WO2024128550A1 - 트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법 - Google Patents

트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법 Download PDF

Info

Publication number
WO2024128550A1
WO2024128550A1 PCT/KR2023/017380 KR2023017380W WO2024128550A1 WO 2024128550 A1 WO2024128550 A1 WO 2024128550A1 KR 2023017380 W KR2023017380 W KR 2023017380W WO 2024128550 A1 WO2024128550 A1 WO 2024128550A1
Authority
WO
WIPO (PCT)
Prior art keywords
strain
pdi
yeast
genus
protein
Prior art date
Application number
PCT/KR2023/017380
Other languages
English (en)
French (fr)
Inventor
송규현
배현원
변효정
박진섭
김병수
Original Assignee
씨제이제일제당 (주)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 씨제이제일제당 (주) filed Critical 씨제이제일제당 (주)
Publication of WO2024128550A1 publication Critical patent/WO2024128550A1/ko

Links

Images

Definitions

  • the present invention relates to a method for producing recombinant proteins using PDI derived from strains of the Trichoderma genus.
  • Host cells that are mainly used to produce recombinant proteins include E. coli, yeast ( S. cerevisiae ), and CHO cells, which are animal cells.
  • yeast has several advantages compared to E. coli. there is. Unlike E. coli , yeast is a eukaryotic cell that is genetically identical to higher organisms. It has a transcription and translation system similar to genes derived from higher organisms, can remove introns through splicing, and is capable of removing introns from higher organisms. It has a secretory organ similar to the Golgi apparatus, so it can produce and secrete activated proteins through post-translational modification.
  • endotoxin endotoxin
  • endotoxin which must be removed in the case of medicinal proteins, is removed.
  • S. cerevisiae which is commonly used, has been actively studied by numerous researchers since the production of genetic recombinant proteins using this yeast was reported in 1981. However, in order to obtain a high expression rate in S.
  • Pichia pastoris a facultative methylotrophic yeast, has recently been attracting attention.
  • Pichia pastoris is a methylotrophic yeast, and foreign genes can be integrated into chromosomal DNA. It uses AOX1 as a promoter for enzymes in the methanol-using pathway, and this promoter has the advantage of being very strong.
  • Protein disulfide isomerase is an enzyme that catalyzes the thiol:disulfide bond exchange reaction. It resides in the endoplasmic reticulum and transfers the disulfide bond to newly synthesized secretory proteins that enter the endoplasmic reticulum.
  • PDI is an oxidoreductase that has not only the activity of transferring disulfide bonds, but also the isomerization activity of breaking misconnected disulfide bonds and changing them into structurally stable disulfide bonds. If PDI does not operate normally, the substrates cannot escape the endoplasmic reticulum and be secreted to the Golgi apparatus or the outside of the cell and are decomposed. Therefore, the efficiency of secretory protein synthesis may vary depending on the level of PDI activity.
  • Thermophilic fungal PDI is fused to the amino-terminus of the target protein and secreted out of the cell in Bacillus brevis strains (Kajino, T. et al. (2000) Appl. Environ. Microbiol. 66: 638-642) , co-expression of dsbC, a type of PDI, with a target protein in the oxidative cytoplasm of mutant E. coli (Bessette, PH et al. (1999) Proc. Natl. Acad. Sci. USA, 96: 13703-13708) was reported. It has been done.
  • the yield of the target protein is quite low due to problems such as secretion of proteolytic enzymes, and when dsbC and the target protein are co-expressed in the cytoplasm, the expression rate is known to be low. there is.
  • a variant yeast production step comprising performing the following steps i) and ii) simultaneously, sequentially or in reverse order:
  • PDI protein disulfide isomerase
  • Another example of the present application provides a mutant yeast for producing a target protein containing a gene encoding protein disulfide isomerase (PDI) derived from a strain of the genus Trichoderma .
  • PDI protein disulfide isomerase
  • compositions for producing a target protein in mutant yeast including a gene encoding protein disulfide isomerase (PDI) derived from a strain of the genus Trichoderma or a recombinant vector containing the same.
  • PDI protein disulfide isomerase
  • the present invention provides a mutant yeast strain transformed with a gene encoding protein disulfide isomerase (PDI) derived from a strain of the genus Trichoderma and a method for producing a target protein using the same.
  • PDI protein disulfide isomerase
  • a variant yeast production step comprising performing the following steps i) and ii) simultaneously, sequentially or in reverse order:
  • PDI protein disulfide isomerase
  • PDI protein disulfide isomerase
  • the PDI in step i) of step 1) may be PDI derived from a genus Trichoderma strain, and preferably may be PDI derived from a Trichoderma reesei strain.
  • the PDI may include the amino acid sequence of SEQ ID NO: 14 or may consist of the amino acid sequence of SEQ ID NO: 14, and if it has the same or corresponding enzymatic activity as the PDI, a portion of the amino acid sequence of SEQ ID NO: 14 Polypeptides having amino acid sequences whose sequences are deleted, modified, substituted, or added may also be included within the scope of the present application. In addition, regardless of the origin of the microorganism, the amino acid sequence of SEQ ID NO.
  • a polypeptide having homology or identity of 99% or more, 99.5% or more, or 99.8% or more a polypeptide having the same or corresponding conversion activity as the PDI may also be included within the scope of the present application as the PDI.
  • the yeast of step i) and step ii) of step 1) may be any one selected from the group consisting of genus Pichia , genus Candida , and genus Hansenula strains.
  • the yeast may be Pichia pastoris, more specifically, Pichia pastoris ( Pichia pastoris ) It may be BG16 strain, but is not limited thereto.
  • the target protein of step ii) of step 1) may be a protein containing a disulfide bond in the protein, or may be a protein containing 3 or more disulfide bonds in the protein, but is not limited thereto.
  • the target protein may be one or more selected from the group consisting of transferrin, albumin, and insulin precursor, and the transferrin, albumin, and insulin precursor are bovine. ), but is not limited thereto.
  • the term “transferrin” may refer to serum transferrin, and may be used as one of the factors that replace serum (FBS, fetal bovine serum) in serum free media (FBS free media), etc.
  • the transferrin may include the amino acid sequence of SEQ ID NO: 6 below or may be composed of the amino acid sequence of SEQ ID NO: 6, but is not limited thereto.
  • albumin may refer to serum albumin, and may be used as one of the factors that replace serum in serum-free media, etc.
  • the albumin may include the amino acid sequence of SEQ ID NO: 24, or may be composed of the amino acid sequence of SEQ ID NO: 24, but is not limited thereto.
  • insulin precursor may be used as one of the factors that replace serum in serum-free media, etc.
  • the insulin precursor may include the amino acid sequence of SEQ ID NO: 30 below or may be composed of the amino acid sequence of SEQ ID NO: 30, but is not limited thereto.
  • the term “vector” refers to an expression control region (or expression control sequence) suitable for expressing a polynucleotide encoding a PDI derived from a strain of the genus Trichoderma or a polynucleotide encoding a target protein in a suitable host.
  • the expression control region may include a DNA preparation containing the base sequence of the polynucleotide operably linked to a promoter capable of initiating transcription, an optional operator sequence for regulating such transcription, and a suitable mRNA ribosome binding. After being transformed into a suitable host cell, the vector can replicate or function independently of the host genome and is integrated into the genome itself. It can be.
  • the vector used in this application is not particularly limited, and any vector known in the art can be used.
  • Examples of commonly used vectors include plasmids, cosmids, viruses, and bacteriophages in a natural or recombinant state.
  • pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, and Charon21A can be used as phage vectors or cosmid vectors, and pDZ-based, pBR-based, and pUC-based plasmid vectors can be used.
  • pBluescriptII series, pGEM series, pTZ series, pCL series, and pET series can be used.
  • pDZ, pDC, pDCM2, pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pPICZ ⁇ A vectors, etc. can be used.
  • a polynucleotide encoding a PDI or a target protein derived from a strain of the genus Trichoderma can be inserted into a chromosome through a vector for intracellular chromosome insertion. Insertion of the polynucleotide into the chromosome may be accomplished by any method known in the art, for example, homologous recombination, but is not limited thereto. A selection marker may be additionally included to confirm whether the chromosome has been inserted.
  • the selection marker is used to select cells transformed with a vector, that is, to confirm the insertion of the target nucleic acid molecule, and to display selectable phenotypes such as drug resistance, auxotrophy, resistance to cytotoxic agents, or expression of surface polypeptides. Markers that provide may be used. In an environment treated with a selective agent, only cells expressing the selection marker survive or show other expression traits, so transformed cells can be selected.
  • the term “transformation” refers to introducing a vector containing a specific polynucleotide into a host cell or microorganism so that the polypeptide encoded by the polynucleotide can be expressed within the host cell.
  • the transformed polynucleotide can include both of these, regardless of whether it is inserted into the chromosome of the host cell or located outside the chromosome.
  • the polynucleotide includes DNA and/or RNA encoding the polypeptide of interest.
  • the polynucleotide can be introduced in any form as long as it can be introduced and expressed into a host cell.
  • the polynucleotide can be introduced into the host cell in the form of an expression cassette, which is a genetic structure containing all elements necessary for self-expression.
  • the expression cassette may typically include a promoter, a transcription termination signal, a ribosome binding site, and a translation termination signal that are operably linked to the polynucleotide.
  • the expression cassette may be in the form of an expression vector capable of self-replication.
  • the polynucleotide may be introduced into the host cell in its own form and operably linked to a sequence required for expression in the host cell, but is not limited thereto.
  • operably linked refers to a promoter sequence that initiates and mediates transcription of a polynucleotide encoding a PDI or a target protein derived from the genus Trichoderma strain of the present application and the polynucleotide sequence is functional. It means that it is connected to .
  • the term “culture” refers to growing the mutant yeast of the present application under appropriately controlled environmental conditions.
  • the culture process of the present application can be carried out according to appropriate media and culture conditions known in the art. This culture process can be easily adjusted and used by a person skilled in the art depending on the strain selected. Specifically, the culture may be batch, continuous, and/or fed-batch, but is not limited thereto.
  • the term "medium” refers to a material that is mainly mixed with nutrients necessary for cultivating the mutant yeast of the present application, and supplies nutrients and growth factors, including water, which are essential for survival and growth. do.
  • the medium and other culture conditions used for cultivating the mutant yeast of the present application can be any medium used for cultivating ordinary microorganisms without any particular restrictions, but the mutant yeast of the present application can be cultured with an appropriate carbon source, nitrogen source, and personnel. , can be cultured under aerobic conditions in a normal medium containing inorganic compounds, amino acids, and/or vitamins, while controlling temperature, pH, etc.
