WO2024085603A1 - USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도 - Google Patents

USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도 Download PDF

Info

Publication number
WO2024085603A1
WO2024085603A1 PCT/KR2023/016053 KR2023016053W WO2024085603A1 WO 2024085603 A1 WO2024085603 A1 WO 2024085603A1 KR 2023016053 W KR2023016053 W KR 2023016053W WO 2024085603 A1 WO2024085603 A1 WO 2024085603A1
Authority
WO
WIPO (PCT)
Prior art keywords
usp47
myc
protein
expression
fragment
Prior art date
Application number
PCT/KR2023/016053
Other languages
English (en)
French (fr)
Inventor
송은주
신형경
황수아
김은경
추현아
Original Assignee
이화여자대학교 산학협력단
한국과학기술연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020230109267A external-priority patent/KR20240055632A/ko
Application filed by 이화여자대학교 산학협력단, 한국과학기술연구원 filed Critical 이화여자대학교 산학협력단
Publication of WO2024085603A1 publication Critical patent/WO2024085603A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
    • A61K31/415—1,2-Diazoles
    • A61K31/416—1,2-Diazoles condensed with carbocyclic ring systems, e.g. indazole
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/4965—Non-condensed pyrazines
    • A61K31/497—Non-condensed pyrazines containing further heterocyclic rings
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/4985—Pyrazines or piperazines ortho- or peri-condensed with heterocyclic ring systems
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/517—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with carbocyclic ring systems, e.g. quinazoline, perimidine
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519—Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/553—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having at least one nitrogen and one oxygen as ring hetero atoms, e.g. loxapine, staurosporine
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing

Definitions

  • the present invention relates to a pharmaceutical composition for preventing or treating c-Myc-related diseases, including an agent that inhibits the expression or activity of USP47 protein or a fragment thereof, and its use.
  • Cells are regulated by complex processes such as division, growth, differentiation, and apoptosis, and abnormal cell proliferation occurs due to abnormalities in this series of regulatory processes, leading to cell cancer.
  • abnormalities in cell division are thought to be a direct cause of cancer, and substances that regulate the cell division process are considered targets for the development of cancer prevention and treatment.
  • the cell division process occurs by repeating the cell cycle of G1, S, G2, and M phases, and checkpoints exist in each process to regulate the cell cycle.
  • the activities of proteins involved in cell cycle regulation are additionally regulated by phosphorylation and ubiquitination.
  • ubiquitination the mechanism of deubiquitination, which removes ubiquitin, also plays an important role in regulating cell division.
  • the deubiquitination enzyme USP44 regulates anaphase initiation by deubiquitinating cdc20 (Nature 2007;446:87681), and other deubiquitinating enzymes USP1 and USP7 regulate the DNA damage checkpoint (DNA It is known to regulate damage checkpoint (Mol Cell 2005;17:3319, Nat Cell Biol 2006;8:33947).
  • USP7 is known to regulate the stabilization of p53 by deubiquitination of Mdm2 (Oncogene 2007;26:72626), and USP16 deubiquitinates histone H2A to prevent chromosomal segregation during mitosis. It is known to regulate (Nature 2007;449:106872).
  • One aspect provides a pharmaceutical composition for preventing or treating c-Myc-related diseases, including an agent that inhibits the expression or activity of USP47 (Ubiquitin-specific protease 47) protein or fragments thereof.
  • USP47 Ubiquitin-specific protease 47
  • compositions for inhibiting c-Myc expression or activity comprising an agent that inhibits the expression or activity of USP47 protein or a fragment thereof.
  • Another aspect includes 1) treating a candidate agent in an in vitro model expressing USP47 protein or a fragment thereof; and 2) confirming the expression level of c-Myc protein or fragment thereof in the model.
  • compositions for diagnosing c-Myc-related diseases comprising an agent capable of measuring the expression level of the USP47 protein, a fragment thereof, or a gene encoding the same.
  • Another aspect provides a method of providing information for diagnosing a c-Myc-related disease, comprising measuring the expression level of the USP47 protein, a fragment thereof, or a gene encoding the same from a biological sample isolated from an individual.
  • One aspect is to provide a pharmaceutical composition for preventing or treating c-Myc-related diseases, which includes an agent that inhibits the expression or activity of USP47 protein or fragments thereof.
  • USP47 Ubiquitin Specific Peptidase 47
  • the USP47 may include the amino acid sequence of UniProt number Q96K76.
  • the USP47 protein or fragment thereof may include one or more selected from the group consisting of the UCH domain, UBL1 domain, and UBL2 domain of USP47, and specifically includes a UCH domain, a UBL1 domain, and a UBL2 domain, or a UCH domain. , may include a UBL1 domain and a UBL2 domain.
  • the USP47 protein may include the amino acid sequence of SEQ ID NO: 11, and specifically, the amino acid sequence of SEQ ID NO: 11 and at least 70%, 75%, 80%, 85%, 90%, or 95% of the amino acid sequence of SEQ ID NO: 11. It may show homology, and more specifically, may be composed of the amino acid sequence of SEQ ID NO: 11.
