ZA806639B - Shielded balanced loop antennas for electronic security systems - Google Patents
Shielded balanced loop antennas for electronic security systemsInfo
- Publication number
- ZA806639B ZA806639B ZA00806639A ZA806639A ZA806639B ZA 806639 B ZA806639 B ZA 806639B ZA 00806639 A ZA00806639 A ZA 00806639A ZA 806639 A ZA806639 A ZA 806639A ZA 806639 B ZA806639 B ZA 806639B
- Authority
- ZA
- South Africa
- Prior art keywords
- security systems
- loop antennas
- electronic security
- balanced loop
- shielded balanced
- Prior art date
Links
Classifications
-
- G—PHYSICS
- G08—SIGNALLING
- G08B—SIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
- G08B13/00—Burglar, theft or intruder alarms
- G08B13/22—Electrical actuation
- G08B13/24—Electrical actuation by interference with electromagnetic field distribution
- G08B13/2402—Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
- G08B13/2465—Aspects related to the EAS system, e.g. system components other than tags
- G08B13/2468—Antenna in system and the related signal processing
- G08B13/2471—Antenna signal processing by receiver or emitter
-
- G—PHYSICS
- G08—SIGNALLING
- G08B—SIGNALLING OR CALLING SYSTEMS; ORDER TELEGRAPHS; ALARM SYSTEMS
- G08B13/00—Burglar, theft or intruder alarms
- G08B13/22—Electrical actuation
- G08B13/24—Electrical actuation by interference with electromagnetic field distribution
- G08B13/2402—Electronic Article Surveillance [EAS], i.e. systems using tags for detecting removal of a tagged item from a secure area, e.g. tags for detecting shoplifting
- G08B13/2465—Aspects related to the EAS system, e.g. system components other than tags
- G08B13/2468—Antenna in system and the related signal processing
- G08B13/2474—Antenna or antenna activator geometry, arrangement or layout
-
- H—ELECTRICITY
- H01—ELECTRIC ELEMENTS
- H01Q—ANTENNAS, i.e. RADIO AERIALS
- H01Q7/00—Loop antennas with a substantially uniform current distribution around the loop and having a directional radiation pattern in a plane perpendicular to the plane of the loop
- H01Q7/04—Screened antennas
Landscapes
- Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Signal Processing (AREA)
- Automation & Control Theory (AREA)
- Computer Security & Cryptography (AREA)
- Electromagnetism (AREA)
- General Physics & Mathematics (AREA)
- Burglar Alarm Systems (AREA)
- Variable-Direction Aerials And Aerial Arrays (AREA)
- Details Of Aerials (AREA)
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US06/094,429 US4251808A (en) | 1979-11-15 | 1979-11-15 | Shielded balanced loop antennas for electronic security systems |
Publications (1)
Publication Number | Publication Date |
---|---|
ZA806639B true ZA806639B (en) | 1981-11-25 |
Family
ID=22245143
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ZA00806639A ZA806639B (en) | 1979-11-15 | 1980-10-29 | Shielded balanced loop antennas for electronic security systems |
Country Status (13)
Country | Link |
---|---|
US (1) | US4251808A (de) |
JP (1) | JPS5683000A (de) |
AU (1) | AU530083B2 (de) |
CA (1) | CA1148630A (de) |
DE (1) | DE3043026A1 (de) |
DK (1) | DK158686C (de) |
ES (2) | ES496218A0 (de) |
FR (1) | FR2470976A1 (de) |
GB (1) | GB2063569B (de) |
IT (1) | IT1129351B (de) |
MX (1) | MX148678A (de) |
SE (1) | SE445498B (de) |
ZA (1) | ZA806639B (de) |
Families Citing this family (62)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA1138955A (en) * | 1979-09-14 | 1983-01-04 | Edward R. Fearon | Anti-shoplifting system |
US4373163A (en) * | 1980-07-14 | 1983-02-08 | I.D. Engineering, Inc. | Loop antenna for security systems |
US4384281A (en) * | 1980-10-31 | 1983-05-17 | Knogo Corporation | Theft detection apparatus using saturable magnetic targets |
US4342999A (en) * | 1980-11-25 | 1982-08-03 | Rca Corporation | Loop antenna arrangements for inclusion in a television receiver |
USRE32627E (en) * | 1981-09-10 | 1988-03-22 | Sensormatic Electronics Corporation | Electrical surveillance apparatus with moveable antenna elements |