  • culture media for yeast can be found in the literature ["Yeast", Current Protocols in Molecular Biology, 2017], ["Pichia Protocols", Methods in Molecular Biology, 2007], etc.
  • the carbon source includes carbohydrates such as glucose, saccharose, lactose, fructose, sucrose, maltose, etc.; Sugar alcohols such as mannitol, sorbitol, etc., organic acids such as pyruvic acid, lactic acid, citric acid, etc.; Amino acids such as glutamic acid, methionine, lysine, etc.; Methanol or ethanol may be included. Additionally, natural organic nutrient sources such as starch hydrolyzate, molasses, blackstrap molasses, rice bran, cassava, bagasse and corn steep liquor can be used, specifically glucose and sterilized pre-treated molasses (i.e. converted to reducing sugars). Carbohydrates such as molasses) can be used, and various other carbon sources in an appropriate amount can be used without limitation. These carbon sources may be used alone or in combination of two or more types, but are not limited thereto.
  • the nitrogen source includes inorganic nitrogen sources such as ammonia, ammonium sulfate, ammonium chloride, ammonium acetate, ammonium phosphate, anmonium carbonate, and ammonium nitrate; Organic nitrogen sources such as amino acids such as glutamic acid, methionine, and glutamine, peptone, NZ-amine, meat extract, yeast extract, malt extract, corn steep liquor, casein hydrolyzate, fish or its decomposition products, defatted soybean cake or its decomposition products, etc. can be used These nitrogen sources may be used individually or in combination of two or more types, but are not limited thereto.
  • inorganic nitrogen sources such as ammonia, ammonium sulfate, ammonium chloride, ammonium acetate, ammonium phosphate, anmonium carbonate, and ammonium nitrate
  • Organic nitrogen sources such as amino acids such as glutamic acid, methionine, and glutamine, peptone, NZ-amine, meat extract, yeast
  • the agent may include monopotassium phosphate, dipotassium phosphate, or a corresponding sodium-containing salt.
  • Inorganic compounds may include sodium chloride, calcium chloride, iron chloride, magnesium sulfate, iron sulfate, manganese sulfate, calcium carbonate, etc.
  • amino acids, vitamins, and/or appropriate precursors may be included. These components or precursors can be added to the medium batchwise or continuously. However, it is not limited to this.
  • compounds such as ammonium hydroxide, potassium hydroxide, ammonia, phosphoric acid, sulfuric acid, etc. can be added to the medium in an appropriate manner to adjust the pH of the medium.
  • foam generation can be suppressed by using an antifoaming agent such as fatty acid polyglycol ester.
  • oxygen or oxygen-containing gas can be injected into the medium, or to maintain the anaerobic and microaerobic state, nitrogen, hydrogen, or carbon dioxide gas can be injected without gas injection, and is limited thereto. That is not the case.
  • the culture temperature can be maintained at 20 to 45°C, specifically 25 to 40°C, and culture can be performed for about 10 to 160 hours, but is not limited thereto.
  • the recombinant protein produced by the culture of the present invention may be secreted into the medium or remain within the cell.
  • the recombinant protein production method of the present invention includes preparing a mutant yeast of the present invention, preparing a medium for culturing the mutant yeast, or a combination thereof (in any order), for example , may be additionally included before the culturing step.
  • the method for producing a recombinant protein of the present invention may further include the step of recovering the recombinant protein from the culture medium (medium in which the culture was performed) or the mutant yeast.
  • the recovering step may be additionally included after the culturing step.
  • the recovery may be to collect the protein of interest using a suitable method known in the art according to the cultivation method of the mutant yeast of the present invention, for example, batch, continuous, or fed-batch culture method.
  • a suitable method known in the art for example, batch, continuous, or fed-batch culture method.
  • Various chromatographies such as chromatography, HPLC, or a combination of these methods can be used, and the protein of interest can be recovered from the medium or mutant yeast using a suitable method known in the art.
  • the recombinant protein production method of the present invention may additionally include a purification step.
  • the purification can be performed using a suitable method known in the art.
  • the recovery step and the purification step are performed sequentially (or sequentially) regardless of the order, simultaneously, or in one step. It may be performed in an integrated manner, but is not limited thereto.
  • the present invention provides a mutant yeast for producing a target protein containing a gene encoding protein disulfide isomerase (PDI) derived from a strain of the genus Trichoderma .
  • PDI protein disulfide isomerase
  • the PDI, target protein, and yeast derived from the Trichoderma genus strain are as described above.
  • the mutant yeast may have a gene encoding PDI derived from a Trichoderma genus strain inserted or integrated into the yeast genome, or a gene encoding PDI derived from a Trichoderma genus strain may exist outside the yeast genome.
  • the mutant yeast may be one in which a gene encoding PDI derived from a heterogeneous Trichoderma genus strain has been introduced, resulting in increased target protein productivity compared to yeast that has not been introduced.
  • the mutant yeast with increased target protein productivity is about 1% or more, about 5% or more, about 10% or more, about 15% or more, about 20% or more compared to the target protein production ability of the parent strain or unmodified microorganism before mutation. or more, about 25% or more, about 26% or more, about 27% or more, about 28% or more, about 29% or more, about 30% or more, about 31% or more, about 32% or more, about 33% or more, about 34% or more, about 35% or more, about 36% or more, about 37% or more, about 38% or more, about 39% or more, about 40% or more, about 41% or more, about 42% or more, about 43% or more, about 44% or more, about 45% or more, about 46% or more, about 47% or more, about 48% or more, about 49% or more, about 50% or more (the upper limit is not particularly limited, for example, about 200% or less, about 150% or less) , may be about 100% or less, or may be about 50% or more (the
  • the mutant yeast with increased productivity has a target protein productivity (or production capacity, or production) of about 1.1 times or more, about 1.12 times or more, or about 1.13 times or more, compared to the parent strain or unmodified microorganism before mutation. 1.15 times or more, 1.16 times or more, 1.17 times or more, 1.18 times or more, 1.19 times or more, about 1.2 times or more, 1.25 times or more, about 1.3 times or more, about 1.4 times or more, or about 1.5 times or more (the upper limit is It may be an increase (for example, about 10 times or less, about 5 times or less, about 3 times or less, or about 2 times or less), but is not limited thereto.
  • the term “about” is a range that includes ⁇ 0.5, ⁇ 0.4, ⁇ 0.3, ⁇ 0.2, ⁇ 0.1, etc., and includes all values in a range that are equivalent or similar to the value that appears after the term “about.” Not limited.
  • non-modified microorganism does not exclude strains containing mutations that may occur naturally in microorganisms, and is either a wild-type strain or a natural strain itself, or a strain that is transformed by genetic mutation due to natural or artificial factors. It may refer to the strain before change.
  • the unmodified microorganism may refer to a strain in which a gene encoding PDI derived from a strain of the Trichoderma genus described herein is not introduced or before it is introduced.
  • non-modified microorganism may be used interchangeably with “pre-transformed strain”, “pre-transformed microorganism”, “non-mutated strain”, “non-modified strain”, “non-mutated microorganism” or “reference microorganism”.
  • the “unmodified microorganism” is Pichia pastoris ( Pichia pastoris ) may be a strain, more specifically, Pichia pastoris ( Pichia pastoris ) It may be BG16 strain, but is not limited thereto.
  • the present invention provides a composition for producing a target protein in mutant yeast, comprising a gene encoding protein disulfide isomerase (PDI) derived from a strain of the genus Trichoderma or a recombinant vector containing the same.
  • PDI protein disulfide isomerase
  • the PDI, target protein, and yeast derived from the Trichoderma genus strain are as described above.
  • the production composition may further include any suitable excipients commonly used in compositions for producing the target protein, such as preservatives, wetting agents, dispersing agents, suspending agents, buffering agents, stabilizers. Or it may be an isotonic topic, but it is not limited thereto.
  • the present invention provides a method for introducing (e.g., transforming) a polynucleotide encoding protein disulfide isomerase (PDI) derived from the genus Trichoderma strain, and/or a recombinant vector containing the polynucleotide into a microorganism.
  • the mutant yeast containing the gene encoding PDI derived from the genus Trichoderma strain of the present invention expresses the target protein at high levels, and can be used to produce the target recombinant protein in high yield.
  • Figure 1 is a schematic diagram of the pPICZFRT recombinant plasmid.
  • Figure 2 is a schematic diagram of the pPICZFRT-bTRANSFERRIN (N495Q) recombinant plasmid.
  • Figure 3 shows SDS-PAGE results for comparing transferrin expression levels in culture supernatants of Pichia pastoris PDI-introduced strain (CF04-1024), Ogataea angusta PDI-introduced strain (CF04-1025), and Trichoderma ressei PDI-introduced strain (CF04-1026). This is a diagram showing .
  • Figure 4 is a schematic diagram of the pPICZFRT-PDI(TR) recombinant plasmid.
  • Figure 5 compares the albumin expression level in the culture supernatant of the strain (CF04-1005) in which the gene encoding bovine albumin was introduced into the Pichia pastoris BG16 strain and the strain (CF04-1038) introduced into CF04-1035. This diagram shows the SDS-PAGE results for.
  • Figure 6 shows the expression level of the insulin precursor in the culture supernatant for each strain (CF04-1017) in which the gene encoding the bovine insulin precursor was introduced into the Pichia pastoris BG16 strain and the strain (CF04-1040) into which the gene encoding the bovine insulin precursor was introduced.
  • This is a diagram showing the SDS-PAGE results for comparison.
  • a vector for transformation of Pichia pastoris was prepared as follows.
  • SEQ ID NO: 1 consisting of an FRT site, a restriction enzyme recognition site for cloning, an LRA3 (L-rhamnonate dehydratase) promoter expressed under rhamnose-inducing conditions, and Flp recombinase was synthesized to produce pPICZ ⁇ A vector (InvitrogenTM, catalog number: The 1341 to 3593 bp region of V19520) was connected.
  • the region of SEQ ID NO: 1 was amplified through PCR using primers having the base sequences of SEQ ID NO: 2 and SEQ ID NO: 3 using the synthesized DNA of SEQ ID NO: 1 as a template.
  • the 1341 to 3593 bp region of the pPICZ ⁇ A vector was amplified through PCR using primers having the base sequences of SEQ ID NO: 4 and SEQ ID NO: 5 using the pPICZ ⁇ A vector DNA as a template.
  • the PCR reaction used Pfu-X DNA Polymerase (SolgTM, catalog number: SPX16-R500) and followed the manufacturer's protocol.
  • SolgTM Pfu-X DNA Polymerase
  • a recombinant plasmid was obtained by cloning the two amplified fragments using the Gibson assembly (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) method, and was named pPICZFRT. (See Figure 1).
  • the amino acid sequence of bovine transferrin was from NCBI reference sequence ID: NP_803450.2, sequences 19 to 704 excluding the signal sequence. In order to remove glycosylation from this sequence, N (asparagine) at position 495 was replaced with Q (glutamine) to use the non-glycosylated form, and the amino acid sequence of the non-glycosylated bovine transferrin is as shown in SEQ ID NO: 6.