  • the UCH domain may include the amino acid sequence of SEQ ID NO: 12, and specifically, at least 70%, 75%, 80%, 85%, 90%, or 95% of the amino acid sequence of SEQ ID NO: 12. It may show homology, and more specifically, may be composed of the amino acid sequence of SEQ ID NO: 12.
  • the fragment containing the UBL1 domain and the UBL2 domain may include the 477th to 753rd amino acid sequence of SEQ ID NO: 11, and specifically, 70% or more, 75% of the 477th to 753rd amino acid sequence of SEQ ID NO: 11. It may be more than 80%, more than 85%, more than 90%, or more than 95% homology, and more specifically, it may be composed of the 477th to 753rd amino acid sequence of SEQ ID NO: 11.
  • the term "agent capable of inhibiting the expression or activity of USP47 protein or fragment thereof” or “USP47 expression or activity inhibitor” refers to the gene, mRNA or protein encoding the USP47 protein or fragment thereof, directly or indirectly. It refers to a substance that can bind and inhibit the expression or activity of USP47 protein or its fragment.
  • the agent capable of inhibiting the expression or activity of USP47 may be used in the same sense as an inhibitor of USP47 or an inhibitor of USP47.
  • the agent capable of inhibiting the expression or activity of the USP47 protein or fragment thereof may inhibit the expression or activity of c-Myc by inhibiting the expression or activity of USP47, and may specifically promote the decomposition of c-Myc. You can.
  • the c-Myc protein may include the amino acid sequence of SEQ ID NO: 15, and specifically, the amino acid sequence of SEQ ID NO: 15 and at least 70%, 75%, 80%, 85%, 90%, or 95% of the amino acid sequence of SEQ ID NO: 15. It may exhibit homology of more than %, and more specifically may be composed of the amino acid sequence of SEQ ID NO: 15.
  • agents capable of inhibiting the expression of USP47 protein or fragments thereof include miRNA, siRNA, shRNA, antisense oligonucleotides, and combinations thereof that bind complementary to the mRNA of the USP47 gene. It may be characterized in that it is selected from the group consisting of, and the agent capable of inhibiting the activity of the USP47 protein or fragment thereof includes antibodies, aptamers, small molecules, and It may be characterized as being selected from the group consisting of combinations thereof.
  • siRNA, siRNA or shRNA refers to a nucleic acid molecule that binds to mRNA transcribed from a target gene and inhibits translation of the mRNA in order to mediate RNA interference or gene silencing. Since the siRNA or shRNA can inhibit the expression of the target gene at the translation level, it can be used in an efficient gene knockdown method or gene therapy method, and for the purposes of this specification, it can be used to inhibit the expression of USP47. there is.
  • antisense oligonucleotide refers to DNA or RNA or a derivative thereof containing a nucleic acid sequence complementary to the sequence of a specific mRNA, and binds to the complementary sequence in the mRNA to translate the mRNA into a protein. It exhibits an inhibitory effect, and for the purposes of this specification, it can be used to inhibit the expression of USP.
  • the term “antibody” refers to a protein-based molecule that can specifically bind to the antigenic site of a protein or peptide molecule. Such antibodies are produced by cloning each gene into an expression vector according to a conventional method. The protein encoded by the marker gene can be obtained and produced from the obtained protein by a conventional method. In the present specification, the antibody can be interpreted as a means to inhibit the activity of the activated USP47 protein by binding to the protein. As a specific example, polyclonal antibodies that can specifically bind to USP47, monoclonal antibodies, or parts thereof if they have antigen binding properties are also included in the antibody, and all immunoglobulin antibodies as well as humanized antibodies can be included.
  • the antibody may also contain special antibodies such as in addition, the antibody may be in a complete form with two full-length light chains and two full-length heavy chains, as well as in a form containing functional fragments of the antibody molecule.
  • a functional fragment of an antibody molecule refers to a fragment that possesses at least an antigen-binding function and may include Fab, F(ab'), F(ab') 2, and Fv.
  • the term “aptamer” refers to a nucleic acid molecule that has binding activity to a given target molecule.
  • the aptamer may be RNA, DNA, modified nucleic acid, or a mixture thereof, and may be in a linear or circular form.
  • the shorter the nucleotide sequence constituting the aptamer the easier chemical synthesis and mass production are. It is known to be easier, have superior cost advantages, be easily chemically modified, have excellent in vivo stability, and have low toxicity.
  • the aptamer can be interpreted as a means to inhibit the activity of the activated USP protein by binding to the protein.
  • small molecules refers to organic compounds with a small molecular weight and molecules that bind to biopolymers such as proteins and regulate their functions. It may be of natural origin or artificially synthesized, and may inhibit protein function or interfere with protein-protein interactions, but is not limited thereto.
  • the small molecule compound includes without limitation any molecule that inhibits the activity of activated USP protein, and a specific example refers to a molecule that binds to activated USP and inhibits its activity, but is not limited thereto.
  • the agent that inhibits the expression or activity of the USP47 protein or fragment thereof may include one or more selected from the group consisting of K-552, a pharmaceutically acceptable salt thereof, a hydrate thereof, and a solvate thereof.
