CN107226855A - A kind of peptone of the molten slurry production of utilization fish - Google Patents
A kind of peptone of the molten slurry production of utilization fish Download PDFInfo
- Publication number
- CN107226855A CN107226855A CN201710562866.5A CN201710562866A CN107226855A CN 107226855 A CN107226855 A CN 107226855A CN 201710562866 A CN201710562866 A CN 201710562866A CN 107226855 A CN107226855 A CN 107226855A
- Authority
- CN
- China
- Prior art keywords
- peptone
- molten slurry
- fish
- slurry production
- utilization
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/461—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from fish
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/06—Preparation of peptides or proteins produced by the hydrolysis of a peptide bond, e.g. hydrolysate products
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Molecular Biology (AREA)
- Wood Science & Technology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Toxicology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Fodder In General (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Abstract
The present invention discloses a kind of peptone of the molten slurry production of utilization fish, and 0.05~0.2wt% sodium Diacetates are added in protein concentrate hydrolyzate and 0.5~1.2 wt% immune modulators are dried and are made.Wherein, the amino acid sequence of immune modulator is TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEG ICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAG FYTHCGPNFCCCIS.Have the beneficial effect that：Peptone of the present invention is without fishy smell, and long shelf-life, amino acid classes are complete, and nutritive value is higher, and there is provided the nitrogen source needed for bacterial growth and carbon source；The potential value of the molten slurry of fish is substantially effectively developed, and greatly reduces the cost of material of peptone.
Description
Technical field
The present invention relates to fish products deep process technology field, more particularly, to a kind of albumen of the molten slurry production of utilization fish
Peptone.
Background technology
Peptone（Peptone）It is a kind of pale yellow powder with meat fragrance taste, by meat, casein or gelatin acid or egg
What white enzyme hydrolysis was made after drying.Protein can also form peptone after acid, alkali or proteases for decomposing, and peptone is rich in organic
Nitrogen compound, also containing some vitamins and carbohydrate, molecular weight about 5000 or so.It is the main original of microbiological culture media
Material, and it is also widely used for all conglomeraties such as fermentation, medicine and microbiology.Abroad, peptone inadequate resource, thus
It is expensive.Research of the China to peptone is more early, main to use acid-base material or enzyme as catalyst, by raw material
Protein structure is destroyed, and is broken into some polypeptide chains or amino acid etc..Raw materials for production are mainly fish meal, pork, meat bone etc., cost compared with
It is high.
The molten slurry of fish is the squeezing waste water produced in fish meal production process, the annual production of domestic fish meal more than 300,000 tons,
And 1 ton of fish meal is often produced, 2 ~ 3 tons of molten pulp wastes of fish are just produced, directly can also be caused to the molten slurry of environmental emission fish if not recovered
Environmental pollution.Containing abundant high-quality protein in the molten slurry of fish, containing albumen 6%, Pepsin digestibility is more than 95%, soluble egg
Account for 70% in vain.So far, the recovery method of slurry albumen molten to fish has carried out substantial amounts of research and experiment both at home and abroad, such as：
The molten slurry concentration of fish for paste method, but this paste in feed industry using very inconvenient, and be difficult to be inhaled by animal
Receive and utilize；The molten slurry of fish is added the method dried in fish meal, but the increase of fish meal moisture absorption can be caused, to be difficult storage, free-running property poor
The problems such as.If peptone is made in the molten slurry of fish, it will thoroughly solve the problems, such as the recycling of the molten slurry of fish, not only widen under aquatic products
The scope of heel comprehensive utilization, makes the potential value of fish processing industry flood tide leftover bits and pieces substantially effectively be developed, makes
Resource is made the best use of everything, and greatly reduces the cost of material of biochemical reagents peptone, makes the protein resource enriched in the molten slurry of fish
A kind of high value-added product is effectively developed into, with good exploitation and application prospect.