US4394645A (en) * | 1981-09-10 | 1983-07-19 | Sensormatic Electronics Corporation | Electrical surveillance apparatus with moveable antenna elements |
EP0130973A1 (de) * | 1983-01-03 | 1985-01-16 | SHIN, Myong | Anti-ladendiebstahlsystem |
US4531117A (en) * | 1983-07-05 | 1985-07-23 | Minnesota Mining And Manufacturing Company | Variable frequency RF electronic surveillance system |
US4509039A (en) * | 1983-07-05 | 1985-04-02 | Minnesota Mining And Manufacturing Company | Shielded, closely spaced transmit-receiver antennas for electronic article surveillance system |
US4609911A (en) * | 1983-07-05 | 1986-09-02 | Minnesota Mining And Manufacturing Company | Variable frequency RF electronic surveillance system |
US4642613A (en) * | 1984-03-16 | 1987-02-10 | Knogo Corporation | Electronic theft detection apparatus with responder elements on protected articles |
US4751516A (en) * | 1985-01-10 | 1988-06-14 | Lichtblau G J | Antenna system for magnetic and resonant circuit detection |
AU633247B2 (en) * | 1985-01-10 | 1993-01-28 | Checkpoint Systems, Inc. | Antenna system for magnetic and resonant circuit detection |
US4647910A (en) * | 1985-09-17 | 1987-03-03 | Allied Corporation | Selector for AC magnetic inductive field receiver coils |
US4728938A (en) * | 1986-01-10 | 1988-03-01 | Checkpoint Systems, Inc. | Security tag deactivation system |
US4769631A (en) * | 1986-06-30 | 1988-09-06 | Sensormatic Electronics Corporation | Method, system and apparatus for magnetic surveillance of articles |
JPS63236401A (ja) * | 1987-03-25 | 1988-10-03 | Kokusai Electric Co Ltd | 誘導無線装置用ループアンテナ |
US4779077A (en) * | 1987-04-13 | 1988-10-18 | Lichtblau G J | Continuously armed high reliability pulse train processor |
US4872018A (en) * | 1987-08-31 | 1989-10-03 | Monarch Marking Systems, Inc. | Multiple loop antenna |
US4972198A (en) * | 1987-08-31 | 1990-11-20 | Monarch Marking Systems, Inc. | Multiple loop antenna |
US5121103A (en) * | 1988-07-29 | 1992-06-09 | Knogo Corporation | Load isolated article surveillance system and antenna assembly |
US5103235A (en) * | 1988-12-30 | 1992-04-07 | Checkpoint Systems, Inc. | Antenna structure for an electronic article surveillance system |
US4999641A (en) * | 1989-09-01 | 1991-03-12 | Monarch Marking Systems, Inc. | Magnetic antenna system having independently controllable electrical field shielding and magnetic field balance |
GB9004431D0 (en) * | 1990-02-28 | 1990-04-25 | Scient Generics Ltd | Detection system for security systems |
US5051726A (en) * | 1990-08-14 | 1991-09-24 | Sensormatic Electronics Corporation | Electronic article surveillance system with antenna array for enhanced field falloff |
NL9100397A (nl) * | 1991-03-06 | 1992-10-01 | Nedap Nv | Asymmetrische antenne voor winkeldiefstaldetectiesystemen. |
US5142292A (en) * | 1991-08-05 | 1992-08-25 | Checkpoint Systems, Inc. | Coplanar multiple loop antenna for electronic article surveillance systems |
US5442334A (en) * | 1992-07-20 | 1995-08-15 | Stoplift Corporation | Security system having deactivatable security tag |
US5404147A (en) * | 1992-10-28 | 1995-04-04 | Sensormatic Electronics Corporation | EAS system loop antenna having three loops of different area |
US5373301A (en) * | 1993-01-04 | 1994-12-13 | Checkpoint Systems, Inc. | Transmit and receive antenna having angled crossover elements |
ES2122209T3 (es) * | 1993-07-13 | 1998-12-16 | Actron Entwicklungs Ag | Dispositivo de antena. |
US5694139A (en) * | 1994-06-28 | 1997-12-02 | Sony Corporation | Short-distance communication antenna and methods of manufacturing and using the short-distance communication antenna |
EP0703637A1 (de) | 1994-09-23 | 1996-03-27 | Actron Entwicklungs AG | Antenne für ein elektronisches Sicherungssystem |
BR9609286A (pt) * | 1995-05-30 | 1999-05-11 | Sensormatic Electronics Corp | Configuração de antena de sistema eas para proporcionar melhor distribuição de campo de interrogação |
US5602556A (en) * | 1995-06-07 | 1997-02-11 | Check Point Systems, Inc. | Transmit and receive loop antenna |