  • K-552 or “K-552 compound” as used herein refers to a carbazole derivative, 9-(3-(4-(2-methoxyphenyl)piperazin-1-yl)propyl)-9H- It is named carbazole and can be expressed by the following formula (1).
  • pharmaceutically acceptable salt refers to a salt that can be used pharmaceutically among salts that are substances in which cations and anions are combined by electrostatic attraction, and are usually metal salts and organic bases. It may be a salt with a salt, a salt with an inorganic acid, a salt with an organic acid, a salt with a basic or acidic amino acid, etc.
  • the metal salt may be an alkali metal salt (sodium salt, potassium salt, etc.), an alkaline earth metal salt (calcium salt, magnesium salt, barium salt, etc.), an aluminum salt, etc.; Salts with organic bases include triethylamine, pyridine, picoline, 2,6-lutidine, ethanolamine, diethanolamine, triethanolamine, cyclohexylamine, dicyclohexylamine, and N,N-dibenzylethylenediamine.
  • Salts with organic bases include triethylamine, pyridine, picoline, 2,6-lutidine, ethanolamine, diethanolamine, triethanolamine, cyclohexylamine, dicyclohexylamine, and N,N-dibenzylethylenediamine.
  • Salts with inorganic acids may include salts with hydrochloric acid, hydrobromic acid, nitric acid, sulfuric acid, phosphoric acid, etc.
  • Salts with organic acids may include salts with formic acid, acetic acid, trifluoroacetic acid, phthalic acid, fumaric acid, oxalic acid, tartaric acid, maleic acid, citric acid, succinic acid, methanesulfonic acid, benzenesulfonic acid, and p-toluenesulfonic acid
  • Salts with basic amino acids may include salts with arginine, lysine, ornithine, etc.
  • Salts with acidic amino acids can be salts with aspartic acid, glutamic acid, etc.
  • Particularly preferred salts include, when the compound has an acidic functional group therein, inorganic salts such as alkali metal salts (e.g., sodium salts, potassium salts, etc.), alkaline earth metal salts (e.g., calcium salts, magnesium salts, barium salts, etc.), and organic salts such as ammonium salts, and when the compound has a basic functional group therein, salts with inorganic acids such as hydrochloric acid, hydrobromic acid, nitric acid, sulfuric acid, phosphoric acid, etc., acetic acid, phthalic acid, fumaric acid, oxalic acid, tartaric acid, maleic acid, citric acid, There are salts with organic acids such as succinic acid, methanesulfonic acid, p-toluenesulfonic acid, etc.
  • inorganic salts such as alkali metal salts (e.g., sodium salts, potassium salts, etc.), alkaline earth metal salts
  • An agent that inhibits the expression or activity of the USP47 protein or a fragment thereof, or a composition containing the agent, may promote the decomposition of c-Myc, and specifically inhibits the c-Myc deubiquitination activity of USP47 to c- It may promote Myc ubiquitination.
  • c-Myc cellular Myc
  • the c-Myc may include the amino acid sequence of UniProt number Q6LBK7.
  • the agent that inhibits the expression or activity of USP47 or the composition containing the agent may inhibit the expression or activity of the signaling pathway downstream of c-Myc by inhibiting the expression or activity of c-Myc. This may inhibit the expression or activity of CCNE1, LDHA, etc. as target genes of c-Myc.
  • composition may further include an agent that inhibits the expression or activity of K-RAS.
  • K-RAS Philadelphia rat sarcoma virus
  • KRAS protein binds to GTP, a signaling molecule, and regulates cell growth by switching between 'on' and 'off' states like a light switch.
  • GTP GTP
  • KRAS protein binds to GTP, a signaling molecule, and regulates cell growth by switching between 'on' and 'off' states like a light switch.
  • KRAS mutations include KRAS G12C, KRAS G12V, and KRAS G12D.
  • the K-RAS may include the amino acid sequence of UniProt number P01116.
  • the agent that inhibits the expression or activity of K-RAS may be one that inhibits the expression or activity of wild-type and/or mutant forms of K-RAS.
  • the K-RAS mutant may be an agent that inhibits the expression or activity of the wild-type K-RAS. It may be a mutation (KRAS G12C) in which glycine (G) is replaced with cysteine (C) at the 12th codon position of the base sequence.
  • the base sequence encoding the K-RAS mutation may be the base sequence of SEQ ID NO: 13 or SEQ ID NO: 14.
  • K-RAS agents that inhibit the expression or activity of K-RAS include Sotorasib, Adagrasib, GFH925, LY3499446, LY3537982, JDQ443, JAB-21822, YL-15293, ELI-002 7P, HBI- 2438, JNJ-74699157, D3S-001, BI 1823911, IBI351, MK-1084, GDC-6036, HS-10370, D-1553, and GEC255, and may include one or more selected from the group consisting of Sotora It may include one or more selected from the group consisting of Sib, Adagraship, GFH925, LY3499446, LY3537982, JDQ443, GDC-6036, and D-1553.