Prior art such as Authorization Notice No. is the B of CN 102827911 Chinese invention patent, discloses double enzyme enzymolysis and prepares
The method of animal protein peptone, using fresh ox bone, animal tissue and internal organ as raw material, using pancreatin and compound protease in weak base bar
Deep layer hydrolysis is carried out under part, and by technological means such as separating-purifyings, obtains a kind of molecular weight stabilizers and is maintained at 2000 ~ 2500
Between, the peptone of amino acid content perseverance.The peptone meet soda acid do not precipitate, it is haze-free, meet high temperature do not solidify, completely it is clear
Clearly, as the primary raw material of high-grade microbiological culture media, but the crude fat content in the molten slurry of fish, the inventive method is unsuitable for fish
The preparation of molten slurry peptone.
The content of the invention
It is an object of the invention to provide a kind of comprehensive nutrition, performance is stable, and no bad flavor, the low utilization fish of cost is molten
Starch the peptone of production.
The present invention is directed to the problem of being mentioned in above-mentioned technology, and the technical scheme taken is：A kind of molten slurry production of utilization fish
Peptone, adds 0.05~0.2wt% sodium Diacetates in protein concentrate hydrolyzate and 0.5~1.2 wt% immune modulators is done
It is dry to be made.Wherein, the amino acid sequence of immune modulator is
TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLST
ARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS。
A kind of method of the molten slurry production peptone of utilization fish, including deodorant, degreasing, desalination, digest, centrifuge, concentrate, do
Dry, concrete operation step is：
Deodorant：10 ~ 20 parts of titanium dioxide, 30 ~ 40 parts of sepiolite powder, 80 ~ 100 parts of water are taken, drying and crushing after ultrasonic disperse loads
In filter bag, it is put into the molten slurry of fish and stirs deodorant under light illumination 1 ~ 3 hour, fishy-smell removing agent is 1 with the molten slurry mass ratio of fish:10 ~ 20, two
Titanium oxide is in the presence of sunshine particularly sunshine middle-ultraviolet lamp, to produce light induced electron or photohole, light induced electron
Or photohole again with water or water dissolved oxygen react, formed active oxygen radical, active oxygen radical can with the molten slurry of fish
Redox reaction occurs for organic fishy smell material of sulfur-bearing, and fishy smell material can be oxidized to the material of harmless free from extraneous odour, so that
The fishy smell in the molten slurry of fish is removed, not producing has hazardous substance to body, safe and efficient；
Degreasing, desalination：The molten slurry of fish is removed into fat through centrifuge, salt, sterilizing are removed by resin separator；
Enzymolysis：The molten slurry of fish after degreasing, desalination is poured into automatic magnetic stirred fermentor, pH to 8 ~ 9 is adjusted, adds trypsase
And alkali protease, addition is respectively 4000 ~ 4500U/g and 3000 ~ 4000U/g, and 4 ~ 6h is digested under the conditions of 45 ~ 60 DEG C,
Constantly regulate pH is to setting value in course of reaction, and enzymolysis goes out enzyme immediately after terminating, and the enzymolysis makes breaks down proteins into different classes of
Small molecule chain material so that amino acid classes are complete in peptone, and nutritive value is higher, and there is provided the nitrogen source needed for bacterial growth
And carbon source, the need for meeting its growth, the problem of realization makes full use of resource, the protection to environment is also significant；
Centrifugation：15 ~ 20min of centrifugation obtains hydrolyzate in 8000 ~ 10000rpm centrifuge, adjusts pH to 5.5, is cooled down after boiling
15 ~ 20min of centrifugation obtains removing the hydrolyzate after acidic protein in 8000 ~ 10000rpm centrifuge；
Concentration：Hydrolyzate is concentrated into concentration to 40 ~ 50%, 0.05%~0.2wt% sodium Diacetates, 0.5%~1.2 wt% is added and is immunized
Regulatory protein, is well mixed, sodium Diacetate is the inhibitor of efficient mould and bacterium, can be anti-mildew, makes prolonged shelf life, is immunized
The amino acid sequence of regulatory protein is TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCE
GICADATATMDRYSDTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVA GFYTHCGPNFCCCIS, can
Multinuclear lymphocyte is stimulated, promotes lymphocyte differentiation and maturation, immunologic cellular activity is improved, promotes immune factor expression, close
Into or release, participate in body specificity and the condition of non-specific immune function, transfer immunity information, activation and regulation is immune should
The center answered, strengthens human body immune function；
Dry：Spray drying is carried out under the conditions of 170 ~ 190 DEG C of inlet temperature, 60 ~ 80 DEG C of outlet temperature and produces peptone.
