WO2024148263A1 - Méthodes et compositions pour le traitement par anticorps d'une infection d'hépatite b - Google Patents
Méthodes et compositions pour le traitement par anticorps d'une infection d'hépatite b Download PDFInfo
- Publication number
- WO2024148263A1 WO2024148263A1 PCT/US2024/010478 US2024010478W WO2024148263A1 WO 2024148263 A1 WO2024148263 A1 WO 2024148263A1 US 2024010478 W US2024010478 W US 2024010478W WO 2024148263 A1 WO2024148263 A1 WO 2024148263A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antigen binding
- binding fragment
- group
- antibody
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 110
- 238000011282 treatment Methods 0.000 title claims abstract description 65
- 239000000203 mixture Substances 0.000 title claims abstract description 55
- 208000002672 hepatitis B Diseases 0.000 title abstract description 93
- 239000000427 antigen Substances 0.000 claims description 313
- 102000036639 antigens Human genes 0.000 claims description 313
- 108091007433 antigens Proteins 0.000 claims description 313
- 239000012634 fragment Substances 0.000 claims description 235
- 241000700721 Hepatitis B virus Species 0.000 claims description 156
- 230000003247 decreasing effect Effects 0.000 claims description 75
- 239000000523 sample Substances 0.000 claims description 57
- 230000004071 biological effect Effects 0.000 claims description 51
- 108020004459 Small interfering RNA Proteins 0.000 claims description 49
- 208000015181 infectious disease Diseases 0.000 claims description 42
- 241001529936 Murinae Species 0.000 claims description 38
- 210000002966 serum Anatomy 0.000 claims description 26
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 claims description 26
- 239000008194 pharmaceutical composition Substances 0.000 claims description 23
- 229960005486 vaccine Drugs 0.000 claims description 21
- 230000035772 mutation Effects 0.000 claims description 18
- 108020003175 receptors Proteins 0.000 claims description 18
- 102000005962 receptors Human genes 0.000 claims description 18
- 210000004185 liver Anatomy 0.000 claims description 16
- 238000002965 ELISA Methods 0.000 claims description 15
- 239000002955 immunomodulating agent Substances 0.000 claims description 15
- 229940121354 immunomodulator Drugs 0.000 claims description 15
- 101710132601 Capsid protein Proteins 0.000 claims description 11
- 230000000840 anti-viral effect Effects 0.000 claims description 11
- 239000003443 antiviral agent Substances 0.000 claims description 11
- 229940121357 antivirals Drugs 0.000 claims description 11
- 238000003556 assay Methods 0.000 claims description 11
- 239000012472 biological sample Substances 0.000 claims description 10
- 239000003755 preservative agent Substances 0.000 claims description 10
- 150000007523 nucleic acids Chemical class 0.000 claims description 9
- 230000002335 preservative effect Effects 0.000 claims description 9
- 239000003937 drug carrier Substances 0.000 claims description 8
- 238000004458 analytical method Methods 0.000 claims description 6
- 238000001574 biopsy Methods 0.000 claims description 5
- 210000004369 blood Anatomy 0.000 claims description 5
- 239000008280 blood Substances 0.000 claims description 5
- 230000003442 weekly effect Effects 0.000 claims description 5
- 230000002584 immunomodulator Effects 0.000 claims description 4
- 230000008014 freezing Effects 0.000 claims description 2
- 238000007710 freezing Methods 0.000 claims description 2
- 108020004707 nucleic acids Proteins 0.000 claims description 2
- 102000039446 nucleic acids Human genes 0.000 claims description 2
- 208000000419 Chronic Hepatitis B Diseases 0.000 abstract description 61
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 124
- 238000005516 engineering process Methods 0.000 description 77
- 108020004414 DNA Proteins 0.000 description 34
- 241000699670 Mus sp. Species 0.000 description 34
- 230000002085 persistent effect Effects 0.000 description 32
- 238000010172 mouse model Methods 0.000 description 29
- 125000003275 alpha amino acid group Chemical group 0.000 description 27
- 230000001225 therapeutic effect Effects 0.000 description 23
- 239000000902 placebo Substances 0.000 description 21
- 229940068196 placebo Drugs 0.000 description 21
- AZJGRTCDZBQXFC-UHFFFAOYSA-N 2-(3-chlorophenyl)-5-methyl-1h-imidazole-4-carboxylic acid Chemical compound OC(=O)C1=C(C)NC(C=2C=C(Cl)C=CC=2)=N1 AZJGRTCDZBQXFC-UHFFFAOYSA-N 0.000 description 20
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 18
- 238000002347 injection Methods 0.000 description 18
- 239000007924 injection Substances 0.000 description 18
- 230000004044 response Effects 0.000 description 18
- 239000003814 drug Substances 0.000 description 17
- 230000010076 replication Effects 0.000 description 17
- 241000699666 Mus <mouse, genus> Species 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 201000010099 disease Diseases 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 12
- 108090000623 proteins and genes Proteins 0.000 description 12
- 230000002163 immunogen Effects 0.000 description 11
- 230000007423 decrease Effects 0.000 description 10
- 230000009467 reduction Effects 0.000 description 10
- 230000000890 antigenic effect Effects 0.000 description 9
- 239000002299 complementary DNA Substances 0.000 description 9
- 208000006454 hepatitis Diseases 0.000 description 9
- 231100000283 hepatitis Toxicity 0.000 description 9
- 239000013612 plasmid Substances 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 208000019423 liver disease Diseases 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- 230000000405 serological effect Effects 0.000 description 8
- 210000003462 vein Anatomy 0.000 description 8
- 208000037581 Persistent Infection Diseases 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 230000001684 chronic effect Effects 0.000 description 7
- 238000010494 dissociation reaction Methods 0.000 description 7
- 230000005593 dissociations Effects 0.000 description 7
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 7
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 7
- 238000001727 in vivo Methods 0.000 description 7
- 235000018102 proteins Nutrition 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 102100031673 Corneodesmosin Human genes 0.000 description 6
- 101710139375 Corneodesmosin Proteins 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 235000001014 amino acid Nutrition 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 210000003494 hepatocyte Anatomy 0.000 description 6
- 230000028993 immune response Effects 0.000 description 6
- 238000001990 intravenous administration Methods 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 208000019425 cirrhosis of liver Diseases 0.000 description 5
- 238000011284 combination treatment Methods 0.000 description 5
- 230000000694 effects Effects 0.000 description 5