  • the Sotorasib is represented by the following formula 2, 6-Fluoro-7-(2-fluoro-6-hydroxyphenyl)-1-[4-methyl-2-(1-methylethyl)-3-pyridinyl] -4-[( 2S )-2-methyl-4-(1-oxo-2-propen-1-yl)-1-piperazinyl]pyrido[2,3- d ]pyrimidin-2( 1H )-one It is named (CAS number: 2252403-56-6).
  • Adagrasib is represented by the following formula 3, ⁇ (2S)-4-[7-(8-chloronaphthalen-1-yl)-2- ⁇ [(2S)-1methylpyrrolidin-2-yl]methoxy ⁇ -5,6,7,8tetrahydropyrid[3,4-d]pyrimidin-4-yl]-1-(2-fluoroprop2-enoyl)piperazin-2-yl ⁇ acetonitrile (CAS number: 2326521-71- 3).
  • the LY3537982 is expressed by the following formula 4, and is 4-(2-acryloyl-9-chloro-7-fluoro-5-oxo-2,3,11,11a-tetrahydro-1H,5H-benzo[f]imidazo[5 ,1-c][1,4]oxazepin-8-yl)-2-amino-7-fluorobenzo[b]thiophene-3-carbonitrile (CAS number: 2414198-64-2).
  • the LY3499446 is expressed by the following formula 5, 1-[4-[7-(2-amino-7-fluoro-1,3-benzothiazol-4-yl)-6-chloro-8-fluoroquinazolin-4-yl] It is named piperazin-1-yl]prop-2-en-1-one;methanesulfonic acid (CAS number: 2409131-50-4).
  • the GFH925 is expressed by the following formula 6, (7 R )-16-chloro-14-fluoro-15-(2-fluoro-6-hydroxyphenyl)-9-methyl-5-prop-2-enoyl-2,5 ,9,12-tetrazatetracyclo[8.8.0.0 2,7 .0 13,18 ]octadeca-1(10),11,13,15,17-pentaen-8-one (CAS number: 2349393-95- 7).
  • the JDQ443 is represented by the following formula 7, (1-[6-[4-(5-chloro-6-methyl-1H-indazol-4-yl)-5-methyl-3-(1-methylindazol-5- It is named yl)pyrazol-1-yl]-2-azaspiro[3.3]heptan-2-yl]prop-2-en-1-one (CAS number: 2653994-08-0).
  • the GDC-6036 (Divarasib) is represented by the following formula 8, 1-[(3 S )-4-[7-[6-amino-4-methyl-3-(trifluoromethyl)pyridin-2-yl]-6 -chloro-8-fluoro-2-[[(2 S )-1-methylpyrrolidin-2-yl]methoxy]quinazolin-4-yl]-3-methylpiperazin-1-yl]prop-2-en-1-one It is named (CAS number: 2417987-45-0).
  • the D-1553 (Garsorasib) is represented by the following formula 9, 7-(2-amino-6-fluorophenyl)-1-(4,6-dicyclopropylpyrimidin-5-yl)-4-[(2S,5R)- It is named 2,5-dimethyl-4-prop-2-enoylpiperazin-1-yl]-6-fluoropyrido[2,3-d]pyrimidin-2-one (CAS number: 2559761-14-5).
  • the c-Myc-related disease may include one or more selected from the group consisting of lung cancer, colon cancer, and breast cancer, and may specifically be lung cancer. Additionally, the lung cancer may be non-small cell lung cancer.
  • the c-Myc-related disease may refer to a disease caused by overexpression or overactivity of the c-Myc protein or the gene encoding it. Additionally, the c-Myc-related disease may be caused by USP47 overexpression or hyperactivity.
  • the composition may inhibit one or more activities selected from the group consisting of growth, proliferation, metastasis and invasion of cancer or cancer cells, and specifically inhibits the expression and/or activity of c-Myc to inhibit the growth, proliferation, metastasis or invasion of cancer cells.
  • diseases such as lung cancer, colon cancer, and breast cancer can be treated or prevented.
  • treatment refers to any action that improves or beneficially changes the symptoms of a c-Myc-related disease by administering the composition of the present invention.
  • prevention refers to any action that suppresses or delays the possibility of developing a c-Myc-related disease or disease by administering the composition of the present invention.
  • the pharmaceutical composition may include a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier may mean a carrier or diluent that does not irritate living organisms and does not inhibit the biological activity and properties of the injected compound.
  • pharmaceutically acceptable means that it does not inhibit the activity of the active ingredient and does not have any toxicity beyond what the subject of application (prescription) can adapt to.
  • the type of carrier that can be used in the pharmaceutical composition can be any carrier that is commonly used in the art and is pharmaceutically acceptable.
  • Non-limiting examples of the carrier include lactose, dextrose, maltodextrin, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, glycerol, ethanol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, Cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, or Mineral oil, etc. may be mentioned.
  • the pharmaceutical composition may be prepared into an oral formulation or a parenteral formulation depending on the route of administration by a conventional method known in the art, including a pharmaceutically acceptable carrier in addition to the active ingredient.
