of all ages.
Preferably, Ultrasonic Wave-Assisted Extraction temperature is 30-50 DEG C, power 250w-450w in compound preparation process,
Time is 15-25min, is advantageous to the beneficiating ingredient of each material in formula being leached into water by ultrasonic wave, makes material use
Maximize, improve the compound nutrient composition content of preparation, strengthen its health-care effect.
Preferably, the cooling preservation temperature of compound is -3 ~ 4 DEG C, be advantageous to keep mouthfeel and the Rana nigromaculata of compound
The effect of activity of activity extract and active peptides, fully guarantee compound.
Compared with prior art, beneficial effects of the present invention are：1）Compounding of the invention based on Rana nigromaculata activity extract
Thing have the function that anti-inflammatory, antibacterial, reducing blood lipid and protection cell normal function, it is nutritious comprehensively, be easily absorbed by the body；2）Wind
Taste is unique, has light shaddock taste, is not added with sweetener, acidity agent, pigment and essence etc., compounds to obtain by natural material
The preferable beverage of taste, color and luster, meet modern's health, the consumption concept of nutrition, compound stable system, at sterilization
Reason, not easy to change, rotten or layering, Conservation environment is good, shelf life length；3）The method for preparing compound is simple, and economic value is high,
Can meet the needs of consumer is to mouthfeel and health-care effect.
Embodiment
It is described in further detail with reference to embodiments：
Embodiment 1：
A kind of compound based on Rana nigromaculata activity extract, including the extraction of Rana nigromaculata active material, the preparation of compound, are killed
Bacterium, cooling and inspection, concrete operation step are as follows：
（1）Rana nigromaculata active material extraction step is：Rana nigromaculata is slaughtered, takes its thoracic cavity, the skin freezing in abdominal cavity to leg to exist
It is homogenized in sodium acetate buffer, sodium acetate buffer concentration is 0.2mol/L, pH 4.0, centrifugal treating, takes supernatant to add
47h is freezed after 2mol/L tosylate chlorides, takes out and is dissolved in 37 DEG C, 10000r/min centrifugation 25min, is taken on supernatant
Sephadex G-100 posts, are eluted with sodium acetate, and sodium acetate buffer concentration is 0.2mol/L, pH 4.0, collects A280nmThere is suction
The part of receipts, merge, the impurity such as tosylate chloride are removed to cold distilled water dialysis 24h, freeze-drying, Rana nigromaculata activity is obtained and carries
Take thing.
（2）The preparation process of compound is：By weight, 37 parts of tealeaves, 17 parts of Radix Codonopsis, 18 parts of the Radix Astragali, jujube 98 are taken
It is part, 14 parts of pomelo peel, 32 parts of pot marigold, 18 parts of ginkgo leaf, 69 parts of Chinese yam, 70 parts of sea-buckthorn, 16 parts of red Grape Skin, 2 parts of pilose antler, big
After 20 parts of 14 parts of malt, 45 parts of matrimony vine, orange endo-endothelial layer white endothelium mixing plus water Ultrasonic Wave-Assisted Extraction, ultrasonic assistant soak
Temperature raising degree is 38 DEG C, power 350w, time 16min, is cooked by slow fire 60min, is filtered, and 8000r/min centrifugation 10min, is taken
Rana nigromaculata activity extract and active peptides are added after supernatant sterilizing, stirs, obtains compound；Compound the work in composition formula
Property polypeptid acid sequence is:MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYAEVGHGCRRYRCCAIRA.
（3）Compound is fitted into aseptic bottle, cleans body, checks for the anomalies such as rupture, it is labelled after 1
DEG C Cord blood.
Embodiment 2：
A kind of compound based on Rana nigromaculata activity extract, including the extraction of Rana nigromaculata active material, the preparation of compound, are killed
Bacterium, cooling and inspection, concrete operation step are as follows：
（1）Rana nigromaculata active material extraction step is：Rana nigromaculata is slaughtered, takes its thoracic cavity, the skin freezing in abdominal cavity to leg to exist
It is homogenized in sodium acetate buffer, sodium acetate buffer concentration is 0.2mol/L, pH 4.0, centrifugal treating, takes supernatant to add
48h is freezed after 2mol/L tosylate chlorides, takes out and is dissolved in 37 DEG C, 10000r/min centrifugation 25min, is taken on supernatant
Sephadex G-100 posts, are eluted with sodium acetate, and sodium acetate buffer concentration is 0.2mol/L, pH 4.0, collects A280nmThere is suction
The part of receipts, merge, the impurity such as tosylate chloride are removed to cold distilled water dialysis 24h, freeze-drying, Rana nigromaculata activity is obtained and carries
Thing is taken, Rana nigromaculata activity extract has the function that anti-inflammatory, antibacterial, reducing blood lipid and protection cell normal function, can significantly improved
The health-care effect of this compound, body immunity, prevention disease are improved, and active ingredient easily absorbs.