  • the DNA codon optimized base sequence is as SEQ ID NO: 7.
  • the AOX1 promoter for methanol-induced expression was connected to the front of the base sequence of SEQ ID NO. 7, followed by the alpha mating factor sequence for secretion expression, and the AOX1 transcription terminator was connected to the back to produce a DNA fragment through gene synthesis.
  • the prepared fragment was amplified through PCR reaction using Pfu-X DNA Polymerase using primers having SEQ ID NO. NEB, catalog number: R3189) was used to cut.
  • the AOX1 promoter region was linearized using PmeI (NEB, catalog number: R0560S). Afterwards, the linearized vector was purified using the ExpinTM PCR SV kit (GeneAll, catalog number: 103-102).
  • the Pichia pastoris strain was PPS-9016 [Pichia pastoris BG16 (pep4 ⁇ , prb1 ⁇ , protease deficient)] purchased from ATUM.
  • Pichia pastoris BG16 was transformed by introducing the linearized pPICZFRT-bTRANSFERRIN(N495Q) vector using electroporation according to ATUM's manual.
  • the transformed strain was cultured on YPDS agar medium (Yeast extract 10 g/L, peptone 20 g/L, sorbitol 182.2 g/L, bacto) according to its resistance to zeocin (250 ug/mL) antibiotic (GibcoTM, catalog number: R25001). agar 20 g/L). Integration into the AOX1 promoter site in the genome was confirmed using a forward primer (SEQ ID NO: 10) that binds to the 21 bp front of the AOX1 promoter in the genome and a reverse primer (SEQ ID NO: 11) that binds to the Rhamnose promoter of the vector.
  • the PCR reaction used the Phire Plant Direct PCR Kit (Thermo ScientificTM, catalog number: F130WH) and followed the manufacturer's protocol.
  • the clones whose transformation was confirmed through PCR were inoculated into 1 mL of YP (yeast extract 10 g/L, peptone 20 g/L) + 1% rhamnose liquid medium and cultured at 30°C and 200 rpm for 24 hours. did.
  • Flp recombinase the expression of which was induced by rhamnose, recognized the FRT site and was used on YPD agar medium (Yeast extract 10 g/L, peptone 20 g/L, bacto agar 20 g/L) to select clones with deletion of the FRT region. L) and cultured at 30°C for 72 hours. Single colonies were streaked onto YPD agar and YPDS + zeocin agar, respectively, to select colonies that lost zeocin resistance due to deletion of the FRT region.
  • the selected strain was named CF04-1023.
  • Example 3 PDI orthologues derived from various strains were introduced Pichia pastoris Strain preparation and confirmation of bovine transferrin expression
  • Example 3-1 Preparation of vectors for introduction of PDI derived from various strains
  • a bovine transferrin expression strain prepared in Example 2 PDI from various strains was introduced by the following method. Vector was prepared.
  • the PDI orthologue is Trichoderma reesei, which has 44.20% homology with the PDI of Ogataea angusta (SEQ ID NO: 13), which has 54.63% homology with the amino acid sequence of SEQ ID NO: 12, based on NCBI BlastP of the PDI amino acid sequence (SEQ ID NO: 12) of Pichia pastoris.
  • PDI (SEQ ID NO: 14) was selected as a test candidate.
  • Pichia pastoris PDI gene fragments were obtained from gDNA through PCR using primers with base sequences of SEQ ID NO: 15 and SEQ ID NO: 16.
  • the sequences of Ogataea angusta PDI and Trichoderma reesei PDI are SEQ ID NO: 17 and SEQ ID NO: 18.
  • each sequence was synthesized by adding 20 bp forward and backward, complementary to the pPICZ ⁇ A vector (InvitrogenTM, catalog number: V19020) sequence.
  • Each gene fragment was obtained through PCR using Pfu-X DNA Polymerase using each synthesized DNA as a template and primers having base sequences of SEQ ID NO: 19 and SEQ ID NO: 20.
  • Each obtained gene fragment was linearized with EcoRI-HF (NEB, catalog number: R3101S) using pPICZA vector and Gibson assembly (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly
  • a recombinant plasmid was obtained by cloning using the Master Mix method.
  • the vector into which Pichia pastoris PDI was introduced was named pPICZA-PDI(PP)
  • the vector into which Ogataea angusta PDI was introduced was named pPICZA-PDI(OA)
  • the vector into which Trichoderma reesei PDI was introduced was named pPCIZA-PDI(TR).
  • Example 3-2 PDI derived from various strains was introduced Pichia pastoris Strain manufacturing
  • each linearized vector was linearized using PmeI (NEB, catalog number: R0560S). Afterwards, each linearized vector was purified using the ExpinTM PCR SV kit (GeneAll, catalog number: 103-102). Each linearized vector was introduced into strain CF04-1023 by electroporation according to ATUM's manual, and the transformed strains were selected on YPDS agar medium according to resistance to zeocin (250 ug/mL) antibiotic.
  • a forward primer SEQ ID NO: 10
  • a reverse primer SEQ ID NO: 21
  • the PCR reaction used the Phire Plant Direct PCR Kit and followed the manufacturer's protocol.
  • the Pichia pastoris PDI-introduced strain was named CF04-1024
  • the Ogataea angusta PDI-introduced strain was named CF04-1025
  • the Trichoderma ressei PDI-introduced strain was named CF04-1026.
  • Example 3-3 Pichia pastoris Confirmation of bovine transferrin expression level for each PDI derived from various strains introduced into the strain
  • the strain was cultured using 25 ml of BMMY liquid medium (1% Yeast extract, 2 % Peptone, 13.4 g/l Yeast Nitrogen Base (without amino acids), 100 mM Potassium Phosphate pH 6.0, 0.004 mg/l Biotin, 1% Methanol).
  • BMMY liquid medium 1% Yeast extract, 2 % Peptone, 13.4 g/l Yeast Nitrogen Base (without amino acids), 100 mM Potassium Phosphate pH 6.0, 0.004 mg/l Biotin, 1% Methanol.
  • the cells were cultured for 96 hours at 30°C and 200 rpm using a 250 ml Baffled Erlenmeyer Flask, and methanol at a concentration of 1% was added every 24 hours to induce continuous expression of the protein under the control of the AOX1 promoter. After the end of fermentation, expression was confirmed through analysis of the culture supernatant.
  • the strain (CF04-1023) into which PDI was not additionally introduced did not express bovine transferrin, and bovine transferrin was expressed only in the strains into which PDI was additionally introduced. It was confirmed that it was expressed.
  • the CF04-1026 strain which was a strain into which Trichoderma reesei PDI was introduced, had the highest expression level of bovine transferrin, and the expression level was about 1.3 times that of the strain into which Pichia pastoris PDI was introduced. It was confirmed that it was significantly higher.
  • Example 3-3 it was confirmed that the non-glycosylated bovine transferrin-expressing Pichia pastoris strain into which Trichoderma reesei PDI was introduced had the highest bovine transferrin expression level. Therefore, the Pichia pastoris strain expressing Trichoderma reesei PDI was prepared in the following manner.
  • pPCIZA-PDI(TR) as a template and primers with the base sequences of SEQ ID NO: 22 and SEQ ID NO: 23, obtain a DNA fragment consisting of the AOX1 promoter - Trichoderma reesei PDI-AOX1 terminator through PCR with Pfu-X DNA Polymerase. did. After cutting pPICZFRT using KpnI-HF and NotI-HF, the two fragments were assembled using the Gibson assembly method (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix).
  • a recombinant plasmid was obtained by cloning using pPICZFRT-PDI(TR) (see Figure 4).
  • the pPICZFRT-PDI(TR) vector was introduced into the Pichia pastoris BG16 strain using the same method as described in Example 2, and finally, Trichoderma reesei PDI was integrated into the genome of the Pichia pastoris BG16 strain, and zeocin resistance was achieved through excision of the FRT site. Clones that lost were selected.
  • the strain was named strain CF04-1035.
  • bovine albumin gene was introduced into the Trichoderma reesei PDI expression strain (CF04-1035) and the Pichia pastoris BG16 strain prepared in Example 4, respectively, and the expression level was measured. compared.
  • the amino acid sequence of bovine albumin was the sequence numbers 25 to 607, excluding the signal sequence, from Uniprot ID: P02769, and is the same as SEQ ID NO: 24.
  • bovine albumin protein (SEQ ID NO: 24)
  • the DNA sequence encoding it was codon-optimized, and for cloning, a sequence complementary to the pPICZ ⁇ A vector (InvitrogenTM, catalog number: V19520) sequence was placed 20 bp forward and backward. It was additionally synthesized, and the sequence is the same as SEQ ID NO: 25.
  • Gene fragments were obtained through PCR with Pfu-X DNA Polymerase using the synthesized DNA as a template and primers with base sequences of SEQ ID NO: 26 and SEQ ID NO: 27.
  • a gene fragment to be used as a vector was obtained through PCR using the pPICZ ⁇ A vector as a template and primers having the base sequences of SEQ ID NO: 28 and SEQ ID NO: 29.
  • the two obtained gene fragments were cloned using the Gibson assembly (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) method to obtain a recombinant plasmid.
  • the obtained vector was named pPCIZ ⁇ A-bALBUMIN.
  • the pPCIZ ⁇ A-bALBUMIN vector was introduced and confirmed into the BG16 strain and CF04-1035 strain by the same method as described in Example 2.
  • the strain in which the gene encoding bovine albumin was introduced into the Pichia pastoris BG16 strain was named CF04-1005, and the strain into which the gene encoding bovine albumin was introduced was named CF04-1038.
  • the two strains were cultured and the expression levels of bovine albumin were compared using the same method as described in Example 3-3, and are shown in Figure 5 and Table 2 below.
  • the bovine albumin expression level of the CF04-1038 strain which is a strain expressing Trichoderma reesei PDI
  • the bovine albumin expression level of the CF04-1038 strain is approximately lower than that of the CF04-1005 strain, which is a strain into which Trichoderma reesei PDI was not introduced. It was confirmed to be 1.4 times higher.
  • bovine insulin precursor (bovine insulin precursor ) in the Trichoderma reesei PDI expression strain is excellent
  • bovine insulin precursor Genes encoding bovine insulin precursor
  • the amino acid sequence of the bovine insulin precursor was the 1st to 30th sequence corresponding to the B chain of insulin and the 61st to 81st sequence corresponding to the A chain of Uniprot ID: I7CLV3, with the EPK sequence in front as a spacer.
  • an AAK sequence was added between the B chain and the A chain (Thomas Kjeldsen, 2002, JBC vol 277, issue 21).
  • the sequence is the same as SEQ ID NO: 30.
  • the DNA sequence encoding it was codon-optimized, and for cloning, a sequence complementary to the pPICZ ⁇ A vector sequence was synthesized by adding 20 bp forward and backward. And the sequence is the same as SEQ ID NO: 31.
  • Gene fragments were obtained through PCR using the synthesized DNA as a template and primers with base sequences of SEQ ID NO: 26 and SEQ ID NO: 27. Then, a gene fragment to be used as a vector was obtained through PCR using the pPICZ ⁇ A vector as a template and primers having the base sequences of SEQ ID NO: 28 and SEQ ID NO: 29.
  • the two obtained gene fragments were cloned using the Gibson assembly (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) method to obtain a recombinant plasmid.
  • the obtained vector was named pPCIZ ⁇ A-bPROINSULIN.
  • the pPCIZ ⁇ A-bPROINSULIN vector was introduced and confirmed into the BG16 strain and CF04-1035 strain by the same method as described in Example 2.
  • the strain in which the gene encoding the bovine insulin precursor was introduced into Pichia pastoris BG16 strain was named CF04-1017, and the strain into which CF04-1035 was introduced was named CF04-1040.
  • the bovine insulin precursor expression level of strain CF04-1040 is about 1.5 times higher than that of strain CF04-1017, a strain into which Trichoderma reesei PDI is not introduced. was confirmed.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Endocrinology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Plant Pathology (AREA)
  • Diabetes (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 트리코더마 속 균주 유래 PDI를 이용하여 재조합 단백질을 생산하는 방법에 관한 것으로, 본 발명의 트리코더마 속(genus Trichoderma) 균주 유래 PDI를 암호화하는 유전자를 포함하는 변이 효모는 목적 단백질을 고발현하므로, 이를 이용하여 고수율로 목적하는 재조합 단백질을 생산할 수 있다.