  • the pharmaceutical composition can be formulated and used in the form of oral dosage forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, aerosols, external preparations, suppositories, or sterile injection solutions according to conventional methods.
  • the pharmaceutical composition When formulating the pharmaceutical composition, it may be prepared using diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, or surfactants, but may not be limited thereto.
  • diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, or surfactants, but may not be limited thereto.
  • the pharmaceutical composition When the pharmaceutical composition is prepared as an oral dosage form, it can be prepared as powder, granules, tablets, pills, sugar-coated tablets, capsules, solutions, gels, syrups, suspensions, wafers, etc. according to methods known in the art along with a suitable carrier. It can be prepared as a dosage form.
  • suitable pharmaceutically acceptable carriers include sugars such as lactose, glucose, sucrose, dextrose, sorbitol, mannitol, and xylitol, starches such as corn starch, potato starch, and wheat starch, cellulose, methylcellulose, and ethylcellulose.
  • Cellulose such as sodium carboxymethylcellulose and hydroxypropylmethylcellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, magnesium stearate, mineral oil, malt, gelatin, talc, polyol, vegetable. Yu, etc. can be mentioned.
  • diluents and/or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants may be included in the formulation.
  • the pharmaceutical composition when prepared as a parenteral formulation, it can be formulated in the form of injections, transdermal administration, nasal inhalation, and suppositories along with a suitable carrier according to methods known in the art.
  • suitable carriers include sterilized water, ethanol, polyols such as glycerol or propylene glycol, or mixtures thereof, preferably Ringer's solution, phosphate buffered saline (PBS) containing triethanolamine, or sterile for injection.
  • PBS phosphate buffered saline
  • Isotonic solutions such as water or 5% dextrose can be used.
  • formulated for transdermal administration When formulated for transdermal administration, it can be formulated in the form of ointments, creams, lotions, gels, external solutions, paste preparations, linear preparations, and aerol preparations.
  • suitable propellants such as dichlorofluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, and carbon dioxide.
  • the base is Wethepsol (witepsol), Tween 61, polyethylene glycols, cocoa fat, laurel paper, polyoxyethylene sorbitan fatty acid esters, polyoxyethylene stearates, sorbitan fatty acid esters, etc. can be used.
  • the pharmaceutical composition may be administered in a pharmaceutically effective amount.
  • pharmaceutically effective amount means an amount sufficient to treat or prevent a disease with a reasonable benefit/risk ratio applicable to medical treatment or prevention, and the effective dose level is determined by the severity of the disease, the activity of the drug, and the patient's Factors including age, weight, health, gender, patient's sensitivity to drugs, administration time of the composition of the present invention used, administration route and excretion rate, treatment period, drugs mixed or used simultaneously with the composition of the present invention used, and other factors. It can be determined based on factors well known in the medical field.
  • the pharmaceutical composition of the present invention can be administered alone or in combination with ingredients known to exhibit therapeutic effects on c-Myc-related diseases. It is important to consider all of the above factors and administer the amount that will achieve the maximum effect with the minimum amount without side effects.
  • the dosage of the pharmaceutical composition can be determined by a person skilled in the art in consideration of the purpose of use, the degree of addiction of the disease, the patient's age, weight, gender, antecedent history, or the type of substance used as an active ingredient.
  • the pharmaceutical composition of the present invention can be administered at about 0.1 ng to about 1,000 mg/kg, preferably 1 ng to about 100 mg/kg per adult, and the frequency of administration of the composition of the present invention is specifically determined by this. Although not limited, it can be administered once a day, or the dose can be divided and administered several times. The above dosage or frequency of administration does not limit the scope of the present application in any way.
  • Another aspect is to provide a method for treating or preventing a c-Myc-related disease, comprising administering the pharmaceutical composition for treating or preventing the c-Myc-related disease to a subject.
  • the same parts as described above also apply to the above method.
  • the term “individual” used in this specification includes, without limitation, mammals, birds, reptiles, farmed fish, etc., including dogs, cats, rats, livestock, humans, etc., that develop or are at risk of developing c-Myc-related diseases. It may be possible, and the entity may exclude humans.
  • the pharmaceutical composition may be administered singly or multiple times in a pharmaceutically effective amount.
  • the composition can be formulated and administered in the form of a solution, powder, aerosol, injection, infusion solution (injection), capsule, pill, tablet, suppository, or patch.
  • the pharmaceutical composition for preventing or treating c-Myc-related diseases may be administered through any general route as long as it can reach the target tissue.
  • the pharmaceutical composition is not particularly limited, but depending on the purpose, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, transdermal patch administration, oral administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc. It can be administered through the route. However, when administered orally, it can be administered in an unformulated form, and since the active ingredients of the pharmaceutical composition may be denatured or decomposed by stomach acid, the oral composition is formulated to coat the active agent or protect it from decomposition in the stomach. It can also be administered orally in the form of a tablet or oral patch. Additionally, the composition can be administered by any device that allows the active substance to move to target cells.
  • Another aspect is to provide a composition for inhibiting c-Myc expression or activity, comprising an agent that inhibits the expression or activity of USP47.