- 238000003364 immunohistochemistry Methods 0.000 description 5
- 230000002195 synergetic effect Effects 0.000 description 5
- 108020004705 Codon Proteins 0.000 description 4
- 206010016654 Fibrosis Diseases 0.000 description 4
- 102000006992 Interferon-alpha Human genes 0.000 description 4
- 108010047761 Interferon-alpha Proteins 0.000 description 4
- 210000003719 b-lymphocyte Anatomy 0.000 description 4
- 229940124765 capsid inhibitor Drugs 0.000 description 4
- 230000007882 cirrhosis Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 230000036961 partial effect Effects 0.000 description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- 101710142246 External core antigen Proteins 0.000 description 3
- 241000285408 HBV genotype A2 Species 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 239000002671 adjuvant Substances 0.000 description 3
- 150000001413 amino acids Chemical class 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000016784 immunoglobulin production Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 244000052769 pathogen Species 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 230000002269 spontaneous effect Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 2
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- 239000007995 HEPES buffer Substances 0.000 description 2
- 206010019663 Hepatic failure Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- 229920001213 Polysorbate 20 Polymers 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 101710137302 Surface antigen S Proteins 0.000 description 2
- 108020005202 Viral DNA Proteins 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 239000000370 acceptor Substances 0.000 description 2
- 208000037628 acute hepatitis B virus infection Diseases 0.000 description 2
- 230000033289 adaptive immune response Effects 0.000 description 2
- 239000012491 analyte Substances 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 230000001010 compromised effect Effects 0.000 description 2
- 231100000517 death Toxicity 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000013401 experimental design Methods 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- SPSXSWRZQFPVTJ-ZQQKUFEYSA-N hepatitis b vaccine Chemical compound C([C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC1N=CN=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)OC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](N)CCCNC(N)=N)C1=CC=CC=C1 SPSXSWRZQFPVTJ-ZQQKUFEYSA-N 0.000 description 2
- 229940124736 hepatitis-B vaccine Drugs 0.000 description 2
- 210000004408 hybridoma Anatomy 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000015788 innate immune response Effects 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 231100000835 liver failure Toxicity 0.000 description 2
- 208000007903 liver failure Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 2
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 108090000765 processed proteins & peptides Proteins 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000002333 serotherapy Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000012089 stop solution Substances 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 230000029812 viral genome replication Effects 0.000 description 2
- UIFJBEWVRSHKCF-ZOQUXTDFSA-N 1-[(2r,3r,4r,5r)-4-dihydroxyphosphinothioyloxy-5-(hydroxymethyl)-3-methoxyoxolan-2-yl]pyrimidine-2,4-dione Chemical compound CO[C@@H]1[C@H](OP(O)(O)=S)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 UIFJBEWVRSHKCF-ZOQUXTDFSA-N 0.000 description 1
- BVQKNSCKIBSOGA-KQYNXXCUSA-N 2-amino-9-[(2r,3r,4r,5r)-4-dihydroxyphosphinothioyloxy-5-(hydroxymethyl)-3-methoxyoxolan-2-yl]-3h-purin-6-one Chemical compound CO[C@@H]1[C@H](OP(O)(O)=S)[C@@H](CO)O[C@H]1N1C(NC(N)=NC2=O)=C2N=C1 BVQKNSCKIBSOGA-KQYNXXCUSA-N 0.000 description 1
- PLWXKAOZQSMLOO-AEHJODJJSA-N 2-amino-9-[(2r,3s,4r,5r)-4-dihydroxyphosphinothioyloxy-3-fluoro-3-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=S)[C@]1(O)F PLWXKAOZQSMLOO-AEHJODJJSA-N 0.000 description 1
- 206010059193 Acute hepatitis B Diseases 0.000 description 1
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- BQENDLAVTKRQMS-SBBGFIFASA-L Carbenoxolone sodium Chemical compound [Na+].[Na+].C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C([O-])=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](OC(=O)CCC([O-])=O)C1(C)C BQENDLAVTKRQMS-SBBGFIFASA-L 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 108010021468 Fc gamma receptor IIA Proteins 0.000 description 1
- 108010021472 Fc gamma receptor IIB Proteins 0.000 description 1
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 1
- 206010019799 Hepatitis viral Diseases 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 101100370002 Mus musculus Tnfsf14 gene Proteins 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical class CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 208000035999 Recurrence Diseases 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 229920002684 Sepharose Polymers 0.000 description 1
- 102100021696 Syncytin-1 Human genes 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- 101150003160 X gene Proteins 0.000 description 1
- NPRNBAPBGVERRF-ZOQUXTDFSA-N [(2r,3r,4r,5r)-5-(2,4-dioxopyrimidin-1-yl)-2-(hydroxymethyl)-4-methoxyoxolan-3-yl] dihydrogen phosphate Chemical compound CO[C@@H]1[C@H](OP(O)(O)=O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 NPRNBAPBGVERRF-ZOQUXTDFSA-N 0.000 description 1
- QXWJIJPOAPZARX-KQYNXXCUSA-N [(2r,3r,4r,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)-2-(hydroxymethyl)-4-methoxyoxolan-3-yl] dihydrogen phosphate Chemical compound CO[C@@H]1[C@H](OP(O)(O)=O)[C@@H](CO)O[C@H]1N1C(N=C(N)NC2=O)=C2N=C1 QXWJIJPOAPZARX-KQYNXXCUSA-N 0.000 description 1
- IATVSXSQCCSKNS-ZOQUXTDFSA-N [(2r,3r,4r,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-2-(hydroxymethyl)-4-methoxyoxolan-3-yl] dihydrogen phosphate Chemical compound CO[C@@H]1[C@H](OP(O)(O)=O)[C@@H](CO)O[C@H]1N1C(=O)N=C(N)C=C1 IATVSXSQCCSKNS-ZOQUXTDFSA-N 0.000 description 1
- VXTNWQOOBHQEDS-IOSLPCCCSA-N [(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-2-(hydroxymethyl)-4-methoxyoxolan-3-yl] dihydrogen phosphate Chemical compound CO[C@@H]1[C@H](OP(O)(O)=O)[C@@H](CO)O[C@H]1N1C2=NC=NC(N)=C2N=C1 VXTNWQOOBHQEDS-IOSLPCCCSA-N 0.000 description 1
- QGZHQRNBDZDKFW-FJGDRVTGSA-N [(2r,3r,4s,5r)-5-(2,4-dioxopyrimidin-1-yl)-4-fluoro-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] dihydrogen phosphate Chemical compound O[C@]1(F)[C@H](OP(O)(O)=O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 QGZHQRNBDZDKFW-FJGDRVTGSA-N 0.000 description 1
- SQXGRYKQXLPVFG-AEHJODJJSA-N [(2r,3r,4s,5r)-5-(2-amino-6-oxo-3h-purin-9-yl)-4-fluoro-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] dihydrogen phosphate Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=O)[C@]1(O)F SQXGRYKQXLPVFG-AEHJODJJSA-N 0.000 description 1