Compared with prior art, the advantage of the invention is that：Peptone of the present invention is without fishy smell, long shelf-life, amino acid kind
Class is complete, and nutritive value is higher there is provided the nitrogen source needed for bacterial growth and carbon source, the need for meeting its growth, realizes fully profit
The problem of using resource, the protection to environment is also significant；The recycling of the molten slurry of fish is thoroughly solved the problems, such as, makes the molten slurry of fish
Potential value is substantially effectively developed, and greatly reduces the cost of material of peptone, makes to enrich in the molten slurry of fish
Protein resource be effectively developed into a kind of high value-added product, with good exploitation and application prospect；Production method
Simple possible, can automated production, it is easy to promote.
Embodiment
The present invention program is described further below by embodiment：
Embodiment 1：
A kind of peptone of the molten slurry production of utilization fish, adds 0.1wt% sodium Diacetates in protein concentrate hydrolyzate and 1wt% is immunized
Regulatory protein, which is dried, to be made.Wherein, the amino acid sequence of immune modulator is
TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLST
ARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS。
A kind of method of the molten slurry production peptone of utilization fish, including deodorant, degreasing, desalination, digest, centrifuge, concentrate, do
Dry, concrete operation step is：
1）Deodorant：18 parts of titanium dioxide, 32 parts of sepiolite powder, 95 parts of water are taken, drying and crushing after ultrasonic disperse loads filter bag
In, it is put into the molten slurry of fish and stirs deodorant under light illumination 2 hours, fishy-smell removing agent is 1 with the molten slurry mass ratio of fish:15, titanium dioxide be
In the presence of sunshine particularly sunshine middle-ultraviolet lamp, light induced electron or photohole, light induced electron or photohole are produced
Again with water or water dissolved oxygen react, formed active oxygen radical, active oxygen radical can with the molten slurry of fish sulfur-bearing it is organic
Redox reaction occurs for fishy smell material, fishy smell material can be oxidized to the material of harmless free from extraneous odour, so as to remove the molten slurry of fish
In fishy smell, not producing has hazardous substance to body, safe and efficient；
2）Degreasing, desalination：The molten slurry of fish is removed into fat through centrifuge, salt, sterilizing are removed by resin separator；
3）Enzymolysis：The molten slurry of fish after degreasing, desalination is poured into automatic magnetic stirred fermentor, pH to 8.5 is adjusted, adds tryptose
Enzyme and alkali protease, addition are respectively 4200U/g and 3500U/g, are digested under the conditions of 55 DEG C in 4h, course of reaction constantly
PH is adjusted to setting value, the enzyme that gone out immediately after terminating is digested, the enzymolysis makes breaks down proteins into different classes of small molecule chain material,
So that amino acid classes are complete in peptone, nutritive value is higher there is provided the nitrogen source needed for bacterial growth and carbon source, meets its life
The need for length, the problem of realization makes full use of resource, the protection to environment is also significant；
4）Centrifugation：16min is centrifuged in 9000rpm centrifuge and obtains hydrolyzate, adjusts pH to 5.5, is cooled in after boiling
Centrifugation 18min obtains removing the hydrolyzate after acidic protein in 8500rpm centrifuge；
5）Concentration：Hydrolyzate is concentrated into concentration to 42%, 0.1wt% sodium Diacetates, 0.8wt% immune modulators is added, mixing is equal
Even, sodium Diacetate is the inhibitor of efficient mould and bacterium, can be anti-mildew, makes prolonged shelf life, the amino of immune modulator
Acid sequence is TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEG ICADATATMDRYS
DTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCI S, can stimulate many karyolymph thin
Born of the same parents, promote lymphocyte differentiation and maturation, improve immunologic cellular activity, promote immune factor expression, synthesis or discharge, participate in machine
The center of the condition of body specificity and non-specific immune function, transfer immunity information, activation and regulation immune response, strengthens machine
Body immunity function；
6）Dry：Spray drying is carried out under the conditions of 175 DEG C of inlet temperature, 70 DEG C of outlet temperature and produces peptone.