  • the same parts as described above also apply to the composition.
  • the agent that inhibits the expression or activity of the USP47 protein or fragment thereof may include one or more selected from the group consisting of K-552, a pharmaceutically acceptable salt thereof, a hydrate thereof, and a solvate thereof.
  • composition may further include an agent that inhibits the expression or activity of K-RAS.
  • the agent that inhibits the expression or activity of K-RAS may inhibit the expression or activity of K-RAS wild type and/or mutant type, and may specifically inhibit KRAS G12C.
  • K-RAS K-RAS
  • Sotorasib Adagrasib
  • GFH925 JAB-21822, YL-15293
  • ELI-002 7P HBI-2438
  • JDQ443, JNJ-74699157 D3S-001
  • MK-1084 LY3499446, JAB-21822, LY3537982, GDC-6036, HS-10370, D-1553, and GEC255.
  • Another aspect includes 1) treating a candidate agent in an in vitro model expressing USP47 protein or a fragment thereof; and 2) confirming the expression level of c-Myc protein or fragment thereof in the model.
  • the same parts as described above also apply to the above method.
  • the in vitro model may be cells expressing USP47 protein or fragments thereof.
  • the in vitro model may be a cell in which the expression or activity of the USP47 protein or a fragment thereof is increased.
  • the model may be a cell in which the expression or activity of the USP47 protein or a fragment thereof is increased compared to a negative control or normal group, resulting in overexpression or It may be overactive.
  • Cells with increased expression or activity of the USP47 protein or fragment thereof may be obtained from individuals with increased expression or activity of the USP47 protein or fragment thereof, or may be obtained by overexpressing or overactivating the USP47 protein or fragment thereof in normal cells. .
  • the USP47 protein or fragment thereof may include one or more selected from the group consisting of the UCH domain, UBL1 domain, and UBL2 domain of USP47, and specifically includes a UCH domain or a fragment including a UBL1 domain and a UBL2 domain. Or, and/or may include a fragment including a UCH domain, UBL1 domain, and UBL2 domain.
  • the USP47 protein or fragment thereof may not contain a region or fragment containing one or more selected from the group consisting of the UBL3 domain and UBL4 domain of USP47.
  • the region or fragment containing the UBL3 domain may include the 753rd to 934th amino acid sequence of SEQ ID NO: 11, and specifically the 753rd to 934th amino acid sequence of SEQ ID NO: 11 and at least 70%, 75% or more. , may exhibit at least 80%, at least 85%, at least 90%, or at least 95% homology, and more specifically may be composed of the 753rd to 934th amino acid sequence of SEQ ID NO: 11.
  • the region or fragment containing the UBL4 domain may include the 934th to 1287th amino acid sequence of SEQ ID NO: 11, and specifically, 70% or more, 75% or more of the 934th to 1287th amino acid sequence of SEQ ID NO: 11. , may exhibit at least 80%, at least 85%, at least 90%, or at least 95% homology, and more specifically may be composed of the 934th to 1287th amino acid sequence of SEQ ID NO: 11.
  • the region or fragment containing the UBL3 domain and the UBL4 domain may include the 753rd to 1287th amino acid sequence of SEQ ID NO: 11, and specifically, 70% or more of the 753rd to 1287th amino acid sequence of SEQ ID NO: 11, It may be more than 75%, more than 80%, more than 85%, more than 90%, or more than 95% homology, and more specifically, it may be composed of the 753rd to 1287th amino acid sequence of SEQ ID NO: 11.
  • the UBL3 domain and/or UBL4 domain was confirmed to inhibit the interaction of the UCH domain, UBL1 domain, and UBL2 domain of USP47 with c-Myc, screening for a therapeutic agent that induces c-Myc degradation may reduce efficiency.
  • the in vitro model may be cells expressing c-Myc protein or fragments thereof. Additionally, the in vitro model may be a cell with increased expression or activity of c-Myc protein or fragment thereof. Specifically, the model may be a cell in which the expression or activity of c-Myc protein or fragment thereof is increased compared to the negative control or normal group. It may have increased.
  • the cells with increased expression or activity of the c-Myc protein or fragment thereof are obtained from an individual with increased expression or activity of the c-Myc protein or fragment thereof, or by overexpressing or overexpressing the c-Myc protein or fragment thereof in normal cells. It can be obtained by activating it.
  • the c-Myc protein or fragment thereof may include the bHLH-LZ domain of c-Myc.
  • the region or fragment containing the bHLH-LZ domain may include the 354th to 434th amino acid sequence of SEQ ID NO: 15, specifically the 354th to 434th amino acid sequence of SEQ ID NO: 15 and at least 70%, 75% or more. It may exhibit homology of more than %, more than 80%, more than 85%, more than 90%, or more than 95%, and more specifically, it may be composed of the 354th to 434th amino acid sequence of SEQ ID NO: 15.