- PTESHFKYBQMNFR-FJGDRVTGSA-N [(2r,3r,4s,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-4-fluoro-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] dihydrogen phosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@](F)(O)[C@H](OP(O)(O)=O)[C@@H](CO)O1 PTESHFKYBQMNFR-FJGDRVTGSA-N 0.000 description 1
- KLVQSNKMLGBSHV-GIWSHQQXSA-N [(2r,3r,4s,5r)-5-(6-aminopurin-9-yl)-4-fluoro-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] dihydrogen phosphate Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](OP(O)(O)=O)[C@]1(O)F KLVQSNKMLGBSHV-GIWSHQQXSA-N 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 238000011091 antibody purification Methods 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 239000011545 carbonate/bicarbonate buffer Substances 0.000 description 1
- 230000036755 cellular response Effects 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 208000016350 chronic hepatitis B virus infection Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 238000013270 controlled release Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000001186 cumulative effect Effects 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 230000000994 depressogenic effect Effects 0.000 description 1
- 238000011033 desalting Methods 0.000 description 1
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000009266 disease activity Effects 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229960000980 entecavir Drugs 0.000 description 1
- YXPVEXCTPGULBZ-WQYNNSOESA-N entecavir hydrate Chemical compound O.C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)C1=C YXPVEXCTPGULBZ-WQYNNSOESA-N 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 238000013265 extended release Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 230000005182 global health Effects 0.000 description 1
- 230000005745 host immune response Effects 0.000 description 1
- 230000000642 iatrogenic effect Effects 0.000 description 1
- 239000012729 immediate-release (IR) formulation Substances 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 230000001788 irregular Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000012931 lyophilized formulation Substances 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 150000002704 mannoses Chemical class 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004779 membrane envelope Anatomy 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000009984 peri-natal effect Effects 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 230000000541 pulsatile effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000007420 reactivation Effects 0.000 description 1
- 229940124551 recombinant vaccine Drugs 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 230000001568 sexual effect Effects 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 230000003393 splenic effect Effects 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229960004556 tenofovir Drugs 0.000 description 1
- VCMJCVGFSROFHV-WZGZYPNHSA-N tenofovir disoproxil fumarate Chemical compound OC(=O)\C=C\C(O)=O.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VCMJCVGFSROFHV-WZGZYPNHSA-N 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- -1 vaccines Substances 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 201000001862 viral hepatitis Diseases 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/42—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum viral
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
Definitions
- the present technology relates to compositions and methods for the treatment of hepatitis B infection, including chronic hepatitis B (CHB).
- CHB chronic hepatitis B
- BACKGROUND [0003] The reference in this specification to any prior publication (or information derived from it), or to any matter which is known, is not, and should not be taken as an acknowledgement or admission or any form of suggestion that the prior publication (or information derived from it) or known matter forms part of the common general knowledge in the field of endeavor to which this specification relates.
- Hepatitis B is the most common viral hepatitis, is potentially life threatening, may have long term complications, and is one of the major public health challenges worldwide.
- CHB infection Despite the introduction of a preventative hepatitis B vaccine more than 30 years ago, chronic hepatitis B (CHB) infection remains a global health issue (Lozano R, et al. Lancet 2012; 380(9859):2095- 128), contributing to more than 50% of the world’s liver cancer burden. Approximately one-third of individuals with chronic hepatitis B (CHB) will die from serious liver diseases, such as cirrhosis, hepatocellular carcinoma (HCC), and liver failure, if left untreated.
- HCC hepatocellular carcinoma
- Hepatitis B complete cure is defined by the eradication of the virus and all its replicative intermediates (Revill P, et al. Nature Reviews Gastroenterology and Hepatology, 2016, 13(4):239-248), which is presently considered an unrealistic outcome.
- the clinical endpoint of HBsAg loss and/or seroconversion to anti-HBs is the current goal for CHB therapy, but is rarely achieved.
- the basis for this clearance is presumably the selective pressure of an effective host antiviral (antibody driven) response.
- the innate and adaptive immune responses in patients with CHB have been shown to be compromised, characterized by suboptimal antigen presentation, exhaustion of antigen-specific T-cells and insufficient antibody production (Wang L, et al.
- the present disclosure provides an isolated antibody or antigen binding fragment thereof that specifically binds a hepatitis B virus (HBV) antigen, comprising: (i) three heavy chain CDR sequences comprising (a) a first heavy chain CDR selected from the group consisting of: GFTFSDF (SEQ ID NO: 13), DFWMN (SEQ ID NO: 14), and GFTFSDFW (SEQ ID NO: 15); (b) a second heavy chain CDR selected from the group consisting of: RNKPYNYQ (SEQ ID NO: 16), QIRNKPYNYQTYYSESVRG (SEQ ID NO: 17), and IRNKPYNYQT (SEQ ID NO: 18); and (c) a third heavy chain CDR selected from the group consisting of: GFDY (SEQ ID NO: 19) and TGGFDY (SEQ ID NO: 20); and (ii) three light chain CDR sequences comprising (a) a first light chain CDR selected from
- the isolated antibody or antigen binding fragment thereof comprises a variable chain combination selected from the group consisting of: VH3 (SEQ ID NO: 8) and VL2 (SEQ ID NO: 11); VH2 (SEQ ID NO: 7) and VL1 (SEQ ID NO: 10); VH3 (SEQ ID NO: 8) and VL1 (SEQ ID NO: 10); VH1 (SEQ ID NO: 6) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL1 (SEQ ID NO: 10); VH2 (SEQ ID NO: 7) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL3 (SEQ ID NO: 12); VH3 (SEQ ID NO: 8) and VL3 (SEQ ID NO: 12); and VH2 (SEQ ID NO: 7) and VL3 (SEQ ID NO: 12).