Description

트리코더마 속 균주 유래 PDI를 이용하여 재조합 단백질을 생산하는 방법
관련 출원(들)과의 상호 인용
본 출원은 2022년 12월 15일자 한국 특허 출원 제10-2022-0175628호에 기초한 우선권의 이익을 주장하며, 해당 한국 특허 출원의 문헌들에 개시된 모든 내용은 본 명세서의 일부로서 포함된다.
본 발명은 트리코더마 속 균주 유래 PDI를 이용하여 재조합 단백질을 생산하는 방법에 관한 것이다.
유전자 재조합 단백질 생산을 위해 주로 사용되고 있는 숙주세포로는 대장균(E. coli), 효모(S. cerevisiae), 그리고 동물세포인 CHO 세포 등이 있으며, 이들 중 효모는 대장균과 비교하여 몇 가지 장점을 가지고 있다. 효모는 E. coli와 달리 유전적으로 고등생물과 동일한 진핵세포로서 고등 생물 유래의 유전자와 전사 및 번역 시스템이 유사하고, 스플라이싱(splicing)을 통한 인트론(intron)의 제거가 가능하며, 고등 동물의 골지체와 유사한 분비기관을 갖추고 있어 번역 후 변형(post-translational modification)을 통해 활성화된 단백질을 생산, 분비시킬 수 있다. 또한 효모는 대장균에 비해 유전자 재조합 단백질을 더 효율적으로 세포 밖으로 분비 생산하여 이 단백질의 분리 정제에 도움을 줄 수 있고, 효모에서 단백질을 생산할 때에는 의약용 단백질의 경우에 꼭 제거되어야만 하는 내독소(endotoxin) 등이 대장균과는 다르게 문제가 되지 않는 장점을 가지고 있다. 이러한 효모 중에 대표적으로 사용되고 있는 S. cerevisiae는 1981년 이를 이용하여 유전자 재조합 단백질 생산이 보고된 이래 수많은 연구자들에 의해 활발한 연구가 진행되어 왔다. 그러나, S. cerevisiae에서 높은 발현률을 얻기 위해서는 multi-copy plasmid가 필요하고, 큰 규모의 발효조에서 고농도 세포배양을 할 때 이들 플라스미드의 분포(distribution), 카피 수(copy number), 안정성(stability) 등이 자주 문제가 되며, glycolytic gene 유래의 프로모터들은 대부분 전신-발현 프로모터(constitutive promoter)이므로, 이를 이용하여 단백질 발현을 하는 경우에는 플라스미드를 잃은 세포들이 우세(dominating)할 수 있다는 문제점이 있고, 조절할 수 있는 프로모터들도 정확하게 조절하기 어려운 문제점이 있다. 이러한 문제를 해결하는 대안으로 최근에 통기성 메틸 영양 효모(facultative methylotrophic yeast)인 Pichia pastoris가 주목을 받고 있다. Pichia pastoris는 methylotrophic yeast이고 외래유전자가 chromosomal DNA에 integration될 수 있으며, methanol을 이용하는 pathway 상의 효소들에 대한 프로모터로 AOX1을 이용하는데, 이 프로모터가 매우 강력하다는 장점이 있다.
단백질 디설파이드 이소머라제(protein disulfide isomerase, PDI)는 티올:이황화 결합 교환 반응을 촉매하는 효소로서, 소포체에 머물며 새로이 합성되어 소포체로 들어오는 분비성 단백질에 이황화 결합을 전달시켜 준다. PDI에는 이황화 결합을 전달시켜 주는 활성뿐 아니라 잘못 연결된 이황화 결합을 끊어서 구조적으로 안정한 이황화 결합으로 바꿔주는 이성질화 활성도 지니는 산화/환원(oxidoreductase)이다. PDI가 정상적으로 작동하지 않으면, 기질들은 소포체를 벗어나 골지체나 세포 외부로 분비되지 못하고 분해되어 진다. 따라서, PDI의 활성 정도에 따라 분비성 단백질의 합성 효율이 달라질 수 있다.
이에, PDI를 이용하여 재조합 단백질을 생산하는데 이용하려는 시도가 있어 왔다. 호열성 진균류 PDI를 목적단백질의 아미노-말단에 융합하여 바실러스 브레비스(Bacillus brevis) 균주에서 세포 밖으로 분비시키거나(Kajino, T. et al.(2000) Appl. Environ. Microbiol. 66: 638-642), PDI의 일종인 dsbC를 변종대장균의 산화성 세포질 (cytoplasm)에서 목적단백질과 공동발현(Bessette, P.H. et al.(1999) Proc. Natl. Acad. Sci. USA, 96: 13703-13708) 등이 보고 되었다. 그러나 바실루스 균주에서 세포 밖으로 분비시키는 경우 바실루스 균주가 갖고 있는 단백질 분해효소 분비 등의 문제점 때문에 목적 단백질의 수율이 상당히 낮은 단점을 가지고 있으며, dsbC와 목적단백질을 세포질에서 공동 발현하는 경우 발현율이 낮은 것으로 알려져 있다.
본 출원의 일 예는
1) 하기의 i) 및 ii) 단계를 동시에, 순차로 또는 역순으로 수행하는 단계를 포함하는 변이 효모 제조 단계:
i) 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 벡터를 효모에 도입하는 단계;
ii) 목적 단백질을 코딩하는 유전자를 포함하는 벡터를 효모에 도입하는 단계; 및
2) 상기 1) 단계에서 제조된 변이 효모를 배양하는 단계;
를 포함하는 재조합 단백질 생산 방법을 제공한다.
본 출원의 다른 예는 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 목적 단백질 생산용 변이 효모를 제공한다.
본 출원의 다른 예는 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자 또는 이를 포함하는 재조합 벡터를 포함하는, 변이 효모에서의 목적 단백질 생산용 조성물을 제공한다.
상기 목적을 달성하기 위하여, 본 발명은 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자로 형질전환된 변이 효모 균주 및 이를 이용한 목적 단백질 생산방법을 제공한다.
이하, 본 발명에 대해 더욱 상세히 설명하고자 한다.
본 발명은
1) 하기의 i) 및 ii) 단계를 동시에, 순차로 또는 역순으로 수행하는 단계를 포함하는 변이 효모 제조 단계:
i) 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 벡터를 효모에 도입하는 단계;
ii) 목적 단백질을 코딩하는 유전자를 포함하는 벡터를 효모에 도입하는 단계; 및
2) 상기 1) 단계에서 제조된 변이 효모를 배양하는 단계;
를 포함하는 재조합 단백질 생산 방법을 제공한다.
본 명세서에서 사용되는 용어, “PDI(protein disulfide isomerase)”는 티올:이황화 결합 교환 반응을 촉매하는 효소를 의미하며, “단백질 디설파이드 이소머라제”와 혼용될 수 있다.
상기 1) 단계의 i) 단계의 PDI는 트리코더마 속(genus Trichoderma) 균주 유래 PDI일 수 있고, 바람직하게는 트리코더마 레세이(Trichoderma reesei) 균주 유래 PDI일 수 있다.
본 발명의 일 예에서, 상기 PDI는 서열번호 14의 아미노산 서열을 포함하거나 서열번호 14의 아미노산 서열로 이루어진 것일 수 있으며, PDI와 동일하거나 상응하는 효소 활성을 갖는다면 서열번호 14의 아미노산 서열에서 일부 서열이 결실, 변형, 치환 또는 부가된 아미노산 서열을 갖는 폴리펩티드도 본 출원의 범위 내에 포함될 수 있다. 또한, 미생물의 유래에 상관없이 서열번호 14의 아미노산 서열과 적어도 60% 이상, 70% 이상, 80% 이상, 85% 이상, 90% 이상, 92% 이상, 94% 이상, 96% 이상, 98% 이상, 또는 99% 이상, 99.5% 이상 또는 99.8% 이상의 상동성 또는 동일성을 갖는 폴리펩티드로서, PDI와 동일하거나 상응하는 전환 활성을 갖는 폴리펩티드도 상기 PDI로서 본 출원의 범위 내에 포함될 수 있다.
상기 1) 단계의 i) 단계 및 ii) 단계의 효모는 피키아 속(genus Pichia), 캔디다 속(genus Candida) 및 한세눌라 속(genus Hansenula) 균주로 이루어진 군으로부터 선택되는 어느 하나일 수 있다. 일 예에서, 상기 효모는 피키아 파스토리스(Pichia pastoris)일 수 있고, 더욱 구체적으로, 피키아 파스토리스 (Pichia pastoris) BG16 균주일 수 있으나, 이에 제한되는 것은 아니다.
상기 1) 단계의 ii) 단계의 목적 단백질은 단백질 내에 이황화 결합(disulfide bond)을 포함하는 단백질일 수 있고, 단백질 내에 3개 이상의 이황화 결합을 포함하는 단백질일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 일 예에서, 상기 목적 단백질은 트랜스페린(transferrin), 알부민(albumin) 및 인슐린 전구체(insulin precursor)로 이루어지는 군에서 선택되는 어느 하나 이상일 수 있고, 상기 트랜스페린, 알부민 및 인슐린 전구체는 소(bovine)로부터 유래된 단백질일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서 용어, “트랜스페린”은 혈청 트랜스페린을 의미할 수 있으며, 무혈청배지(Serum free media, FBS free media) 등에서 혈청(FBS, fetal bovine serum)을 대체하는 인자 중 하나로 활용될 수 있다. 일 예에서, 상기 트랜스페린은 하기의 서열번호 6의 아미노산 서열을 포함하거나, 서열번호 6의 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.
[서열번호 6] Bovine Transferrin (N495Q는 진한 부분으로 표시)
DPERTVRWCTISTHEANKCASFRENVLRILESGPFVSCVKKTSHMDCIKAISNNEADAVTLDGGLVYEAGLKPNNLKPVVAEFHGTKDNPQTHYYAVAVVKKDTDFKLNELRGKKSCHTGLGRSAGWNIPMGKLYKELPDPQESIQRAAANFFSASCVPCADQSSFPKLCQLCAGKGTDKCACSNHEPYFGYSGAFKCLMEGAGDVAFVKHSTVFDNLPNPEDRKNYELLCGDNTRKSVDDYQECYLAMVPSHAVVARTVGGKEDVIWELLNHAQEHFGKDKPDNFQLFQSPHGKDLLFKDSADGFLKIPSKMDFELYLGYEYVTALQNLRESKPPDSSKDECMVKWCAIGHQERTKCDRWSGFSGGAIECETAENTEECIAKIMKGEADAMSLDGGYLYIAGKCGLVPVLAENYKTEGESCKNTPEKGYLAVAVVKTSDANINWNNLKDKKSCHTAVDRTAGWNIPMGLLYSKINNCKFDEFFSAGCAPGSPRQSSLCALCIGSEKGTGKECVPNSNERYYGYTGAFRCLVEKGDVAFVKDQTVIQNTDGNNNEAWAKNLKKENFEVLCKDGTRKPVTDAENCHLARGPNHAVVSRKDKATCVEKILNKQQDDFGKSVTDCTSNFCLFQSNSKDLLFRDDTKCLASIAKKTYDSYLGDDYVRAMTNLRQCSTSKLLEACTFHKP
본 명세서에서 용어, “알부민”은 혈청 알부민을 의미할 수 있으며, 무혈청배지 등에서 혈청을 대체하는 인자 중 하나로 이용될 수 있다. 일 예에서, 상기 알부민은 하기의 서열번호 24의 아미노산 서열을 포함하거나, 서열번호 24의 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.
[서열번호 24]
DTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKECCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRRHPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVVSTQTALA
본 명세서에서 용어, “인슐린 전구체”는 무혈청배지 등에서 혈청을 대체하는 인자 중 하나로 이용될 수 있다. 일 예에서, 상기 인슐린 전구체는 하기의 서열번호 30의 아미노산 서열을 포함하거나, 서열번호 30의 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.
[서열번호 30] Spacer 서열은 밑줄로 표시
EPKFVNQHLCGSHLVEALYLVCGERGFFYTPKAAAKGIVEQCCASVCSLYQLENYCN