  • the bHLH-LZ domain may include the amino acid sequence of SEQ ID NO: 16, and specifically, at least 70%, 75%, 80%, 85%, or 90% of the amino acid sequence of SEQ ID NO: 16. Alternatively, it may exhibit more than 95% homology, and more specifically, may be comprised of the amino acid sequence of SEQ ID NO: 16.
  • the in vitro model comprises 1) USP47 protein or fragment thereof; and 2) cells in which c-Myc protein or fragments thereof are expressed or overexpressed.
  • the candidate substance may be an agent that inhibits the expression and/or activity of USP47 protein or a fragment thereof.
  • the method may further include the step of confirming the expression/activity level of the USP47 protein or fragment thereof of the model according to the treatment of the candidate substance.
  • the expression level of c-Myc protein or a fragment thereof decreases upon treatment with the candidate material, it may further include the step of determining the candidate material as a treatment for c-Myc-related diseases. . Specifically, the step may further include determining that the candidate material is a treatment for c-Myc-related diseases when the level of alternative splicing of c-Myc increases as a result of treatment with the candidate material.
  • the candidate may be an agent that inhibits the interaction and/or binding of USP47 protein or fragment thereof and c-Myc protein or fragment thereof.
  • the method may include the step of 2) confirming the interaction and/or binding level of the USP47 protein or fragment thereof and the c-Myc protein or fragment thereof.
  • the candidate substance is used as a treatment for c-Myc-related diseases. It may include an additional judgment step.
  • the candidate substance may be an agent that inhibits the deubiquitination activity of USP47 protein or a fragment thereof.
  • the method may include the step of 2) confirming the level of ubiquitination and/or deubiquitination of the c-Myc protein or fragment thereof.
  • the candidate material is used as a treatment for c-Myc-related diseases. It may include an additional judgment step.
  • the expression and selective deubiquitination of c-Myc is confirmed by concentrating c-Myc in cells using a pull down assay and then increasing the expression or activity of c-Myc using Western blotting. and confirming the level of reduction.
  • the c-Myc-related disease may include one or more selected from the group consisting of lung cancer, colon cancer, and breast cancer, and may specifically be lung cancer. Additionally, the lung cancer may be non-small cell lung cancer.
  • Another aspect provides a method of reducing the expression of c-Myc in cancer cells in vitro by treating cancer cells with an agent that inhibits the expression or activity of USP47.
  • an agent that inhibits the expression or activity of USP47 The same parts as described above also apply to the above method.
  • the cancer cells may include one or more selected from the group consisting of lung cancer cells, breast cancer cells, and colon cancer cells, and may specifically be lung cancer cells.
  • Another aspect is a method of inhibiting proliferation, metastasis, or invasion of cancer cells, comprising treating cancer cells in vitro with an agent that inhibits the expression or activity of USP47 to reduce the expression of c-Myc in the cancer cells.
  • an agent that inhibits the expression or activity of USP47 to reduce the expression of c-Myc in the cancer cells Provides a method.
  • the same parts as described above also apply to the above method.
  • the cancer cells may include one or more selected from the group consisting of lung cancer cells, breast cancer cells, and colon cancer cells, and may specifically be lung cancer cells.
  • compositions for diagnosing c-Myc-related diseases comprising an agent capable of measuring the expression level of the USP47 protein, a fragment thereof, or a gene encoding the same.
  • an agent capable of measuring the expression level of the USP47 protein, a fragment thereof, or a gene encoding the same comprising an agent capable of measuring the expression level of the USP47 protein, a fragment thereof, or a gene encoding the same.
  • the same parts as described above also apply to the composition.
  • the composition can diagnose and/or predict the prognosis of a c-Myc-related disease in a specific individual by detecting or measuring the expression level of the USP47 protein, its fragment, or the gene encoding it.
  • the composition can diagnose and/or predict the prognosis of a c-Myc-related disease in a specific individual by detecting or measuring the interaction and/or binding level of the USP47 protein or fragment thereof and the c-Myc protein or fragment thereof.
  • the composition can diagnose and/or predict the prognosis of a c-Myc-related disease in a specific individual by detecting or measuring the deubiquitination activity of USP47 protein or a fragment thereof.
  • diagnosis means confirming the presence or characteristics of a pathological condition. For the purposes of the present invention, diagnosis may mean determining whether a c-Myc-related disease has occurred.
  • prognosis in this specification refers to a prediction regarding the progression and recovery of a disease, and refers to a forecast or preliminary evaluation.
  • prognosis refers to determining whether treatment is successful, survival, recurrence, metastasis, drug responsiveness, resistance, etc. in an individual after treatment of a c-Myc-related disease.
  • medical outcomes e.g., long-term survival possibility, disease-free survival rate, etc.
  • the negative prognosis refers to recurrence, tumor growth, and metastasis.
  • disease progression or mortality, such as drug resistance and a positive prognosis includes remission of the disease, such as no disease, and improvement or stabilization of the disease, such as tumor regression.
  • prediction in this specification refers to guessing in advance about medical consequences, and for the purpose of the present invention, the course of the disease (disease progression, improvement, recurrence of cancer, etc.) of a patient diagnosed with a c-Myc-related disease. This may mean predicting tumor growth, drug resistance) in advance.