- the antibody or antigen Atty. Dkt. No.117586-0119 binding fragment thereof comprises a variable chain combination selected from the group consisting of: VH3 (SEQ ID NO: 8) and VL2 (SEQ ID NO: 11); VH2 (SEQ ID NO: 7) and VL1 (SEQ ID NO: 10); VH3 (SEQ ID NO: 8) and VL1 (SEQ ID NO: 10); VH1 (SEQ ID NO: 6) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL1 (SEQ ID NO: 10); VH2 (SEQ ID NO: 7) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL3 (SEQ ID NO: 12); VH3 (SEQ ID NO: 8) and VL3 (SEQ ID NO: 12); and VH2 (SEQ ID NO: 7) and VL3 (SEQ ID NO: 12).
- the modified Fc region of the isolated antibody or antigen binding fragment thereof can interact with the modified Fc region of at least one other isolated antibody or antigen binding fragment thereof to form a multimer.
- the composition comprises at least one antibody or antigen binding fragment thereof.
- the composition further comprises a pharmaceutically acceptable carrier.
- the composition further comprises a preservative.
- the composition further comprises a co-therapeutic.
- the co-therapeutic comprises at least one of antivirals, siRNAs, immunomodulators, and vaccines.
- the isolated antibody or antigen binding fragment thereof further comprises (i) a variable heavy chain selected from the group consisting of: VH1 (SEQ ID NO: 6), VH2 (SEQ ID NO: 7), and VH3 (SEQ ID NO: 8); and (ii) a variable light chain selected from the group consisting of: VL1 (SEQ ID NO: 10), VL2 (SEQ ID NO: 11), and VL3 (SEQ ID NO: 12).
- the altered biological activity comprises increased or decreased antibody half-life.
- the modified Fc region of the isolated antibody or antigen binding fragment thereof can interact with the modified Fc region of at least one other isolated antibody or antigen binding fragment thereof to form a multimer.
- the pharmaceutical composition comprises at least one antibody or antigen binding fragment thereof.
- the pharmaceutical composition further comprises a preservative.
- the pharmaceutical composition further comprises a co-therapeutic.
- the co-therapeutic comprises at least one of antivirals, siRNAs, immunomodulators, and vaccines.
- the pharmaceutical composition is formulated for administration intravenously, intraperitoneally, subcutaneously, or intramuscularly.
- the isolated antibody or antigen binding fragment thereof of comprises (i) a variable heavy chain selected from the group Atty. Dkt. No.117586-0119 consisting of: VH1 (SEQ ID NO: 6), VH2 (SEQ ID NO: 7), and VH3 (SEQ ID NO: 8); and (ii) a variable light chain selected from the group consisting of: VL1 (SEQ ID NO: 10), VL2 (SEQ ID NO: 11), and VL3 (SEQ ID NO: 12).
- the kit further comprises a co-therapeutic.
- the co-therapeutic further comprises an antiviral, an siRNA, an immunomodulator, or a vaccine.
- the present disclosure provides a method of measuring a hepatitis B virus (HBV) antigen in a sample comprising: (i) contacting a sample with an antibody or antigen binding fragment thereof, wherein the antibody or antigen binding fragment thereof comprises (a) three heavy chain CDR sequences comprising (1) a first heavy chain CDR selected from the group consisting of: GFTFSDF (SEQ ID NO: 13), DFWMN (SEQ ID NO: 14), and GFTFSDFW (SEQ ID NO: 15); (2) a second heavy chain CDR selected from the group consisting of: RNKPYNYQ (SEQ ID NO: 16), QIRNKPYNYQTYYSESVRG (SEQ ID NO: 17), and IRNKPYNYQT (SEQ ID NO: 18); and (3) a third heavy chain
- the antibody or antigen binding fragment thereof comprises a variable chain combination selected from the group consisting of: VH3 (SEQ ID NO: 8) and VL2 (SEQ ID NO: 11); VH2 (SEQ ID NO: 7) and VL1 (SEQ ID NO: 10); VH3 (SEQ ID NO: 8) and VL1 (SEQ ID NO: 10); VH1 (SEQ ID NO: 6) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL1 (SEQ ID NO: 10); VH2 (SEQ ID NO: 7) and VL2 (SEQ ID NO: 11); VH1 (SEQ ID NO: 6) and VL3 (SEQ ID NO: 12); VH3 (SEQ ID NO: 8) and VL3 (SEQ ID NO: 12); and VH2 (SEQ ID NO: 7) and VL3 (SEQ ID NO: 12).
- VH3 (SEQ ID NO: 8) and VL3 (SEQ ID NO: 12
- FIG.1A represents the average HBsAg in each Atty. Dkt. No.117586-0119 condition over time.
- FIG.1B shows the individual mouse data for the placebo group over time.
- FIG.1C shows the individual mouse data for the 200 ⁇ g m4G2 group over time.
- FIG.1D shows the individual mouse data for the 400 ⁇ g m4G2 group over time.
- FIG.1E shows the HBcAg response in the liver of each treatment group.
- FIGs.2A-2B show the binding affinity of murine 4G2 (m4G2) to CLB-405.
- FIG.2A shows the binding of m4G2 to CLB-405 as measured by ELISA.
- FIG.5A is a chart showing the average HBsAg levels for all groups.
- FIG.5B is a chart showing the change in HBsAg levels for individual mice in the placebo group.
- FIG.5C is a chart showing the change in HBsAg levels for individual mice in the 4G2 (3-2) 400 ⁇ g group.