본 명세서에서 용어, “벡터"는 적합한 숙주 내에서 트리코더마 속(genus Trichoderma) 균주 유래 PDI를 코딩하는 폴리뉴클레오티드 또는 목적 단백질을 코딩하는 폴리뉴클레오티드를 발현시킬 수 있도록 적합한 발현조절영역(또는 발현조절서열)에 작동 가능하게 연결된 상기 폴리뉴클레오티드의 염기서열을 포함하는 DNA 제조물을 포함할 수 있다. 상기 발현조절영역은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함할 수 있다. 벡터는 적당한 숙주세포 내로 형질전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 출원에서 사용되는 벡터는 특별히 한정되지 않으며, 당업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, MBL3, MBL4, IXII, ASHII, APII, t10, t11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pDZ계, pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 구체적으로는 pDZ, pDC, pDCM2, pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pPICZαA 벡터 등을 사용할 수 있다.
일례로 세포 내 염색체 삽입용 벡터를 통해 트리코더마 속(genus Trichoderma) 균주 유래 PDI 또는 목적 단백질을 코딩하는 폴리뉴클레오티드를 염색체 내로 삽입할 수 있다. 상기 폴리뉴클레오티드의 염색체 내로의 삽입은 당업계에 알려진 임의의 방법, 예를 들면, 상동 재조합(homologous recombination)에 의하여 이루어질 수 있으나, 이에 한정되지는 않는다. 상기 염색체 삽입 여부를 확인하기 위한 선별 마커(selection marker)를 추가로 포함할 수 있다. 상기 선별 마커는 벡터로 형질전환된 세포를 선별, 즉 목적 핵산 분자의 삽입 여부를 확인하기 위한 것으로, 약물 내성, 영양 요구성, 세포 독성제에 대한 내성 또는 표면 폴리펩티드의 발현과 같은 선택가능 표현형을 부여하는 마커들이 사용될 수 있다. 선택제(selective agent)가 처리된 환경에서는 선별 마커를 발현하는 세포만 생존하거나 다른 표현 형질을 나타내므로, 형질전환된 세포를 선별할 수 있다.
본 출원에서 용어 "형질전환"은 특정 폴리뉴클레오티드를 포함하는 벡터를 숙주세포 혹은 미생물 내에 도입하여 숙주세포 내에서 상기 폴리뉴클레오티드가 코딩하는 폴리펩티드가 발현할 수 있도록 하는 것을 의미한다. 형질전환된 폴리뉴클레오티드는 숙주세포 내에서 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하거나 상관없이 이들 모두를 포함할 수 있다. 또한, 상기 폴리뉴클레오티드는 목적 폴리펩티드를 코딩하는 DNA 및/또는 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로도 도입될 수 있다. 예를 들면, 상기 폴리뉴클레오티드는 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트(expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결신호, 리보좀 결합부위 및 번역 종결신호를 포함할 수 있다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있으며, 이에 제한되지 않는다.
또한, 상기에서 용어 "작동 가능하게 연결"된 것이란 본 출원의 트리코더마 속(genus Trichoderma) 균주 유래 PDI 또는 목적 단백질을 코딩하는 폴리뉴클레오티드의 전사를 개시 및 매개하도록 하는 프로모터 서열과 상기 폴리뉴클레오티드 서열이 기능적으로 연결되어 있는 것을 의미한다.
본 명세서에서 용어, "배양"은 본 출원의 변이 효모를 적당히 조절된 환경 조건에서 생육시키는 것을 의미한다. 본 출원의 배양과정은 당업계에 알려진 적당한 배지와 배양조건에 따라 이루어질 수 있다. 이러한 배양 과정은 선택되는 균주에 따라 당업자가 용이하게 조정하여 사용할 수 있다. 구체적으로 상기 배양은 회분식, 연속식 및/또는 유가식일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서 용어, "배지"는 본 출원의 변이 효모를 배양하기 위해 필요로 하는 영양물질을 주성분으로 혼합한 물질을 의미하며, 생존 및 발육에 불가결한 물을 비롯하여 영양물질 및 발육인자 등을 공급한다. 구체적으로, 본 출원의 변이 효모의 배양에 사용되는 배지 및 기타 배양 조건은 통상의 미생물의 배양에 사용되는 배지라면 특별한 제한 없이 어느 것이나 사용할 수 있으나, 본 출원의 변이 효모를 적당한 탄소원, 질소원, 인원, 무기화합물, 아미노산 및/또는 비타민 등을 함유한 통상의 배지 내에서 호기성 조건 하에서 온도, pH 등을 조절하면서 배양할 수 있다. 구체적으로, 효모에 대한 배양 배지는 문헌["Yeast", Current Protocols in Molecular Biology, 2017], ["Pichia Protocols", Methods in Molecular Biology, 2007] 등에서 찾아볼 수 있다.
상기 탄소원으로는 글루코오스, 사카로오스, 락토오스, 프룩토오스, 수크로오스, 말토오스 등과 같은 탄수화물; 만니톨, 소르비톨 등과 같은 당 알코올, 피루브산, 락트산, 시트르산 등과 같은 유기산; 글루탐산, 메티오닌, 리신 등과 같은 아미노산; 메탄올 또는 에탄올 등이 포함될 수 있다. 또한, 전분 가수분해물, 당밀, 블랙스트랩 당밀, 쌀겨울, 카사버, 사탕수수 찌꺼기 및 옥수수 침지액 같은 천연의 유기 영양원을 사용할 수 있으며, 구체적으로는 글루코오스 및 살균된 전처리 당밀(즉, 환원당으로 전환된 당밀) 등과 같은 탄수화물이 사용될 수 있으며, 그 외의 적정량의 탄소원을 제한 없이 다양하게 이용할 수 있다. 이들 탄소원은 단독으로 사용되거나 2 종 이상이 조합되어 사용될 수 있으며, 이에 한정되는 것은 아니다.
상기 질소원으로는 암모니아, 황산암모늄, 염화암모늄, 초산암모늄, 인산암모늄, 탄산안모늄, 질산암모늄 등과 같은 무기질소원; 글루탐산, 메티오닌, 글루타민 등과 같은 아미노산, 펩톤, NZ-아민, 육류 추출물, 효모 추출물, 맥아 추출물, 옥수수 침지액, 카세인 가수분해물, 어류 또는 그의 분해생성물, 탈지 대두 케이크 또는 그의 분해 생성물 등과 같은 유기 질소원이 사용될 수 있다. 이들 질소원은 단독으로 사용되거나 2 종 이상이 조합되어 사용될 수 있으며, 이에 한정되는 것은 아니다.
상기 인원으로는 인산 제1칼륨, 인산 제2칼륨, 또는 이에 대응되는 소디움-함유 염 등이 포함될 수 있다. 무기화합물로는 염화나트륨, 염화칼슘, 염화철, 황산마그네슘, 황산철, 황산망간, 탄산칼슘 등이 사용될 수 있으며, 그 외에 아미노산, 비타민 및/또는 적절한 전구체 등이 포함될 수 있다. 이들 구성성분 또는 전구체는 배지에 회분식 또는 연속식으로 첨가될 수 있다. 그러나, 이에 한정되는 것은 아니다.
또한, 본 출원의 변이 효모의 배양 중에 수산화암모늄, 수산화칼륨, 암모니아, 인산, 황산 등과 같은 화합물을 배지에 적절한 방식으로 첨가하여, 배지의 pH를 조정할 수 있다. 또한, 배양 중에는 지방산 폴리글리콜 에스테르와 같은 소포제를 사용하여 기포 생성을 억제할 수 있다. 또한, 배지의 호기 상태를 유지하기 위하여, 배지 내로 산소 또는 산소 함유 기체를 주입하거나 혐기 및 미호기 상태를 유지하기 위해 기체의 주입 없이 혹은 질소, 수소 또는 이산화탄소 가스를 주입할 수 있으며, 이에 한정되는 것은 아니다.
본 발명의 배양 단계에서 배양온도는 20 내지 45℃, 구체적으로는 25 내지 40℃ 를 유지할 수 있고, 약 10 내지 160 시간 동안 배양할 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 배양에 의하여 생산된 재조합 단백질은 배지 중으로 분비되거나 세포 내에 잔류할 수 있다.
본 발명의 재조합 단백질 생산 방법은, 본 발명의 변이 효모를 제조하는 단계, 상기 변이 효모를 배양하기 위한 배지를 준비하는 단계, 또는 이들의 조합(순서에 무관, in any order)을, 예를 들어, 상기 배양하는 단계 이전에, 추가로 포함할 수 있다.
본 발명의 재조합 단백질 생산 방법은, 상기 배양에 따른 배지(배양이 수행된 배지) 또는 상기 변이 효모로부터 재조합 단백질을 회수하는 단계를 추가로 포함할 수 있다. 상기 회수하는 단계는 상기 배양하는 단계 이후에 추가로 포함될 수 있다.
상기 회수는 본 발명의 변이 효모의 배양 방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 기술 분야에 공지된 적합한 방법을 이용하여 목적하는 단백질을 수집(collect)하는 것일 수 있다. 예를 들어, 원심분리, 여과, 결정화 단백질 침전제에 의한 처리(염석법), 추출, 초음파 파쇄, 한외여과, 투석법, 분자체 크로마토그래피(겔여과), 흡착크로마토그래피, 이온교환 크로마토그래피, 친화도 크로마토그래피 등의 각종 크로마토그래피, HPLC 또는 이들의 방법을 조합하여 사용될 수 있으며, 당해 분야에 공지된 적합한 방법을 이용하여 배지 또는 변이 효모로부터 목적하는 단백질을 회수할 수 있다.
또한, 본 발명의 재조합 단백질 생산 방법은, 추가적으로 정제 단계를 포함할 수 있다. 상기 정제는 당해 기술분야에 공지된 적합한 방법을 이용하여, 수행할 수 있다. 일 예에서, 본 출원의 재조합 단백질 생산방법이 회수 단계와 정제 단계를 모두 포함하는 경우, 상기 회수 단계와 정제 단계는 순서에 상관없이 이시적(또는 연속적)으로 수행되거나, 동시에 또는 하나의 단계로 통합되어 수행될 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 목적 단백질 생산용 변이 효모를 제공한다.
상기 트리코더마 속 균주 유래 PDI, 목적 단백질, 효모와 관련해서는 전술한 바와 같다.
상기 변이 효모는 트리코더마 속 균주 유래 PDI를 암호화하는 유전자가 효모 유전체(genome) 내에 삽입 또는 통합된 것일 수 있고, 트리코더마 속 균주 유래 PDI를 암호화하는 유전자가 효모 유전체(genome) 외에 존재하는 것일 수 있다.
상기 변이 효모는 이종의 트리코더마 속 균주 유래 PDI를 암호화하는 유전자가 도입되어, 도입되지 않은 효모 보다 목적 단백질 생산성이 증가된 것일 수 있다.
일 예로, 상기 목적 단백질 생산성이 증가된 변이 효모는 변이 전 모균주 또는 비변형 미생물의 목적 단백질 생산능에 비해 약 1% 이상, 약 5% 이상, 약 10% 이상, 약 15% 이상, 약 20% 이상, 약 25% 이상, 약 26% 이상, 약 27% 이상, 약 28% 이상, 약 29% 이상, 약 30% 이상, 약 31% 이상, 약 32% 이상, 약 33% 이상, 약 34% 이상, 약 35% 이상, 약 36% 이상, 약 37% 이상, 약 38% 이상, 약 39% 이상, 약 40% 이상, 약 41% 이상, 약 42% 이상, 약 43% 이상, 약 44% 이상, 약 45% 이상, 약 46% 이상, 약 47% 이상, 약 48% 이상, 약 49% 이상, 약 50% 이상(상한값은 특별한 제한은 없으며, 예컨대, 약 200% 이하, 약 150% 이하, 약 100% 이하, 또는 약 50% 이하일 수 있음) 증가된 것일 수 있다.
다른 예에서, 상기 생산성이 증가된 변이 효모는 변이 전 모균주 또는 비변형 미생물에 비하여, 목적 단백질 생산성(또는 생산능, 또는 생산량)이 약 1.1배 이상, 약 1.12배 이상, 약 1.13배 이상, 1.15배 이상, 1.16배 이상, 1.17배 이상, 1.18배 이상, 1.19배 이상, 약 1.2 배 이상, 1.25배 이상, 약 1.3배 이상, 약 1.4배 이상, 또는 약 1.5배 이상(상한값은 특별한 제한은 없으며, 예컨대, 약 10배 이하, 약 5배 이하, 약 3배 이하, 또는 약 2배 이하일 수 있음) 증가된 것일 수 있으나, 이에 제한되지 않는다. 상기 용어 “약(about)”은 ±0.5, ±0.4, ±0.3, ±0.2, ±0.1 등을 모두 포함하는 범위로, 약 이란 용어 뒤에 나오는 수치와 동등하거나 유사한 범위의 수치를 모두 포함하나, 이에 제한되지 않는다.