Embodiment 2：
A kind of peptone of the molten slurry production of utilization fish, adds 0.13wt% sodium Diacetates and 0.7wt% in protein concentrate hydrolyzate
Immune modulator, which is dried, to be made.Wherein, the amino acid sequence of immune modulator is
TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLST
ARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS。
A kind of method of the molten slurry production peptone of utilization fish, including deodorant, degreasing, desalination, digest, centrifuge, concentrate, do
Dry, concrete operation step is：
1）Deodorant：18 parts of titanium dioxide, 35 parts of sepiolite powder, 100 parts of water are taken, drying and crushing after ultrasonic disperse loads filter bag
In, it is put into the molten slurry of fish and stirs deodorant under light illumination 2.5 hours, fishy-smell removing agent is 1 with the molten slurry mass ratio of fish:10 ~ 20, titanium dioxide
It is in the presence of sunshine particularly sunshine middle-ultraviolet lamp, to produce light induced electron or photohole, light induced electron or photoproduction
Hole is reacted with the dissolved oxygen in water or water again, forms active oxygen radical, active oxygen radical can be with sulfur-bearing in the molten slurry of fish
Redox reaction occurs for organic fishy smell material, fishy smell material can be oxidized to the material of harmless free from extraneous odour, so as to remove fish
Fishy smell in molten slurry, not producing has hazardous substance to body, safe and efficient；
2）Degreasing, desalination：The molten slurry of fish is removed into fat through centrifuge, salt, sterilizing are removed by resin separator；
3）Enzymolysis：The molten slurry of fish after degreasing, desalination is poured into automatic magnetic stirred fermentor, pH to 8 is adjusted, adds trypsase
And alkali protease, addition is respectively 4500U/g and 4000U/g, digests and is constantly adjusted in 5h, course of reaction under the conditions of 45 DEG C
PH is saved to setting value, the enzyme that gone out immediately after terminating is digested, the enzymolysis makes breaks down proteins into different classes of small molecule chain material, made
Amino acid classes are complete in peptone, nutritive value is higher there is provided the nitrogen source needed for bacterial growth and carbon source, meets its growth
The need for, the problem of realization makes full use of resource, the protection to environment is also significant；
4）Centrifugation：15min is centrifuged in 10000rpm centrifuge and obtains hydrolyzate, adjusts pH to 5.5, is cooled in after boiling
15 ~ 20min of centrifugation obtains removing the hydrolyzate after acidic protein in 9000rpm centrifuge；
5）Concentration：Hydrolyzate is concentrated into concentration to 50%, 0.2wt% sodium Diacetates, 1wt% immune modulators is added, mixing is equal
Even, sodium Diacetate is the inhibitor of efficient mould and bacterium, can be anti-mildew, makes prolonged shelf life, the amino of immune modulator
Acid sequence is TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEG ICADATATMDRYS
DTGGPLSTARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCI S, can stimulate many karyolymph thin
Born of the same parents, promote lymphocyte differentiation and maturation, improve immunologic cellular activity, promote immune factor expression, synthesis or discharge, participate in machine
The center of the condition of body specificity and non-specific immune function, transfer immunity information, activation and regulation immune response, strengthens machine
Body immunity function；
6）Dry：Spray drying is carried out under the conditions of 190 DEG C of inlet temperature, 60 DEG C of outlet temperature and produces peptone.
Routine operation in the operating procedure of the present invention is well known to those skilled in the art, herein without repeating.
Technical scheme is described in detail embodiment described above, it should be understood that it is described above only
For the specific embodiment of the present invention, it is not intended to limit the invention, all any modifications made in the spirit of the present invention,
Supplement or similar fashion replacement etc., should be included in the scope of the protection.