- FIG.5D is a chart showing the HBcAg response in the liver of the placebo and 4G2 (3-2) 400 ⁇ g groups.
- FIGs.6A-6H show the effect of different treatments on HBsAg levels in persistent hepatitis B virus infection (CBA/CaJ) CHB mouse model.
- FIG.11 is a chart showing the binding affinity results from an ELISA for the chimeric (VH+VL), 4G2-VH3+VL2, 4G2-VH2+VL1 and 4G2-VH3+VL1 antibodies.
- DETAILED DESCRIPTION [0030] It is to be appreciated that certain aspects, modes, embodiments, variations, and features of the present technology are described below in various levels of detail in order to provide a substantial understanding of the present technology. The definitions of certain terms as used in this specification are provided below. Unless defined otherwise, all technical and scientific terms used herein generally have the same meaning as commonly understood by one of ordinary skill in the art to which this present technology belongs. I.
- anti-HBs anti-HBs antibodies
- mAb murine
- hAb humanized
- antigen binding fragments thereof The antibodies include various types, including, for example, IgG.
- the antibodies are murine or humanized.
- the anti-HBV antibodies bind efficiently to HBV antigens.
- the immunogenicity and therapeutic outcomes of anti-HBs mAbs are initially validated in a newly developed and validated CBA Carter J (CBA/CaJ) murine model of CHB (see, e.g., Chen HH, et al. PNAS 112(7):2175-2180 (2015)).
- the antigen binding dynamics of the anti-HBs hAbs is initially validated using surface plasmon resonance (SPR) assays and a known HBV antigen, CLB-405 (SEQ ID NO: 40).
- SPR surface plasmon resonance
- CLB-405 SEQ ID NO: 40
- the aim of anti-HBs antibodies when delivered to patients with CHB, is to accelerate and drive functional hepatitis B cure.
- the anti-HBs antibodies can also be used to determine the presence of HBV antigens in a sample.
- Reference to a “likelihood” of a functional cure generally means that the likelihood is 100% that the subject will reach a state of functional cure or, in the absence of circulating HBsAg, has achieved a functional cure. However, as in any biological system, variability can occur. Hence, for the purposes of the present technology, reference to a “likelihood” of a functional cure means at least 80% probability that a subject will achieve a functional cure.
- Humanized antibodies can include full or partial fixed region amino acid sequences from one or more human antibodies and full or partial variable region amino acid Atty. Dkt. No.117586-0119 sequences from one or more non-human antibodies (e.g., mouse antibodies).
- the humanized antibody is made by incorporating the complementarity- determining region (CDR) from one or more non-human antibodies into the non-CDR regions of one or more human antibodies.
- Humanized antibodies can include backmutations, wherein one or more residues in a human originating fixed region is mutated to correspond to one or more residues in a non-human originating fixed region, wherein backmutations can increase binding affinity or improve other properties.
- HBV-specific T cells During spontaneous resolution of acute hepatitis B infection, a coordinated interaction of HBV-specific T cells and B cells eliminate infected hepatocytes, suppress viral replication via non-cytolytic pathways, and neutralize virions through the production of virus-specific antibodies (anti-HBs).
- Chronic infection represents failure of the host immune response to control HBV replication, with spontaneous clearance of HBsAg being uncommon, and found to occur in only 1-2% of patients. This rate is not enhanced with current antiviral therapies, but a key factor associated with this spontaneous loss is a low serum level of HBsAg of ⁇ 100 IU/ml (Tseng TC, et al.
- Phase 4 is a relapse or recrudescence in liver disease activity and viral replication and this phase is also known as HBeAg-negative disease. This phase tends to eventually burn itself out and then patients often have cirrhosis.
- the final phase, phase 5, is identified as HBsAg loss and anti-HBs seroconversion. This is also recognized as the functional cure (FC) phase.
- FC functional cure
- the glycosylation structure can be modified by, for example, altering component linkages and/or adding or removing mannose, N-acetylglucosamine, fucose, galactose, and/or sialic acid.
- the Fc region of the isolated antibody, or antigen binding fragments thereof, of the present technology is modified by isotype swapping comprising pairing the Fc region of one antibody type (e.g., IgG, IgM, IgA, IgD, IgE) with the Fab region of a different antibody type.
- No.117586-0119 treatment if any, frequency of treatment, and the nature of the effect wanted. Dosage may be singular, at an irregular interval, or at a regular interval, such as daily, weekly, or monthly.
- the ranges of effective doses provided below are not intended to be limiting and represent exemplary dose ranges. Thus, in some embodiments, the dosage will be tailored to the individual subject, as is understood and determinable by one of skill in the art.
- the dosage of an anti-HBs antibody for a mammalian (e.g., human) adult can be from 0.001 mg to 2,000 mg, or any range or value therein. In some embodiments, the dosage can be from 0.01 mg to 2,000 mg, or any range or value therein.
- the dosage can be from 1,500 mg to 2,000 mg, or any range or value therein. In some embodiments, the dosage can be from 24 mg to 300 mg, or any range or value therein. In some embodiments, the dosage can be from about 2.0 mg per kg subject weight to about 40 mg per kg subject weight. VIII. Therapeutic and Antigen Measurement Methods and Kits for such Methods [0080] The following discussion is presented by way of example only, and is not intended to be limiting. Atty. Dkt. No.117586-0119 [0081] One aspect of the present technology includes methods of treating existing and/or persistent hepatitis B, including chronic hepatitis B (CHB) in a subject diagnosed as having or suspected as having a hepatitis B infection.
- CHB chronic hepatitis B
- kits for treating a subject in need thereof or for measuring HBV antigens in a sample wherein the kit includes the antibodies, or antigen binding fragments thereof, of the present technology.
- a kit can optionally include other components, such as a co-therapeutic.
- Example 1 Antibody Development and Purification
- the murine antibody 4G2 was generated by immunizing a single BALB/c mouse with 5 doses of a pooled antigen mix, using epitopes selected from HBsAg.
- the antigen pool was a 1:1:1 three HBsAg antigenic epitopes: a triplet of the mini-loop epitope, a triplet of the loop2 epitope, and a dimer of the extended loop1 epitope.