（2）The preparation process of compound is：By weight, 42 parts of tealeaves, 11 parts of Radix Codonopsis, 28 parts of the Radix Astragali, jujube 110 are taken
It is part, 18 parts of pomelo peel, 42 parts of pot marigold, 18 parts of ginkgo leaf, 85 parts of Chinese yam, 68 parts of sea-buckthorn, 12 parts of red Grape Skin, 3 parts of pilose antler, big
After 34 parts of 16 parts of malt, 60 parts of matrimony vine, orange endo-endothelial layer white endothelium mixing plus water Ultrasonic Wave-Assisted Extraction, ultrasonic assistant soak
Temperature raising degree is 36 DEG C, power 250w, time 20min, is cooked by slow fire 50min, is filtered, centrifugation, takes supernatant to add after sterilizing
Enter Rana nigromaculata activity extract and active peptides, stir, obtain compound, preparing compound by above-mentioned steps has well
Nourishes taste, adjust the function of blood in human body in gas, and mentioned component is made it have by reasonably combining and weight proportion
The very mouthfeel of fragrant alcohol, has a light shaddock taste, and unique flavor is suitable for people of all ages.Compound the active peptides ammonia in composition formula
Base acid sequence is:MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYAEVGHGCRRYRCCAIR A, the activity
Polypeptide can stimulate thyroid hormone secretion to increase, and promote the bile acidification of cholesterol, make the increase of excrement excretion of cholesterol, have bright
The effect of aobvious reduction cholesterol, and people only high to cholesterol value plays the role of to reduce cholesterol, in composition formula is compounded
Addition active peptides can make compound have the effect of reducing blood lipid, improve the economic value of compound, also help drinking person
Health.
（3）Compound is fitted into aseptic bottle, cleans body, checks for the anomalies such as rupture, it is labelled after 2
DEG C Cord blood.
Embodiment 3：
The subjective appreciation of compound based on Rana nigromaculata activity extract：
Please all certain sensory's experiences of 10 product quality inspections lab technician to embodiment 1, embodiment 2 and commercially available health care
Drink control group carries out subjective appreciation, and standards of grading are shown in Table 1, and each index uses ten point system, and full marks are 50 points, calculate each finger
After marking score, it is added after being multiplied by weighted value, produces subjective appreciation score value.Results of sensory evaluation is：It is 48.5, embodiment 2 to implement 1
For 47.0, control group 40.1, it follows that the compound based on Rana nigromaculata activity extract of embodiment 1 and embodiment 2
Subjective appreciation score is higher than control group, it is easier to is esthetically acceptable to the consumers.
Table 1：The sensory evaluation scores standard of compound based on Rana nigromaculata activity extract
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Pujiang County Ou Li Bioisystech Co., Ltd
<120>A kind of compound based on Rana nigromaculata activity extract
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 57
<212> PRT
<213>It is artificial synthesized
<400> 1
Met Lys Gly Leu Ser Phe Val Leu Leu Val Leu Leu Leu Met Met Pro
1 5 10 15
Asp Gly Glu Gly Thr Asp Pro Glu Met Gln Tyr Trp Thr Cys Gly Tyr
20 25 30
Arg Gly Leu Cys Arg Arg Phe Tyr Ala Glu Val Gly His Gly Cys Arg
35 40 45
Arg Tyr Arg Cys Cys Ala Ile Arg Ala
50 55
Claims (7)
1. a kind of compound based on Rana nigromaculata activity extract, including the extraction of Rana nigromaculata active material, the preparation of compound are cold
But and examine, it is characterised in that：Formula is in the preparation process of the compound：Rana nigromaculata activity extract 60-110 parts, tea
Leaf 30-48 parts, Radix Codonopsis 10-25 parts, Radix Astragali 15-30 parts, jujube 80-120 parts, pomelo peel 10-20 parts, pot marigold 15-45 parts, silver
Apricot leaf 10-20 parts, Chinese yam 60-95 parts, sea-buckthorn 60-82 parts, red Grape Skin 8-20 parts, pilose antler 1-3 parts, fructus hordei germinatus 8-20 parts, Chinese holly
Qi 41-68 parts, active peptides 0.4-0.8 parts, orange endo-endothelial layer white endothelium 15-35 parts.
A kind of 2. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The compounding
Active peptides amino acid sequence in composition formula is: MKGLSFVLLVLLLMMPDGEGTDPEMQYWTCGYRGLCRRFYAEVGH
GCRRYRCCAIRA。
A kind of 3. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The blackspot
Frog active material extraction step is：Rana nigromaculata is slaughtered, takes its thoracic cavity, the skin freezing in abdominal cavity to leg in sodium acetate buffer
Middle homogenate, centrifugal treating, take supernatant to freeze 46 ~ 49h after adding 2mol/L tosylate chlorides, take out and dissolved in 37 DEG C, centrifuge, take
Sephadex G-100 posts, are eluted with sodium acetate on supernatant, collect A280nmThere is the part of absorption, merge, removal of impurities, freezing is done
It is dry, obtain Rana nigromaculata activity extract.
A kind of 4. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The blackspot
Sodium acetate buffer concentration in frog active material extraction step is 0.2mol/L, pH 4.0.