US5825335A (en) * | 1995-10-23 | 1998-10-20 | Kubota Corporation | Sheet antenna apparatus |
US5653192A (en) * | 1996-03-06 | 1997-08-05 | Alfa Laval Agri Inc. | Livestock identification apparatus |
AU2546597A (en) * | 1996-04-10 | 1997-10-29 | Sentry Technology Corporation | Electronic article surveillance system |
US5914692A (en) * | 1997-01-14 | 1999-06-22 | Checkpoint Systems, Inc. | Multiple loop antenna with crossover element having a pair of spaced, parallel conductors for electrically connecting the multiple loops |
DE19732254A1 (de) * | 1997-07-26 | 1999-02-11 | Kaba Benzing Gmbh | Vorrichtung zur Übermittlung magnetischer Signale mittels einer Leiterplatte |
US6611783B2 (en) | 2000-01-07 | 2003-08-26 | Nocwatch, Inc. | Attitude indicator and activity monitoring device |
EP1158601A1 (de) * | 2000-05-15 | 2001-11-28 | Häni Prolectron Ag | Trägerelement für eine Antenne mit geringer Handempfindlichkeit |
US6900727B2 (en) | 2002-07-16 | 2005-05-31 | Bert Taeho Lee | Weapon detector system |
US7030750B2 (en) | 2002-07-16 | 2006-04-18 | Bert Taeho Lee | Detachable entrance and exit gate with a combined commodity burglarproofing and small arms detecting system |
KR200298223Y1 (ko) * | 2002-09-11 | 2002-12-16 | 태호 리 버트 | 총기류 탐지 겸용 상품도난 방지장치의 출입게이트 구조 |
US20040102870A1 (en) * | 2002-11-26 | 2004-05-27 | Andersen Scott Paul | RFID enabled paper rolls and system and method for tracking inventory |
EP1719087B1 (de) * | 2004-02-19 | 2008-05-07 | Koninklijke Philips Electronics N.V. | Verfahren und vorrichtung zum übermitteln des vorliegens einer notsituation, ohne die quelle der übermittlung eindeutig zu identifizieren |
US7591415B2 (en) * | 2004-09-28 | 2009-09-22 | 3M Innovative Properties Company | Passport reader for processing a passport having an RFID element |
US20070252001A1 (en) * | 2006-04-25 | 2007-11-01 | Kail Kevin J | Access control system with RFID and biometric facial recognition |
EP2327230B1 (de) | 2008-09-04 | 2013-03-27 | Allflex Usa, Inc. | Kombiniertes elektronisches vollduplex- und halbduplex-identifikationsetikett |
NO2486552T3 (de) * | 2009-10-09 | 2018-01-27 | ||
US8811542B2 (en) * | 2009-10-09 | 2014-08-19 | Aleis Pty Ltd. | HDX demodulator |
CA2783571C (en) * | 2009-11-04 | 2018-01-09 | Allflex Usa, Inc. | Signal cancelling transmit/receive multi-loop antenna for a radio frequency identification reader |
US20120139730A1 (en) * | 2010-12-03 | 2012-06-07 | Metrologic Instruments, Inc. | Electronic article surveillance system |
WO2012149025A1 (en) * | 2011-04-25 | 2012-11-01 | Conocophillips Company | In situ radio frequency catalytic upgrading |
US9671478B2 (en) * | 2011-07-22 | 2017-06-06 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Antenna and antenna arrangement for magnetic resonance applications |
MX346099B (es) | 2011-10-11 | 2017-03-07 | Senseonics Inc | Sistema para activar la fuerza de un campo electrodinámico. |
US9577349B2 (en) | 2015-06-29 | 2017-02-21 | Near Field Magnetics, Inc. | Near-field magnetic communication antenna |
DE102017105649A1 (de) * | 2017-03-16 | 2018-09-20 | Bundesdruckerei Gmbh | RFID-Lesegerät und Verfahren zu seiner Herstellung |
US11283296B2 (en) | 2017-05-26 | 2022-03-22 | Nucurrent, Inc. | Crossover inductor coil and assembly for wireless transmission |
US11283303B2 (en) | 2020-07-24 | 2022-03-22 | Nucurrent, Inc. | Area-apportioned wireless power antenna for maximized charging volume |
US11695302B2 (en) | 2021-02-01 | 2023-07-04 | Nucurrent, Inc. | Segmented shielding for wide area wireless power transmitter |
Family Cites Families (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB419783A (en) * | 1933-02-02 | 1934-11-19 | Marconi Wireless Telegraph Co | Improvements in and relating to wireless receiving apparatus |
US2391026A (en) * | 1943-11-15 | 1945-12-18 | Standard Telephones Cables Ltd | Shielded loop antenna |
JPS4327094Y1 (de) * | 1964-02-25 | 1968-11-09 | ||
US3863244A (en) * | 1972-06-14 | 1975-01-28 | Lichtblau G J | Electronic security system having improved noise discrimination |