- Treatment with either 200 ⁇ g or 400 ⁇ g of m4G2-IgG3 resulted in a substantial decrease in serum HBsAg levels at 4 days post treatment (W8+4 in Table 3 and FIGs.1A, 1C, 1D).
- the decrease in serum HBsAg post- treatment was partially maintained even at 4 weeks post treatment, with the 400 ⁇ g treatment group exhibiting a stronger reduction phenotype than the 200 ⁇ g treatment group (W12+4 in Table 3 and FIGs.1A, 1C, 1D).
- Table 3 Results of murine 4G2 (m4G2) treatment of chronic HBV [0091] These results show that serotherapy using 4G2 antibody is efficacious in the HDI CHB murine model with rapid serum HBsAg decline and clearance, and clearance of infected hepatocytes. Accordingly, these results demonstrate that the antibodies, or Atty. Dkt. No.117586-0119 antigen binding fragments thereof, of the present technology are useful in methods for treating hepatitis (HBV) infection in a subject in need thereof.
- Example 3 Development of Humanized antibodies and CDR Identification [0092] Humanized versions of the 4G2 (h4G2) antibody were developed.
- AD66810 siRNA was delivered subcutaneously (SC) at 3 mg/kg body weight (mpk) on study day 0.
- Submandibular bleeds were performed at 7 days before day 0 (-7), day 7, day 14, day 24, and day 28 of the study. Samples were Atty. Dkt. No.117586-0119 assayed for serum HBsAg levels, which were then cross-compared between treatment groups to determine therapeutic efficacy.
- each treatment was therapeutically effective in every mouse treated.
- Treatment with anti-HBV siRNA decreased HBsAg levels at 7 days post treatment (study day 7), with antigen levels rebounding slightly throughout the remainder of the study.
- Treatment with m4G2 decreased HBsAg levels below the limit of detection at 7 days post treatment (study day 14), with HBsAg rebounding by 17 days post treatment (study day 24).
- FIG. 6G shows the average response in HBsAg levels for each treatment group.
- the plate was washed 6 times with PBS, 0.05% Tween-20 and developed with 100 ⁇ l TMB substrate for 10 minutes at room temperature and stopped by adding 50 ⁇ l of stop solution.
- the absorbance values were measured at 450 nm using a spectrophotometer.
- the equilibrium dissociation constants (K D ) were calculated from the ratio of kd over ka.
- the m4G2 antibody binds HBsAg, a known HBV antigen, with an EC50 of 0.2 nM as determined by ELISA (FIG.2A), and has a dissociation constant (K D ) of 14.9 nM as determined by SPR (FIG.2B).
- the binding performance of m4G2 to CLB-405 is summarized in Table 11.
- Table 11 4G2 binding performance to CLB-405 (SEQ ID NO: 40)
- Example 6 Antiviral activity of multi-dose m4G2 in a hydrodynamic tail vein injection (HDI) murine model with persistent HBV infection
- HDI hydrodynamic tail vein injection
- HBV genotype A2adw2 plasmid into CBA/CaJ mice was performed to establish persistent infection of ⁇ 3 log IU/mL HBsAg.
- mice were monitored at different timepoints for serological markers of HBsAg and HBV DNA.
- FIG.3 and Table 12 multiple injections of m4G2 at 400 ⁇ g resulted in no significant HBsAg rebound up to 2 weeks post third dose in all mice in that group, and resulted in an increase in the number of mice with persistent HBsAg control from 3/8 mice in the single dose group to 5/8 in the multi dose group. Atty. Dkt.
- Example 7 Antiviral activity of m4G2 in AAV-HBV model
- Male C57BL/6 mice were infected with AAV8 virus carrying 1.3 copies of the HBV genome (genotype D, serotype ayw) at 5 ⁇ 10 10 viral genome equivalents to establish a stable infection of ⁇ 4 log IU/mL HBsAg.
- Mice received two intravenous injections of m4G2 at a dose of 400 ⁇ g per mouse on days 0 and 56.
- the efficacy of m4G2 was determined by evaluation of HBsAg in plasma at various timepoints post antibody administration.
- the murine monoclonal antibody m4G2 binds specifically to a loop 1 epitope within the Hepatitis B surface antigen (HBsAg), and, as shown in Example 2, demonstrates anti-viral activity in the hydrodynamic tail vein Atty. Dkt. No.117586-0119 injection (HDI) mouse model of persistent HBV infection. As described in Example 3, this antibody was humanized onto human IgG1 backbone to produce the humanized 4G2 (3-2) anti-CLB-405 antibody. [0108] In vivo model.
- the humanized candidate 4G2 (3-2) anti-CLB-405 antibody also known as 4G2-VH3+VL2
- 4G2-VH3+VL2 was tested for efficacy in a mouse model for persistent hepatitis B virus infection (CBA/CaJ CHB mouse model).
- a single dose of 400 ⁇ g of 4G2 (3-2) antibody was injected intravenously.
- the CBA/CaJ CHB mouse model was developed by hydrodynamic injection (HDI) of an HBV replication competent DNA (HBV genotype A2 adw (Huang et al., “An immunocompetent mouse model for the tolerance of human chronic hepatitis B virus infection,” PNAS 103(47):17862-17867 (2006)), which allows for the delivery of DNA into hepatocytes through an intravenous tail vein injection delivery of HBV plasmid in a large aqueous volume (Yang et al., “Hydrodynamic injection of viral DNA: A mouse model of acute hepatitis B virus infection,” PNAS 99(21):13825-13830 (2002); Huang et al. (2006)).
- HBV replication competent DNA HBV replication competent DNA
- Table 14 shows the average reduction in HBsAg in mice treated with 4G2 (3-2) and placebo. Table 14 also shows the number of responders in each groups defined as animals with HBsAg declines >0.5 log or undetectable HBsAg.
- Table 13 Study design to evaluate the efficacy of humanized candidate 4G2 (3-2) in persistent hepatitis B virus infection (CBA/CaJ) CHB mouse model
- Table 14 Efficacy of humanized candidate 4G2 (3-2) by reduction in circulating HBsAg in persistent hepatitis B virus infection (CBA/CaJ) CHB mouse model [0111] Results.