본 명세서에서 용어, "비변형 미생물"은 미생물에 자연적으로 발생할 수 있는 돌연변이를 포함하는 균주를 제외하는 것이 아니며, 야생형 균주 또는 천연형 균주 자체이거나, 자연적 또는 인위적 요인에 의한 유전적 변이로 형질이 변화되기 전 균주를 의미할 수 있다. 예를 들어, 상기 비변형 미생물은 본 명세서에 기재된 트리코더마 속 균주 유래 PDI를 암호화하는 유전자가 도입되지 않거나 도입되기 전의 균주를 의미할 수 있다. 상기 "비변형 미생물"은 “변형 전 균주”, “변형 전 미생물”, “비변이 균주”, “비변형 균주”, “비변이 미생물” 또는 “기준 미생물”과 혼용될 수 있다. 일 예에서, 상기 “비변형 미생물”은 피키아 파스토리스 (Pichia pastoris) 균주일 수 있고, 더욱 구체적으로, 피키아 파스토리스 (Pichia pastoris) BG16 균주일 수 있으나, 이에 제한되는 것은 아니다.
또한, 본 발명은 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자 또는 이를 포함하는 재조합 벡터를 포함하는, 변이 효모에서의 목적 단백질 생산용 조성물을 제공한다.
상기 트리코더마 속 균주 유래 PDI, 목적 단백질, 효모와 관련해서는 전술한 바와 같다.
일 예에서, 상기 생산용 조성물은 목적 단백질 생산용 조성물에 통상 사용되는 임의의 적합한 부형제를 추가로 포함할 수 있으며, 이러한 부형제는, 예를 들어 보존제, 습윤제, 분산제, 현탁화제, 완충제, 안정화제 또는 등장화제 등일 수 있으나, 이에 한정되는 것은 아니다.
또한, 본 발명은 상기 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 폴리뉴클레오티드, 및/또는 상기 폴리뉴클레오티드를 포함하는 재조합 벡터를 미생물에 도입(예를 들면, 형질전환)시키는 단계를 포함하는, 상기 미생물의 목적 단백질 생산성 증가 방법 또는 상기 미생물에 목적 단백질 생산능을 부여하는 방법을 제공한다.
본 발명의 트리코더마 속(genus Trichoderma) 균주 유래 PDI를 암호화하는 유전자를 포함하는 변이 효모는 목적 단백질을 고발현하므로, 이를 이용하여 고수율로 목적하는 재조합 단백질을 생산할 수 있다.
도 1은 pPICZFRT 재조합 플라스미드의 개략도를 나타낸 도이다.
도 2는 pPICZFRT-bTRANSFERRIN(N495Q) 재조합 플라스미드의 개략도를 나타낸 도이다.
도 3은 Pichia pastoris PDI 도입 균주(CF04-1024), Ogataea angusta PDI 도입 균주(CF04-1025) 및 Trichoderma ressei PDI 도입 균주(CF04-1026) 별 배양 상등액의 트랜스페린 발현량을 비교하기 위한 SDS-PAGE 결과를 나타낸 도이다.
도 4는 pPICZFRT-PDI(TR) 재조합 플라스미드의 개략도를 나타낸 도이다.
도 5는 소 알부민(bovine albumin)을 암호화하는 유전자를 Pichia pastoris BG16 균주에 도입한 균주(CF04-1005) 및 CF04-1035에 도입한 균주(CF04-1038) 별 배양 상등액의 알부민 발현량을 비교하기 위한 SDS-PAGE 결과를 나타낸 도이다.
도 6은 소 인슐린 전구체(bovine insulin precursor)를 암호화하는 유전자를 Pichia pastoris BG16 균주에 도입한 균주(CF04-1017) 및 CF04-1035에 도입한 균주(CF04-1040) 별 배양 상등액의 인슐린 전구체 발현량을 비교하기 위한 SDS-PAGE 결과를 나타낸 도이다.
이하 본 발명을 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 하나 이상의 구체예를 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1. pPICZFRT 플라스미드의 제조
Pichia pastoris의 형질 전환을 위한 벡터를 하기와 같은 방법으로 제조하였다.
FRT 부위, 클로닝을 위한 제한효소 인식부위, Rhamnose 유도 조건 하에 발현되는 LRA3 (L-rhamnonate dehydratase) 프로모터, Flp 재조합 효소로 구성되는 DNA(서열번호 1)를 합성하여 pPICZαA 벡터(Invitrogen™, 카탈로그번호: V19520)의 1341 ~ 3593 bp 영역을 연결하였다. 이러한 유전자 조작을 위해서 합성한 서열번호 1의 DNA를 주형으로 하여 서열번호 2와 서열번호 3의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 서열번호 1의 영역을 증폭하였다. pPICZαA 벡터의 1341 ~ 3593 bp 영역은 pPICZαA 벡터 DNA를 주형으로 하여 서열번호 4와 서열번호 5의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 증폭하였다. PCR 반응은 Pfu-X DNA Polymerase(Solg™, 카탈로그번호: SPX16-R500)을 이용하였으며, 제조사의 프로토콜을 따랐다. 증폭한 두 단편을 깁슨 어셈블리 (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝함으로써 재조합 플라스미드를 획득하였으며, pPICZFRT로 명명하였다(도 1 참조).
실시예 2. 비당화형 Bovine transferrin 발현 Pichia pastoris 균주 제조
소 트랜스페린(Bovine transferrin)의 아미노산 서열은 NCBI reference sequence ID: NP_803450.2에서 signal 서열을 제외한 19~704번 서열을 사용하였다. 이 서열에서 glycosylation을 제거하기 위해 495번째 N(asparagine)을 Q(glutamine)로 치환하여 비당화 형태로 사용하였으며, 비당화형 소 트랜스페린의 아미노산 서열은 서열번호 6과 같다.
Pichia pastoris에서 서열번호 6의 아미노산 서열을 갖는 단백질을 발현하기 위해 DNA의 코돈을 최적화하였다. DNA 코돈 최적화된 염기 서열은 서열번호 7과 같다.
서열번호 7의 염기서열 앞 쪽에는 메탄올 유도 발현을 위한 AOX1 프로모터를, 이어서 분비 발현을 위한 alpha mating factor 서열을 연결하였고, 뒤 쪽에는 AOX1 전사 종료자를 연결하여 유전자 합성을 통해 DNA 단편을 제작하였다. 제작한 단편을 서열번호 8과 서열번호 9를 갖는 프라이머를 이용하여 Pfu-X DNA Polymerase를 사용하여 PCR 반응을 통해 증폭하고, pPICZFRT를 KpnI-HF(NEB, 카탈로그번호: R3142), NotI-HF (NEB, 카탈로그번호: R3189)를 이용하여 절단하였다. 이렇게 얻은 두 단편을 깁슨 어셈블리 (DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝함으로써 재조합 플라스미드를 획득하였으며, pPICZFRT-bTRANSFERRIN(N495Q)로 명명하였다(도 2 참조).
Pichia pastoris 균주에 pPICZFRT-bTRANSFERRIN(N495Q) 벡터를 도입하여 형질전환하기 위해서 AOX1 프로모터 부위를 PmeI(NEB, 카탈로그번호: R0560S)을 사용하여 선형화하였다. 이 후, 선형화한 벡터를 Expin™ PCR SV kit (GeneAll, 카탈로그번호: 103-102)를 사용하여 정제하였다. Pichia pastoris 균주는 ATUM 社에서 구매한 PPS-9016 [Pichia pastoris BG16 (pep4△, prb1△, protease deficient)] 균주를 사용하였다. Pichia pastoris BG16에 ATUM社의 메뉴얼에 따라 선형화된 pPICZFRT-bTRANSFERRIN(N495Q) 벡터를 전기천공법으로 도입하여 형질전환하였다. 형질전환 균주는 zeocin (250 ug/mL) 항생제(Gibco™, 카탈로그번호: R25001)의 내성 여부에 따라 YPDS 한천배지(Yeast extract 10 g/L, peptone 20 g/L, sorbitol 182.2 g/L, bacto agar 20 g/L)에서 선별하였다. 게놈 내의 AOX1 프로모터 위치에 통합 여부는 게놈의 AOX1 프로모터의 21 bp 앞부분에 결합하는 전방 프라이머(서열번호 10)와 벡터의 Rhamnose 프로모터에 결합하는 후방 프라이머(서열번호 11)로 확인하였다. PCR 반응은 Phire Plant Direct PCR Kit (Thermo Scientific™, 카탈로그번호: F130WH)를 사용하였으며 제조사의 프로토콜을 따랐다.
형질 전환 여부를 PCR을 통해 확인한 클론을 YP(yeast extract 10 g/L, peptone 20 g/L) + 1% 람노스(rhamnose) 액상 배지 1 mL에 접종하여 30℃, 200 rpm에서 24시간 동안 배양하였다. 람노스에 의해 발현이 유도된 Flp 재조합효소가 FRT 부위를 인식하여 FRT 영역의 삭제가 일어난 클론을 선별하기 위해 YPD 한천배지(Yeast extract 10 g/L, peptone 20 g/L, bacto agar 20 g/L)에 스트리킹하여 30℃에서 72시간 동안 배양하였다. 단일 콜로니들을 YPD 한천배지와 YPDS + zeocin 한천배지에 각각 스트리킹하여 FRT 영역의 삭제가 일어나 zeocin 내성을 잃은 콜로니를 선별하였다. 선별한 균주를 CF04-1023으로 명명하였다.
실시예 3. 다양한 균주 유래 PDI orthologue가 도입된 Pichia pastoris 균주 제조 및 소 트랜스페린 발현 확인
실시예 3-1. 다양한 균주 유래 PDI 도입을 위한 벡터의 제조
상기 실시예 2에서 제조한 소 트랜스페린(bovine transferrin) 발현 균주인 CF04-1023 균주에 다양한 균주 유래 PDI를 도입하여 소 트랜스페린 발현에 미치는 영향을 확인하기 위하여, 하기의 방법으로 다양한 균주 유래 PDI가 도입된 벡터를 제조하였다.
PDI orthologue는 Pichia pastoris의 PDI 아미노산 서열(서열번호 12)의 NCBI BlastP를 기초로, 서열번호 12의 아미노산 서열과 상동성 54.63%인 Ogataea angusta의 PDI(서열번호 13)와 상동성 44.20%의 Trichoderma reesei의 PDI(서열번호 14)를 테스트 후보로 선정하였다.
구체적으로, Pichia pastoris에서의 발현을 위해 Pichia pastoris PDI는 gDNA로부터 서열번호 15와 서열번호 16의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 유전자 단편을 획득하였다. Ogataea angusta PDI와 Trichoderma reesei PDI 서열은 서열번호 17, 서열번호 18과 같다. 각각의 서열은 클로닝을 위해 pPICZαA vector(Invitrogen™, 카탈로그번호: V19020) 서열과 상보적인 서열을 앞, 뒤로 20bp씩 추가하여 합성하였다. 합성한 각각의 DNA를 주형으로 서열번호 19와 서열번호 20의 염기서열을 갖는 프라이머로 Pfu-X DNA Polymerase를 이용하여 PCR을 통해 각각의 유전자 단편을 획득하였다. 획득한 각각의 유전자 단편을 EcoRI-HF (NEB, 카탈로그번호: R3101S)으로 선형화한 pPICZA 벡터와 깁슨 어셈블리(DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝하여 재조합 플라스미드를 획득하였다. Pichia pastoris PDI가 도입된 벡터는 pPICZA-PDI(PP), Ogataea angusta PDI가 도입된 벡터는 pPICZA-PDI(OA), Trichoderma reesei PDI가 도입된 벡터는 pPCIZA-PDI(TR)으로 각각 명명하였다.
실시예 3-2. 다양한 균주 유래 PDI가 도입된 Pichia pastoris 균주 제조
상기 실시예 2에서 제조한 소 트랜스페린(bovine transferrin) 발현 Pichia pastoris BG16 균주인 CF04-1023 균주에 상기 실시예 3-1에서 제조한 pPICZA-PDI(PP), pPICZA-PDI(OA), pPICZA-PDI(TR) 벡터를 각각 도입하기 위하여 하기와 같이 형질전환하여 다양한 균주 유래 PDI가 도입된 균주를 제조하였다.