US3810147A (en) * | 1971-12-30 | 1974-05-07 | G Lichtblau | Electronic security system |
US3967161A (en) * | 1972-06-14 | 1976-06-29 | Lichtblau G J | A multi-frequency resonant tag circuit for use with an electronic security system having improved noise discrimination |
US3973263A (en) * | 1973-04-20 | 1976-08-03 | The United States Of America As Represented By The Secretary Of The Navy | Sensitivity improvement of spaced-loop antenna by capacitive gap loading |
JPS5046062A (de) * | 1973-08-28 | 1975-04-24 | ||
JPS5226879A (en) * | 1975-08-26 | 1977-02-28 | Nippon Telegr & Teleph Corp <Ntt> | Method of measuring phase constants in waveguides |
US4243980A (en) * | 1978-02-17 | 1981-01-06 | Lichtblau G J | Antenna system for electronic security installations |
US4260990A (en) * | 1979-11-08 | 1981-04-07 | Lichtblau G J | Asymmetrical antennas for use in electronic security systems |
-
1979
- 1979-11-15 US US06/094,429 patent/US4251808A/en not_active Expired - Lifetime
-
1980
- 1980-10-06 AU AU62989/80A patent/AU530083B2/en not_active Ceased
- 1980-10-10 CA CA000362129A patent/CA1148630A/en not_active Expired
- 1980-10-23 ES ES496218A patent/ES496218A0/es active Granted
- 1980-10-29 ZA ZA00806639A patent/ZA806639B/xx unknown
- 1980-10-30 IT IT68658/80A patent/IT1129351B/it active
- 1980-11-11 MX MX184713A patent/MX148678A/es unknown
- 1980-11-12 JP JP15834080A patent/JPS5683000A/ja active Granted
- 1980-11-14 GB GB8036676A patent/GB2063569B/en not_active Expired
- 1980-11-14 SE SE8007986A patent/SE445498B/sv not_active IP Right Cessation
- 1980-11-14 FR FR8024264A patent/FR2470976A1/fr active Granted
- 1980-11-14 DK DK489380A patent/DK158686C/da active
- 1980-11-14 DE DE19803043026 patent/DE3043026A1/de active Granted
-
1981
- 1981-11-16 ES ES507188A patent/ES8302369A1/es not_active Expired
Also Published As
Publication number | Publication date |
---|---|
JPS5683000A (en) | 1981-07-07 |
DK158686B (da) | 1990-07-02 |
IT1129351B (it) | 1986-06-04 |
DE3043026A1 (de) | 1981-05-21 |
ES8202958A1 (es) | 1982-02-16 |
US4251808A (en) | 1981-02-17 |
AU530083B2 (en) | 1983-06-30 |
ES507188A0 (es) | 1982-12-16 |
DK158686C (da) | 1991-02-25 |
ES8302369A1 (es) | 1982-12-16 |
FR2470976B1 (de) | 1984-11-23 |
DK489380A (da) | 1981-05-16 |
GB2063569A (en) | 1981-06-03 |
AU6298980A (en) | 1981-06-04 |
DE3043026C2 (de) | 1990-02-22 |
CA1148630A (en) | 1983-06-21 |
IT8068658A0 (it) | 1980-10-30 |
SE445498B (sv) | 1986-06-23 |
GB2063569B (en) | 1983-06-22 |
SE8007986L (sv) | 1981-05-16 |
ES496218A0 (es) | 1982-02-16 |
MX148678A (es) | 1983-05-27 |
JPH0230553B2 (de) | 1990-07-06 |
FR2470976A1 (fr) | 1981-06-12 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ZA806639B (en) | Shielded balanced loop antennas for electronic security systems | |
GB2062969B (en) | Antenna systems for electronic security systems | |
JPS54115099A (en) | Antenna system for electronic security system | |
DE3066820D1 (en) | Electronic tuning antenna system | |
GB2061624B (en) | Electromagnetic interference shielding device | |
AU561298B2 (en) | Shielded loop for electronic surveillance system | |
GB2010375B (en) | Electronic lock systems | |
GB2051208B (en) | Electronic lock | |
GB2133865B (en) | Locking device for air-to-air guided missiles | |
JPS55138569A (en) | Electronic lock | |
JPS5628977A (en) | Electronic locking device | |
JPS5653534A (en) | Electromagnetic coil malfunction detector | |
IL57521A0 (en) | An electronic security system | |
JPS55138570A (en) | Electronic lock | |
JPS55126675A (en) | Electronic lock | |
JPS5628978A (en) | Electronic lock | |
JPS55165380A (en) | Electronic lock | |
JPS5356597A (en) | Electromagnetic locking device | |
GB2063983B (en) | Security mounting | |
JPS55116974A (en) | Electronic lock | |
JPS55145284A (en) | Electronic lock | |
YU124679A (en) | Electronic lock | |
JPS55138574A (en) | Electronic lock | |
JPS55138573A (en) | Electronic lock | |
JPS55138572A (en) | Electronic lock |