- FIGs.5A-5C show the average and individual effect of humanized candidate 4G2 (3-2) on HBsAg levels in persistent hepatitis B virus infection (CBA/CaJ) CHB mouse model.
- FIG.5A shows the average data indicating that administration of 4G2 (3-2) resulted in decrease in serum HBsAg at 400 ⁇ g dose level showing an average 1.6 log reduction in HBsAg at week 10+4 (4 days post-dose antibody administration) where the peak efficacy was observed.
- the HBsAg levels rebound for a subset of mice within a week with average reduction at the end of the study being 1.21 log reduction whereas on average, the placebo animals did not show significant decline in HBsAg over the duration of the study.
- FIGs.5B and 5C show the individual data for mice in placebo and treatment groups, respectively.
- the number of animals with undetectable HBsAg at peak response (week 10+4) was 1/8 in placebo and 8/8 in 4G2 (3-2) groups, whereas at the end of the study (week 12+4) was 1/8 in placebo and 4/8 in 4G2 (3-2) groups.
- the number of responders (HBsAg declines >0.5 log) at peak response (week 10+4) was 1/8 in placebo and 8/8 in 4G2 (3-2) groups, whereas at the end of the study (week 12+4) was 1/8 in placebo and 7/8 in Atty. Dkt. No.117586-0119 4G2 (3-2) groups.
- the humanized candidate 4G2 demonstrated liver clearance as assessed by IHC of Hepatitis B core antigen (HBcAg) positive cells in the liver.
- HBV Hepatitis B core antigen
- Example 9 Humanized 4G2 is effective in combination with siRNA in the HDI CHB model
- Humanized 4G2 (h4G2) candidates in combination with anti-HBV siRNA were assayed for their efficacy in inducing a response in a mouse model for persistent hepatitis B virus infection (CBA/CaJ CHB mouse model).
- HBV replication competent DNA plasmid HBV genotype A2 adw (PJ Chen)
- HBV genotype A2 adw PJ Chen
- a single HDI of an HBV replication competent DNA plasmid has generally been shown to induce persistent HBV replication (> 6 months).
- HDI HBV DNA and HBsAg serological markers were measured in mouse serum to confirm that a persistent HBV infection was established.
- Mice with a persistent HBV replication were then used to evaluate the effectiveness of humanized 4G2 in combination with siRNA treatment.
- HBV model mice either received a placebo, siRNA treatment (AD-66810), or combination treatment with siRNA (AD-66810) and h4G2-VH3+VL2, with 3 mg/kg (mpk) siRNA administered at day 0 subcutaneously (SC) and 400 ⁇ g h4G2-VH3+VL2, or an equivalent volume of placebo PBS, administered at day 7 intravenously (IV).
- Table 15 Humanized 4G2 and siRNA experimental design [0115] As shown in FIGs.7A-7D, combination treatment with anti-HBV siRNA and h4G2-VH3+VL2 resulted in synergistic beneficial effects. At day -7 all treatment groups Atty. Dkt.
- Antibody treatment combined with siRNA treatment further exhibited synergistic therapeutic effects in a persistent HBV model, including combination treatment with h4G2- VH3+VL2 and anti-HBV siRNA.
- these results demonstrate that the antibodies, or antigen binding fragments thereof, of the present technology are useful in methods for treating hepatitis (HBV) infection in a subject in need thereof.
- Example 10 Binding Affinity Analysis of h4G2 Candidates.
- the top three humanized 4G2 candidates demonstrating the greatest binding affinity (4G2-VH3+VL2, 4G2-VH2+VL1, and 4G2-VH3+VL1), as described in Example 3, were purified at 20 mg scale with > 95% purity (FIG.8), and were further analyzed by multi-dose SPR and ELISA to confirm binding affinity to Hepatitis B antigens.
- the selected antibodies were evaluated for binding to CLB-405 HBsAg using a Surface Plasmon Atty. Dkt. No.117586-0119 Resonance (SPR) biosensor, Biacore 8K (GE Healthcare).
- Antibodies were captured on the sensor chip through Fc capture method and CLB-405 HBsAg was used as the analyte (FIG. 9).
- the data of dissociation (kd) and association (ka) rate constants were obtained using Biacore 8K evaluation software.
- the equilibrium dissociation constants (KD) were calculated from the ratio of kd over ka.
- 1 ⁇ g/ml CLB-405 was coated on an ELISA plate in 100 ⁇ l CBS at 4°C overnight. The washed and blocked plates were incubated with the selected antibodies titrated 3-fold starting at 15 ⁇ g/ml.
- the plates were washed and incubated with anti-Human IgG Fc [HRP] and anti-Mouse Fc [HRP] for 30min at 37°C.
- the plate was washed and developed with TMB substrate at room temperature and stopped by addition of stop solution.
- the absorbance values were measured at 450 nm using a spectrometer.
- each range discussed herein can be readily broken down into a lower third, middle third and upper third, etc.
- all language such as “up to,” “at least,” “greater than,” “less than,” and the like include the number recited and refer to ranges which can be subsequently broken down into subranges as discussed above.
- a range includes each individual member.
- a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
- a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.
- Atty. Dkt. No.117586-0119 All patents, patent applications, provisional applications, and publications referred to or cited herein are incorporated by reference in their entirety, including all figures and tables, to the extent they are not inconsistent with the explicit teachings of this specification.