A kind of 5. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The compounding
The preparation process of thing is：By weight, tealeaves, Radix Codonopsis, the Radix Astragali, jujube, pomelo peel, pot marigold, ginkgo leaf, Chinese yam, sand are taken
Add water Ultrasonic Wave-Assisted Extraction, slow fire after spine, red Grape Skin, pilose antler, fructus hordei germinatus, matrimony vine, the mixing of orange endo-endothelial layer white endothelium
50-75min is decocted, is filtered, centrifugation, takes supernatant to add Rana nigromaculata activity extract and active peptides after sterilizing, stirs,
Obtain compound.
A kind of 6. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The compounding
Ultrasonic Wave-Assisted Extraction temperature is 30-50 DEG C, power 250w-450w, time 15-25min in thing preparation process.
A kind of 7. compound based on Rana nigromaculata activity extract according to claim 1, it is characterised in that：The compounding
The cooling preservation temperature of thing is -3 ~ 4 DEG C.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710544876.6A CN107372913A (en) | 2017-07-06 | 2017-07-06 | A kind of compound based on Rana nigromaculata activity extract |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710544876.6A CN107372913A (en) | 2017-07-06 | 2017-07-06 | A kind of compound based on Rana nigromaculata activity extract |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107372913A true CN107372913A (en) | 2017-11-24 |
Family
ID=60335551
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710544876.6A Pending CN107372913A (en) | 2017-07-06 | 2017-07-06 | A kind of compound based on Rana nigromaculata activity extract |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107372913A (en) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1461604A (en) * | 2002-05-27 | 2003-12-17 | 刘莉 | Health-care food with functions of anti-senility, beautifying face and moistening skin and prepn. method therefor |
| CN102715300A (en) * | 2012-05-11 | 2012-10-10 | 邵悌金 | Spleen-strengthening blood-nourishing health drink |
| CN104738638A (en) * | 2015-01-09 | 2015-07-01 | 李晨悦 | Composition with anti-fatigue effect and application thereof |
-
2017
- 2017-07-06 CN CN201710544876.6A patent/CN107372913A/en active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1461604A (en) * | 2002-05-27 | 2003-12-17 | 刘莉 | Health-care food with functions of anti-senility, beautifying face and moistening skin and prepn. method therefor |
| CN102715300A (en) * | 2012-05-11 | 2012-10-10 | 邵悌金 | Spleen-strengthening blood-nourishing health drink |
| CN104738638A (en) * | 2015-01-09 | 2015-07-01 | 李晨悦 | Composition with anti-fatigue effect and application thereof |
Non-Patent Citations (2)
| Title |
|---|
| 中国科协青少年科技中心: "《第二十九届全国青少年科技创新大赛获奖作品集》", 31 December 2014, 科学普及出版社 * |
| 姚文兵等: "蛙皮活性提取物的抗炎作用和体外抗菌活性研究", 《中国药科大学学报》 * |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN104432385A (en) | Dendrobium officinale health beverage and preparation method thereof | |
| CN104705738B (en) | A kind of chrysanthemum beverage and preparation method thereof | |
| CN106072223A (en) | Beche-de-mer in East China Sea nourishing healthy fruit jelly and preparation method thereof | |
| CN103520083A (en) | Preparation method of active edible fungus skincare material | |
| CN105331476A (en) | Low-alcohol grape wine and preparation method thereof | |
| CN103976205B (en) | Endocrine fruit jelly of a kind of improvement and preparation method thereof | |
| CN103642626B (en) | Compound Chinese herbal medicine fermentation health-care wine capable of promoting body building of old people | |
| CN103356856A (en) | Health care blood pressure reducing tea | |
| CN106520493A (en) | Loquat fruit wine and preparation method thereof | |
| CN105331477A (en) | White grape wine and preparation method thereof | |
| CN102165978A (en) | Cordyceps health-preserving tea and making method thereof | |
| CN105362127A (en) | Anti-inflammation and haemostatic medicinal toothpaste | |
| CN101991110A (en) | Wild ganoderma lucidum food | |
| CN107372913A (en) | A kind of compound based on Rana nigromaculata activity extract | |
| CN104587425A (en) | Cold-dispelling paste traditional Chinese medicine composition and preparation method thereof | |
| CN106666309A (en) | Sandworm protein fermented beverage and preparation method thereof | |
| CN106261281A (en) | A kind of Herba Dendrobii hippophae rhamnoides beverage and preparation method thereof | |
| CN102160666A (en) | Natural organic beverage for moisturizing intestines, beautifying skin and prolonging life | |
| CN106118940A (en) | A kind of anti-senescence wine | |
| CN104673577A (en) | SOD wine and preparation method thereof | |
| CN110367539A (en) | A kind of preparation method of rose cereal nourish and beautify skin drink | |
| CN111296599A (en) | Traditional Chinese medicine health tea with auxiliary blood sugar reducing effect and preparation method thereof | |
| CN1586316A (en) | Tortoise-snake nutritive health soup | |
| CN108949483A (en) | Paste flavor vinegar and its preparation process | |
| CN105994724A (en) | Fermentation preparation technology of cordyceps militaris black tea |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| RJ01 | Rejection of invention patent application after publication | ||
| RJ01 | Rejection of invention patent application after publication |
Application publication date: 20171124 |