SEQUENCE LISTING
<110>Zhejiang Feng Yu marine organisms Products Co., Ltd
<120>A kind of peptone of the molten slurry production of utilization fish
<130> 1
<160> 1
<170> PatentIn version 3.5
<210> 1
<211> 126
<212> PRT
<213>It is artificial synthesized
<400> 1
Thr Asp Cys Val Cys Val Asn Cys Phe Cys Cys Gly Ala Ala Lys Cys
1 5 10 15
Tyr Leu Cys Arg Val Leu His Pro Gly Lys Leu Cys Val Cys Val Asn
20 25 30
Cys Ser Lys Gln Asp Asn Ala Tyr Ala Ser Ala Ile Pro Arg Asp Cys
35 40 45
His Gly Gly Lys Thr Cys Glu Gly Ile Cys Ala Asp Ala Thr Ala Thr
50 55 60
Met Asp Arg Tyr Ser Asp Thr Gly Gly Pro Leu Ser Thr Ala Arg Cys
65 70 75 80
Val Asn Ala Phe His Phe Tyr Lys Gly Cys Ser Leu Tyr Glu Glu Asn
85 90 95
Val Ser Tyr Lys Pro Phe Val Val Ser Trp Lys Tyr Gly Val Ala Gly
100 105 110
Phe Tyr Thr His Cys Gly Pro Asn Phe Cys Cys Cys Ile Ser
115 120 125
Claims (10)
1. a kind of peptone of the molten slurry production of utilization fish, it is characterised in that：Described peptone is including amino acid sequence
TDCVCVNCFCCGAAKCYLCRVLHPGKLCVCVNCSKQDNAYASAIPRDCHGGKTCEGICADATATMDRYSDTGGPLST
ARCVNAFHFYKGCSLYEENVSYKPFVVSWKYGVAGFYTHCGPNFCCCIS immune modulator.
2. a kind of peptone of the molten slurry production of utilization fish according to claim 1, it is characterised in that：Described peptone
0.05~0.2wt% sodium Diacetates are added in protein concentrate hydrolyzate and 0.5~1.2 wt% immune modulators are dried and are made.
3. a kind of peptone of the molten slurry production of utilization fish according to claim 2, it is characterised in that：Described peptone
Preparation method includes deodorant, degreasing, desalination, enzymolysis, centrifugation, concentration, drying.
4. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described deodorant
Step is：Fishy-smell removing agent is fitted into filter bag, is put into the molten slurry of fish and stirs deodorant under light illumination 1 ~ 3 hour；Fishy-smell removing agent is molten with fish
It is 1 to starch mass ratio:10~20.
5. a kind of method of the molten slurry production peptone of utilization fish according to claim 4, it is characterised in that：Described deodorant
The preparation method of fishy-smell removing agent is in step：Take 10 ~ 20 parts of titanium dioxide, 30 ~ 40 parts of sepiolite powder, 80 ~ 100 parts of water, ultrasound point
Drying and crushing after dissipating.
6. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described enzymolysis
Step is：The molten slurry of fish adjusts pH to 8 ~ 9, adds trypsase and alkali protease, addition be respectively 4000 ~ 4500U/g and
3000 ~ 4000U/g, digests 4 ~ 6h, go out enzyme under the conditions of 45 ~ 60 DEG C.
7. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described centrifugation
Step is：Centrifugation obtains hydrolyzate, adjusts pH, and cooling centrifugation obtains removing the hydrolyzate after acidic protein after boiling.
8. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described concentration
Step is that hydrolyzate is concentrated into concentration to 40 ~ 50%, adds sodium Diacetate, immune modulator, is well mixed.
9. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described centrifugation
Centrifuge speed is 8000 ~ 10000rpm in step, and the time is 15 ~ 20min.