구체적으로, 각각의 벡터의 AOX1 프로모터 부위를 PmeI (NEB, 카탈로그번호: R0560S)을 사용하여 선형화하였다. 이 후, 각각의 선형화한 벡터를 Expin™ PCR SV kit (GeneAll, 카탈로그번호: 103-102)를 사용하여 정제하였다. 각각의 선형화한 벡터를 ATUM社의 메뉴얼에 따라 전기천공법으로 CF04-1023 균주에 도입하였고, 형질전환 균주는 zeocin (250 ug/mL) 항생제의 내성 여부에 따라 YPDS 한천배지에서 선별하였다. 게놈 내의 AOX1 프로모터 위치에 통합 여부는 게놈의 AOX1 프로모터의 21 bp 앞부분에 결합하는 전방 프라이머(서열번호 10)와 벡터의 TEF1 프로모터에 결합하는 후방 프라이머(서열번호 21)로 확인하였다. PCR 반응은 Phire Plant Direct PCR Kit를 사용하였으며 제조사의 프로토콜을 따랐다. 상기 선별한 균주에 대하여 Pichia pastoris PDI 도입 균주는 CF04-1024, Ogataea angusta PDI 도입 균주는 CF04-1025, Trichoderma ressei PDI 도입 균주는 CF04-1026으로 각각 명명하였다.
실시예 3-3. Pichia pastoris 균주에 도입된 다양한 균주 유래 PDI 별 소 트랜스페린 발현량 확인
Pichia pastoris 균주에 도입된 다양한 균주 유래 PDI 별 소 트랜스페린 발현량 확인하기 위하여, 상기 실시예 3-2에서 제조한 균주 4종(CF04-1023, 1024, 1025, 1026)을 배양하여 소 트랜스페린(Bovine Transferrin)의 발현을 확인하였다.
균주의 배양은 BMMY 액상 배지(1% Yeast extract, 2 % Peptone, 13.4 g/l Yeast Nitrogen Base(without amino acids), 100 mM Potassium Phosphate pH 6.0, 0.004 mg/l Biotin, 1% Methanol) 25 ml을 250 ml Baffled Erlenmeyer Flask를 이용하여 30℃, 200 rpm으로 96시간 동안 배양하였으며, 매 24시간 마다 1% 농도의 메탄올(Methanol)을 추가 공급하여 AOX1 프로모터 조절 하의 단백질이 지속적으로 발현되도록 유도하였다. 발효 종료 이후 배양 상등액의 분석을 통해 발현 여부를 확인하였다. 원심분리를 통해 효모 균체를 가라 앉힌 배양 상등액을 SDS-PAGE (Laemmli, 1970) 방법을 통해 4-20% Tris-glycine polyacrylamide gel을 이용해 분리하였으며, DIRECTBLUE™ gel staining solution (SCGBIOMAX, 카탈로그번호: BDS-1000)을 사용하여 염색하였다. 겔(gel) 상의 트랜스페린(transferrin)에 해당하는 밴드(band)의 농도 비교는 Calibrated Densitometer (BIO-RAD, GS-900)를 사용하여 분석하였다. 또한 해당 크기의 밴드가 트랜스페린이 맞는지 추가적인 확인을 위해 in gel digestion (Rosenfeld, 1992) 방법을 이용하여 LC-MS/MS 분석으로 확인하였다. 트랜스페린 발현 SDS-PAGE 결과는 도 3에 나타내었고, 트랜스페린 발현량 비교 결과는 하기의 표 1에 나타내었다.
번호 균주 번호 도입 형질 발현량 (O.D)
1 CF04-1023 Transferrin(N495Q) 0
2 CF04-1025 Transferrin(N495Q),
Ogataea angusta PDI		 255.49
3 CF04-1024 Transferrin(N495Q),
Pichia pastoris PDI		 319.28
4 CF04-1026 Transferrin(N495Q),
Trichoderma reesei PDI		 402.2
그 결과, 도 3 및 표 1에 나타난 바와 같이, PDI가 추가로 도입되지 않은 균주 (CF04-1023)는 소 트랜스페린(bovine transferrin)을 발현하지 않았고, PDI가 추가로 도입된 균주들에서만 소 트랜스페린이 발현됨을 확인하였다. 또한, Ogataea angusta PDI와 Pichia pastoris PDI가 도입된 균주에 비해 Trichoderma reesei PDI가 도입된 균주인 CF04-1026 균주의 소 트랜스페린 발현량이 가장 우수하였으며, Pichia pastoris PDI가 도입된 균주에 비해 발현량이 약 1.3배로 월등히 높음을 확인하였다.
실시예 4. Trichoderma reesei PDI 발현 균주 제조
상기 실시예 3-3에서 Trichoderma reesei PDI가 도입된 비당화형 소 트랜스페린 발현 Pichia pastoris 균주의 소 트랜스페린 발현량이 가장 우수함을 확인하였으므로, Trichoderma reesei PDI를 발현하는 Pichia pastoris 균주를 하기와 같은 방법으로 제조하였다.
pPCIZA-PDI(TR)을 주형으로 서열번호 22와 서열번호 23의 염기서열을 갖는 프라이머를 이용하여 Pfu-X DNA Polymerase로 PCR을 통해 AOX1 프로모터-Trichoderma reesei PDI-AOX1 terminator로 구성되는 DNA 단편을 획득하였다. pPICZFRT를 KpnI-HF, NotI-HF를 이용하여 절단한 뒤, 두 단편을 깁슨 어셈블리(DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝함으로써 재조합 플라스미드를 획득하였으며, pPICZFRT-PDI(TR)로 명명하였다(도 4 참조). pPICZFRT-PDI(TR) 벡터를 실시예 2에 기재된 방법과 동일한 방법을 통해 Pichia pastoris BG16 균주에 도입하여 최종적으로 Trichoderma reesei PDI가 Pichia pastoris BG16 균주 게놈 상에 통합되었으며, FRT 부위의 절제를 통해 zeocin 내성을 잃은 클론을 선별하였다. 해당 균주는 CF04-1035 균주로 명명하였다.
실시예 5. Trichoderma reesei PDI 발현 균주에서 소 알부민(bovine albumin) 발현 확인
소 트랜스페린 외 다른 종류의 단백질 발현량이 우수한지 확인하기 위하여 실시예 4에서 제조한 Trichoderma reesei PDI 발현 균주(CF04-1035)와 Pichia pastoris BG16 균주에 소 알부민(bovine albumin) 유전자를 각각 도입하여 발현량을 비교하였다. 소 알부민(bovine albumin)의 아미노산 서열은 Uniprot ID: P02769에서 signal 서열을 제외한 25~607번 서열을 사용하였으며, 서열번호 24와 같다.
소 알부민 단백질(서열번호 24)을 분비 발현하기 위해, 이를 암호화하는 DNA 서열을 코돈 최적화하였고, 클로닝을 위해 pPICZαA vector (Invitrogen™, 카탈로그번호: V19520) 서열과 상보적인 서열을 앞, 뒤로 20 bp씩 추가하여 합성하였으며, 그 서열은 서열번호 25와 같다. 합성한 DNA를 주형으로 서열번호 26과 서열번호 27의 염기서열을 갖는 프라이머를 이용하여 Pfu-X DNA Polymerase로 PCR을 통해 유전자 단편을 획득하였다. 그리고 pPICZαA 벡터를 주형으로 서열번호 28과 서열번호 29의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 벡터로 사용할 유전자 단편을 획득하였다. 획득한 두 유전자 단편을 깁슨 어셈블리(DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝하여 재조합 플라스미드를 획득하였다. 획득한 벡터는 pPCIZαA-bALBUMIN으로 명명하였다. pPCIZαA-bALBUMIN 벡터를 BG16 균주와 CF04-1035 균주에 실시예 2에 기재된 방법과 동일한 방법으로 각각 도입 및 확인을 진행하였다. 소 알부민(bovine albumin)을 암호화하는 유전자를 Pichia pastoris BG16 균주에 도입한 균주를 CF04-1005, CF04-1035에 도입한 균주를 CF04-1038으로 명명하였다.
상기 두 균주를 배양하여 실시예 3-3에 기재된 방법과 동일한 방법으로 소 알부민(bovine albumin)의 발현량을 비교하여 도 5 및 하기의 표 2에 나타내었다.
번호 균주 번호 도입 형질 발현량 (O.D)
1 CF04-1005 Albumin 435.75
2 CF04-1038 Albumin
Trichoderma reesei PDI		 617.33
그 결과, 도 5 및 표 2에 나타난 바와 같이, Trichoderma reesei PDI를 발현하는 균주인 CF04-1038 균주의 소 알부민(bovine albumin) 발현량이 Trichoderma reesei PDI가 도입되지 않은 균주인 CF04-1005 균주에 비해 약 1.4배 높음을 확인하였다.
실시예 6. Trichoderma reesei PDI 발현 균주에서 소 인슐린 전구체 (bovine insulin precursor) 발현 확인
Trichoderma reesei PDI 발현 균주에서 소 인슐린 전구체 (bovine insulin precursor) 발현이 우수한지 여부를 확인하기 위하여, 실시예 4에서 제조한 Trichoderma reesei PDI 발현 균주(CF04-1035)와 Pichia pastoris BG16 균주에 소 인슐린 전구체(bovine insulin precursor)를 암호화하는 유전자를 각각 도입하여 발현량을 비교하였다. 소 인슐린 전구체(bovine insulin precursor)의 아미노산 서열은 Uniprot ID: I7CLV3에서 Insulin의 B chain에 해당하는 1~30번째 서열과 A chain에 해당하는 61~81번째 서열을 사용하였으며, spacer로 앞쪽에 EPK 서열을, B chain과 A chain 사이에 AAK 서열을 추가하였다(Thomas Kjeldsen, 2002, JBC vol 277, issue 21). 그 서열은 서열번호 30과 같다.
소 인슐린 전구체(bovine insulin precursor) 단백질(서열번호 30)을 분비 발현하기 위해, 이를 암호화하는 DNA 서열을 코돈 최적화하였고, 클로닝을 위해 pPICZαA vector 서열과 상보적인 서열을 앞, 뒤로 20 bp씩 추가하여 합성하였으며, 그 서열은 서열번호 31과 같다. 합성한 DNA를 주형으로 서열번호 26과 서열번호 27의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 유전자 단편을 획득하였다. 그리고 pPICZαA 벡터를 주형으로 서열번호 28과 서열번호 29의 염기서열을 갖는 프라이머를 이용하여 PCR을 통해 벡터로 사용할 유전자 단편을 획득하였다. 획득한 두 유전자 단편을 깁슨 어셈블리(DG Gibson et al., NATURE METHODS, VOL.6 NO.5, MAY 2009, NEBuilder HiFi DNA Assembly Master Mix) 방법을 이용하여 클로닝하여 재조합 플라스미드를 획득하였다. 획득한 벡터는 pPCIZαA-bPROINSULIN으로 명명하였다. pPCIZαA-bPROINSULIN 벡터를 BG16 균주와 CF04-1035 균주에 실시예 2에 기재된 방법과 동일한 방법으로 각각 도입 및 확인을 진행하였다. 소 인슐린 전구체(bovine insulin precursor)를 암호화하는 유전자를 Pichia pastoris BG16 균주에 도입한 균주를 CF04-1017, CF04-1035에 도입한 균주를 CF04-1040으로 명명하였다.
상기 두 균주를 배양하여 소 인슐린 전구체의 발현량을 비교하였다. 실시예 3-3에 기재된 방법과 4-20% Tris-glycine polyacrylamide gel 대신 10-20% Tris-tricine polyacrylamide gel을 사용한 것을 제외하고는 동일한 방법으로 실험하였으며, 그 결과를 도 6 및 하기의 표 3에 나타내었다.
번호 균주 번호 도입 형질 발현량 (O.D)
1 CF04-1017 Insulin Precursor 96.2
2 CF04-1040 Insulin Precursor
Trichoderma reesei PDI		 145.61
그 결과, 도 6 및 표 3에 나타난 바와 같이, Trichoderma reesei PDI를 발현하는 균주인 CF04-1040 균주의 소 인슐린 전구체 발현량이 Trichoderma reesei PDI가 도입되지 않은 균주인 CF04-1017 균주에 비해 약 1.5배 높음을 확인하였다.