- Hepatitis B surface antigen S (HBsAg-S) protein (external loop region between 100 and 160 amino acid position is underlined, stop codon is *): MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPT SNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSS TTSTGPCRTCMTTGQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFS WLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI* (SEQ ID NO: 3) Hepatitis B surface antigen S (HBsAg-S) protein and a FLAG tag (FLAG sequence is italicized and external loop region between 100 and 160 amino acid position is underlined): MDYKDDDDKENITSGFLGPLLVLQAG
- Humanized variable heavy chain CDR1 IMGT GFTFSDFW (SEQ ID NO: 15) Humanized variable heavy chain CDR2 Chothia: RNKPYNYQ (SEQ ID NO: 16) Humanized variable heavy chain CDR2 Kabat: QIRNKPYNYQTYYSESVRG (SEQ ID NO: 17) Humanized variable heavy chain CDR2 IMGT: IRNKPYNYQT (SEQ ID NO: 18) Humanized variable heavy chain CDR3 Chothia: GFDY (SEQ ID NO: 19) Humanized variable heavy chain CDR3 Kabat: GFDY (SEQ ID NO: 19) Humanized variable heavy chain CDR3 IMGT: TGGFDY (SEQ ID NO: 20) Humanized variable light chain CDR1 Chothia: KASQDVSSDVA (SEQ ID NO: 21) Humanized variable light chain CDR1 Kabat: KASQDVSSDVA (SEQ ID NO: 21) Humanized variable light chain CDR1 IMGT: Q
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Sont divulguées dans la présente invention des compositions et des méthodes pour le traitement d'une infection d'hépatite B, notamment l'hépatite B chronique (HBC).
Applications Claiming Priority (8)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202363437506P | 2023-01-06 | 2023-01-06 | |
US63/437,506 | 2023-01-06 | ||
US202363505194P | 2023-05-31 | 2023-05-31 | |
US63/505,194 | 2023-05-31 | ||
US202363588082P | 2023-10-05 | 2023-10-05 | |
US63/588,082 | 2023-10-05 | ||
US202363589057P | 2023-10-10 | 2023-10-10 | |
US63/589,057 | 2023-10-10 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024148263A1 true WO2024148263A1 (fr) | 2024-07-11 |
Family
ID=91804369
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2024/010478 WO2024148263A1 (fr) | 2023-01-06 | 2024-01-05 | Méthodes et compositions pour le traitement par anticorps d'une infection d'hépatite b |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024148263A1 (fr) |
Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN110240658A (zh) * | 2019-06-20 | 2019-09-17 | 徐州医科大学 | 靶向hbv治疗肝癌的car-t及其应用 |
US20190389939A1 (en) * | 2015-10-09 | 2019-12-26 | Xiamen University | Antibody against hepatitis b surface antigen and use thereof |
US20220119537A1 (en) * | 2012-05-18 | 2022-04-21 | Amgen Inc. | St2 antigen binding proteins |
US20220127336A1 (en) * | 2018-12-19 | 2022-04-28 | Humabs Biomed Sa | Antibodies that neutralize hepatitis b virus and uses thereof |
WO2022240159A1 (fr) * | 2021-05-10 | 2022-11-17 | 메디맵바이오 주식회사 | Anticorps anti-tigit et leur utilisation |
-
2024
- 2024-01-05 WO PCT/US2024/010478 patent/WO2024148263A1/fr unknown
Patent Citations (5)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20220119537A1 (en) * | 2012-05-18 | 2022-04-21 | Amgen Inc. | St2 antigen binding proteins |
US20190389939A1 (en) * | 2015-10-09 | 2019-12-26 | Xiamen University | Antibody against hepatitis b surface antigen and use thereof |
US20220127336A1 (en) * | 2018-12-19 | 2022-04-28 | Humabs Biomed Sa | Antibodies that neutralize hepatitis b virus and uses thereof |
CN110240658A (zh) * | 2019-06-20 | 2019-09-17 | 徐州医科大学 | 靶向hbv治疗肝癌的car-t及其应用 |
WO2022240159A1 (fr) * | 2021-05-10 | 2022-11-17 | 메디맵바이오 주식회사 | Anticorps anti-tigit et leur utilisation |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10421804B2 (en) | Anti-Zika virus antibodies and methods of use | |
US20220363735A1 (en) | Polyomavirus Neutralizing Antibodies | |
EA036953B1 (ru) | Человеческие антитела против гемагглютинина вируса гриппа | |
EP3094644B1 (fr) | Anticorps monoclonaux humains neutralisants dirigés contre l'antigène de surface du virus de l'hépatite b | |
EA034767B1 (ru) | Человеческие антитела к белку f респираторного синцитиального вируса и способы их применения | |
JP7490574B2 (ja) | B型肝炎抗体 | |
RU2765878C2 (ru) | Антитела для лечения инфекции гепатитом в и связанных с ней заболеваний | |
WO2017059813A1 (fr) | Anticorps anti-antigène de surface d'hépatite b et son utilisation | |
JP2023528441A (ja) | 抗SARS-CoV-2スパイク糖タンパク質抗体を用いてSARS-CoV-2感染及びCOVID-19を治療又は予防するための方法 | |
US20240336691A1 (en) | Anti-tl1a antibody compositions and methods of treatment in the lung | |
Hong et al. | Recent progress on neutralizing antibodies against hepatitis B virus and its implications | |
CN114729371B (zh) | 能够抑制乙型肝炎病毒(hbv)对人肝细胞的感染的与人ntcp结合的抗体 | |
WO2024148263A1 (fr) | Méthodes et compositions pour le traitement par anticorps d'une infection d'hépatite b | |
Lim et al. | Single domain antibodies derived from ancient animals as broadly neutralizing agents for SARS-CoV-2 and other coronaviruses | |
JP2021511043A (ja) | インフルエンザヘマグルチニンに対するヒト抗体 | |
JP2022547551A (ja) | B型肝炎に対するヒト中和抗体に関連する組成物及び方法 | |
RU2817696C1 (ru) | Моноклональное антитело iC1 и его антигенсвязывающий фрагмент, селективно связывающие рецептор-связывающий домен Spike-белка вируса SARS-CoV-2, обладающие вируснейтрализующей активностью | |
US20230000979A1 (en) | Anti-crimean-congo hemorrhagic fever virus antibodies, and methods of their generation and use | |
US20220143172A1 (en) | Immune composition comprising antigen and glycoengineered antibody thereof | |
CN116457370A (zh) | 包含抗原和其醣工程化抗体的免疫组合物 | |
EA046393B1 (ru) | Антитела к гемагглютинину и их применение | |
JP2024105291A (ja) | B型肝炎感染症を処置するための方法および組成物 | |
JP2022553703A (ja) | 抗血球凝集素抗体およびその使用方法 | |
PURCELL NGAMBO et al. | Patent 2969749 Summary |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 24738981 Country of ref document: EP Kind code of ref document: A1 |