10. a kind of method of the molten slurry production peptone of utilization fish according to claim 3, it is characterised in that：Described is dry
Spray drying condition is in dry step：170 ~ 190 DEG C of inlet temperature, 60 ~ 80 DEG C of outlet temperature.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710562866.5A CN107226855A (en) | 2017-07-11 | 2017-07-11 | A kind of peptone of the molten slurry production of utilization fish |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201710562866.5A CN107226855A (en) | 2017-07-11 | 2017-07-11 | A kind of peptone of the molten slurry production of utilization fish |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| CN107226855A true CN107226855A (en) | 2017-10-03 |
Family
ID=59956975
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN201710562866.5A Pending CN107226855A (en) | 2017-07-11 | 2017-07-11 | A kind of peptone of the molten slurry production of utilization fish |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN107226855A (en) |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102827911A (en) * | 2012-09-24 | 2012-12-19 | 平凉市华科生物技术有限公司 | Preparation method of animal peptone by double-enzyme enzymolysis |
| CN104313093A (en) * | 2014-10-17 | 2015-01-28 | 福州大学 | Method for preparing peptone by utilizing fish processing wastes |
| CN105104921A (en) * | 2015-08-07 | 2015-12-02 | 浙江海洋学院 | Fishy smell removing method for hydrolyzed fish protein |
| CN106086128A (en) * | 2015-10-23 | 2016-11-09 | 浙江海洋学院 | A kind of preparation method of tuna peptone |
| CN106834401A (en) * | 2017-01-23 | 2017-06-13 | 舟山福氏食品科技有限公司 | A kind of small band fish peptone production technology |
-
2017
- 2017-07-11 CN CN201710562866.5A patent/CN107226855A/en active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102827911A (en) * | 2012-09-24 | 2012-12-19 | 平凉市华科生物技术有限公司 | Preparation method of animal peptone by double-enzyme enzymolysis |
| CN104313093A (en) * | 2014-10-17 | 2015-01-28 | 福州大学 | Method for preparing peptone by utilizing fish processing wastes |
| CN105104921A (en) * | 2015-08-07 | 2015-12-02 | 浙江海洋学院 | Fishy smell removing method for hydrolyzed fish protein |
| CN106086128A (en) * | 2015-10-23 | 2016-11-09 | 浙江海洋学院 | A kind of preparation method of tuna peptone |
| CN106834401A (en) * | 2017-01-23 | 2017-06-13 | 舟山福氏食品科技有限公司 | A kind of small band fish peptone production technology |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CA1164377A (en) | Process for producing a low-molecular weight peptide composition and nutrient agent containing the same | |
| CN109287865B (en) | Compound fermented protein feed and preparation method thereof | |
| CN104003766A (en) | Method for producing amino acid fertilizer by means of waste water and meat and bone meal generated by livestock harmless treatment | |
| CN103290082A (en) | Method for improving gelatin viscosity by utilizing glutamine transaminase to catalyze gelatin crosslinking | |
| CN101509030A (en) | Hydrolyzation of pig blood with complex enzyme method for producing blood peptide native | |
| CN101904412A (en) | Method for producing food attractant by using fish soluble extract | |
| CN103030645A (en) | Method for preparing high-purity heme on large scale and application of heme | |
| CN101538601A (en) | Method for producing bovine-bone peptone by enzyme technology | |
| CN101081055A (en) | Anaerobic fermentation soya bean watse and method for preparing the same | |
| CN107227332A (en) | A kind of method of the molten slurry production peptone of utilization fish | |
| CN103276038B (en) | Method for producing reagent grade peptone | |
| CN107226855A (en) | A kind of peptone of the molten slurry production of utilization fish | |
| CN107227331A (en) | A kind of method of the molten slurry production protein small peptide of utilization fish | |
| CN107494891A (en) | A kind of method that mycoprotein makes animal food additive | |
| CN101744115B (en) | Feed additive and preparation method thereof | |
| CN110720549A (en) | Preparation method of euphausia superba soluble pulp | |
| CN109880875A (en) | A kind of selenium-rich tuna bone collagen peptide and preparation method thereof | |
| CN105394381A (en) | Calcium supplement type digestion promoting piglet feed and preparation method thereof | |
| CN100465154C (en) | Processing method for producing amino acid by using (supercritical) near-critical hydrolyzed biomass | |
| CN1552892A (en) | Physiological active buck peptide by compound proteinase catalysis and use of products thereby | |
| CN1276721C (en) | Polypeptide health-care nutritive food and its making method | |
| CN1283397A (en) | Process for preparing decoloured protono by pressure hydrolysis of animal blood | |
| CN109645236A (en) | A kind of processing method of sausage wastewater | |
| RU2226841C1 (en) | Protein food additive production method | |
| KR20000058843A (en) | The method for manufacturing of health drink |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| PB01 | Publication | ||
| PB01 | Publication | ||
| SE01 | Entry into force of request for substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| WD01 | Invention patent application deemed withdrawn after publication | ||
| WD01 | Invention patent application deemed withdrawn after publication |
Application publication date: 20171003 |