Claims (17)

1) 하기의 i) 및 ii) 단계를 동시에, 순차로 또는 역순으로 수행하는 단계를 포함하는 변이 효모 제조 단계:
i) 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 벡터를 효모에 도입하는 단계;
ii) 목적 단백질을 코딩하는 유전자를 포함하는 벡터를 효모에 도입하는 단계; 및
2) 상기 1) 단계에서 제조된 변이 효모를 배양하는 단계;
를 포함하는 재조합 단백질 생산 방법.
제1항에 있어서, 상기 1) 단계의 i)의 트리코더마 속(genus Trichoderma) 균주는 트리코더마 레세이(Trichoderma reesei)인 것인, 재조합 단백질 생산 방법.
제1항에 있어서, 상기 1) 단계의 i)의 트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)는 서열번호 14의 아미노산 서열로 이루어진 것인, 재조합 단백질 생산 방법.
제1항에 있어서, 상기 효모는 피키아 속(genus Pichia), 캔디다 속(genus Candida) 및 한세눌라 속(genus Hansenula) 균주로 이루어진 군으로부터 선택되는 어느 하나인, 재조합 단백질 생산 방법.
제1항에 있어서, 상기 효모는 피키아 파스토리스(Pichia pastoris) 균주인, 재조합 단백질 생산 방법.
제1항에 있어서, 상기 1) 단계의 ii)의 목적 단백질은 3개 이상의 이항화 결합(disulfide bond)을 포함하는 단백질인, 재조합 단백질의 생산 방법.
제6항에 있어서, 상기 목적 단백질은 트랜스페린(transferrin), 알부민(albumin) 및 인슐린 전구체(insulin precursor)로 이루어지는 군에서 선택되는 어느 하나 이상인, 재조합 단백질의 생산 방법.
제7항에 있어서, 상기 트랜스페린, 알부민 및 인슐린 전구체는 소(bovine) 유래인, 재조합 단백질의 생산 방법.
트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자를 포함하는 목적 단백질 생산용 변이 효모.
제9항에 있어서, 상기 트리코더마 속 균주 유래 PDI를 암호화하는 유전자는 효모 유전체(genome) 내에 삽입된 것인, 변이 효모.
제9항에 있어서, 상기 트리코더마 속(genus Trichoderma) 균주는 트리코더마 레세이(Trichoderma reesei)인 것인, 변이 효모.
제9항에 있어서, 상기 변이 효모는 피키아 속(genus Pichia), 캔디다 속(genus Candida) 및 한세눌라 속(genus Hansenula)으로 이루어진 군으로부터 선택되는 어느 하나인, 변이 효모.
제9항에 있어서, 상기 변이 효모는 피키아 파스토리스(Pichia pastoris) 균주인, 변이 효모.
제9항에 있어서, 상기 목적 단백질은 3개 이상의 이항화 결합(disulfide bond)을 포함하는 단백질인, 변이 효모.
제9항에 있어서, 상기 목적 단백질은 트랜스페린(transferrin), 알부민(albumin) 및 인슐린 전구체(insulin precursor)로 이루어지는 군에서 선택되는 어느 하나 이상인, 변이 효모.
제15항에 있어서, 상기 트랜스페린, 알부민 및 인슐린 전구체는 소(bovine) 유래인, 변이 효모.
트리코더마 속(genus Trichoderma) 균주 유래 PDI(protein disulfide isomerase)를 암호화하는 유전자 또는 이를 포함하는 벡터를 포함하는, 변이 효모에서의 목적 단백질 생산용 조성물.
PCT/KR2023/017380 2022-12-15 2023-11-02 트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법 WO2024128550A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020220175628A KR20240094203A (ko) 2022-12-15 2022-12-15 트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법
KR10-2022-0175628 2022-12-15

Publications (1)

Publication Number Publication Date
WO2024128550A1 true WO2024128550A1 (ko) 2024-06-20

Family

ID=91485157

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/017380 WO2024128550A1 (ko) 2022-12-15 2023-11-02 트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법

Country Status (2)

Country Link
KR (1) KR20240094203A (ko)
WO (1) WO2024128550A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8546126B2 (en) * 2007-03-21 2013-10-01 Danisco Us Inc. Over expression of foldases and chaperones improves protein production
US20140335622A1 (en) * 2012-01-23 2014-11-13 Asahi Glass Company, Limited Expression vector and method for producing protein
KR20170039681A (ko) * 2014-07-30 2017-04-11 다이이찌 산쿄 가부시키가이샤 단백질의 개량 고분비 생산 방법

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8546126B2 (en) * 2007-03-21 2013-10-01 Danisco Us Inc. Over expression of foldases and chaperones improves protein production
US20140335622A1 (en) * 2012-01-23 2014-11-13 Asahi Glass Company, Limited Expression vector and method for producing protein
KR20170039681A (ko) * 2014-07-30 2017-04-11 다이이찌 산쿄 가부시키가이샤 단백질의 개량 고분비 생산 방법

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
MEHMET INAN; DINESH ARYASOMAYAJULA; JAYANTA SINHA; MICHAEL M. MEAGHER: "Enhancement of protein secretion in Pichia pastoris by overexpression of protein disulfide isomerase", BIOTECHNOLOGY AND BIOENGINEERING, JOHN WILEY, HOBOKEN, USA, vol. 93, no. 4, 27 October 2005 (2005-10-27), Hoboken, USA, pages 771 - 778, XP071151382, ISSN: 0006-3592, DOI: 10.1002/bit.20762 *
SHUSTA ERIC V, RAINES RONALD T, PLIICKTHUN ANDREAS, WITTRUP K DANE: "Saccharomyces cerevisiae for production of single-chain antibody fragn1ents", NATURE BIOTECHNOLOGY, vol. 16, 1 August 1998 (1998-08-01), pages 773 - 777, XP093182059 *

Also Published As

Publication number Publication date
KR20240094203A (ko) 2024-06-25

Similar Documents

Publication Publication Date Title
WO2013105802A2 (ko) 자일로즈 이용능이 부여된 코리네박테리움 속 미생물 및 이를 이용한 ｌ-라이신의 생산방법
WO2022163934A1 (ko) 신규한 d-알라닌-d-알라닌 리가아제 a 변이체 및 이를 이용한 l-글루탐산 생산 방법
WO2023158175A1 (ko) 수송단백질 신규 변이체 및 이를 이용한 l-방향족 아미노산 생산 방법
WO2015093831A1 (ko) Ｄ（－）２，３－부탄디올의 생성능이 증강된 재조합 미생물 및 이를 이용한 ｄ（－）２，３－부탄디올의 생산 방법
WO2022231369A1 (ko) 신규한 포르메이트 의존성 포스포리보실글리신아미드 포밀 전이효소 변이체 및 이를 이용한 imp 생산 방법
WO2022163917A1 (ko) 신규한 단백질 변이체 및 이를 이용한 l-발린 생산 방법
WO2024128550A1 (ko) 트리코더마 속 균주 유래 pdi를 이용하여 재조합 단백질을 생산하는 방법
WO2022163933A1 (ko) 신규한 abc 트랜스포터 atp-결합 단백질 변이체 및 이를 이용한 l-글루탐산 생산 방법
WO2022163935A1 (ko) 신규한 글루코사민-6-포스페이트 디아미나제 변이체 및 이를 이용한 l-글루탐산 생산 방법
WO2022163920A1 (ko) 신규한 시스테인 설피네이트 디설피나제 변이체 및 이를 이용한 l-발린 생산 방법
WO2022163922A1 (ko) 신규한 아스파라긴 신타제 변이체 및 이를 이용한 l-발린 생산 방법
WO2022163923A1 (ko) 신규한 atp 포스포리보실트랜스퍼라제 변이체 및 이를 이용한 l-발린 생산 방법
WO2022231371A1 (ko) 신규한 5-(카르복시아미노)이미다졸리보뉴클레오티드합성효소 변이체 및 이를 이용한 imp 생산 방법
WO2022225319A1 (ko) 신규한 l-세린 암모니아 분해 효소 변이체 및 이를 이용한 xmp 또는 gmp 생산 방법
WO2022215800A1 (ko) 신규한 분지쇄아미노산 투과효소 변이체 및 이를 이용한 l-발린 생산 방법
WO2021125867A1 (ko) 화합물을 생산하는 미생물 및 이를 이용한 화합물의 생산 방법
WO2022163918A1 (ko) 신규한 테트라하이드로디피콜리네이트 n-숙시닐트랜스퍼라제 변이체 및 이를 이용한 l-발린 생산 방법
WO2022163937A1 (ko) 신규한 abc 트랜스포터 atp-결합 단백질 변이체 및 이를 이용한 l-글루탐산 생산 방법
WO2022163924A1 (ko) 신규한 5,10-메틸렌테트라하이드로폴레이트 리덕타제 변이체 및 이를 이용한 l-발린 생산 방법
WO2022163940A1 (ko) 신규한 갈락토사이드 o-아세틸트랜스퍼라제 변이체 및 이를 이용한 l-글루탐산 생산 방법
WO2022163925A1 (ko) 신규한 단백질 변이체 및 이를 이용한 l-발린 생산 방법
WO2022163930A1 (ko) 신규한 2-숙시닐-5-엔도피루빌-6-하이드록시-3-사이클로헥센-1-카복실레이트 신타아제 변이체 및 이를 이용한 xmp 또는 gmp 생산 방법
WO2022163926A1 (ko) 신규한 프롤린 탈수소효소 변이체 및 이를 이용한 l-발린 생산 방법
WO2020180132A1 (ko) D-글루타메이트 영양요구성 대장균 및 이를 이용한 목적 물질 생산 방법
WO2022163929A1 (ko) 신규한 펩티딜-디펩티다제 변이체 및 이를 이용한 xmp 또는 gmp 생산 방법