  • the term "measurement of expression level” refers to measuring the presence, expression, or expression level of a specific protein (peptide) or a gene encoding the protein, specifically, USP47 protein, a fragment thereof, or an mRNA encoding the same. Alternatively, it may be measuring the expression level of a gene.
  • the USP47 protein or fragment thereof, the expression level of which can be measured using the diagnostic composition may include one or more selected from the group consisting of the UCH domain, UBL1 domain, and UBL2 domain of USP47, and specifically includes the UCH domain. Alternatively, it may contain a fragment containing a UBL1 domain and a UBL2 domain, or it may contain a fragment containing a UCH domain, a UBL1 domain, and a UBL2 domain.
  • Methods for measuring the expression level of the protein include Western blotting, ELISA (enzyme linked immunosorbent assay), radioimmunoassay (RIA), radical immunodiffusion, and Ochterony immunodiffusion ( Ouchterlony immunodiffusion, rocket immunoeletrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, immunofluorescence, immunochromatography ( It may be immunochromatography, fluorescence activated cell sorter analysis (FACS), protein chip technology, or biosensor.
  • Western blotting ELISA (enzyme linked immunosorbent assay), radioimmunoassay (RIA), radical immunodiffusion, and Ochterony immunodiffusion ( Ouchterlony immunodiffusion, rocket immunoeletrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, immunofluorescence, immunochromatography ( It may be immunochromatography, fluorescence activated cell sorter analysis (FACS), protein chip
  • Methods for measuring the expression level of the mRNA or gene include reverse transcriptase polymerization reaction (RT-PCR), competitive reverse transcriptase polymerase reaction (competitive RT-PCR), real time quantitative RT-PCR, It may be quantitative RT-PCR, RNase protection method, Northern blotting, DNA chip technology or biosensor.
  • RT-PCR reverse transcriptase polymerization reaction
  • competitive RT-PCR competitive reverse transcriptase polymerase reaction
  • real time quantitative RT-PCR It may be quantitative RT-PCR, RNase protection method, Northern blotting, DNA chip technology or biosensor.
  • the term "agent capable of measuring the expression level” refers to a molecule that can be used to confirm the expression level of a specific protein or the gene encoding it, and specifically detects and/or detects the protein or the gene. It may include, but is not limited to, an amplifying agent.
  • agent capable of detecting a specific protein or the gene encoding it refers to an agent that can specifically bind to and recognize the specific gene or protein, or detect and amplify the specific gene or protein.
  • Agent capable of amplifying refers to an agent capable of increasing the number of a specific gene or protein by repeating its replication, for example, a primer that can specifically amplify a polynucleotide containing the gene or It may refer to a probe capable of specifically binding, but is not limited thereto.
  • the diagnostic composition includes a primer, probe, nucleotide, antibody, antibody fragment or antigen-binding fragment thereof, ligand, receptor, protein, or a combination thereof that specifically binds to the USP47 protein, a fragment thereof, or an mRNA or gene encoding the same. You can.
  • Another aspect is to provide a kit for diagnosing c-Myc-related diseases, including the composition for diagnosing c-Myc-related diseases.
  • the same parts as described above also apply to the kit.
  • the kit can diagnose the c-Myc-related disease by detecting or measuring the expression level of the USP47 protein, its fragment, or the mRNA or gene encoding it.
  • the kit includes primers, probes, or antibodies that selectively recognize a marker or a fragment thereof that maintains antigen-binding ability, as well as primers, probes, or fragments thereof that maintain antigen-binding ability to detect the expression or measure the expression level of the SP47 protein, a fragment thereof, or an mRNA or gene encoding the same.
  • primers, probes, or antibodies that selectively recognize a marker or a fragment thereof that maintains antigen-binding ability, as well as primers, probes, or fragments thereof that maintain antigen-binding ability to detect the expression or measure the expression level of the SP47 protein, a fragment thereof, or an mRNA or gene encoding the same.
  • primers, probes, or antibodies that selectively recognize a marker or a fragment thereof that maintains antigen-binding ability, as well as primers, probes, or fragments thereof that maintain antigen-binding ability to detect the expression or measure the expression level of the SP47 protein, a fragment thereof, or an mRNA or gene
  • a c-Myc-related disease diagnostic kit for detecting or measuring the expression level of a polynucleotide or gene includes one or more oligonucleotides that specifically bind to a polynucleotide or gene encoding the USP47 protein or a fragment thereof. It may include primers corresponding to the gene or partial sequence thereof, reverse transcriptase, Taq polymerase, primers for PCR, and dNTPs, and may include the expression level of the mRNA or gene and the expression level of the mRNA or gene to measure the polynucleotide expression level. Kits using the measurement methods described in this regard are available.
  • a diagnostic kit for c-Myc-related diseases for detecting or measuring the expression level of a polypeptide or protein may include an antibody or antibody fragment that specifically binds to the USP47 protein or a fragment thereof, and determines the expression level of the polypeptide.
  • a kit using the measurement method described can be used.
  • Another aspect is to provide a method of providing information for diagnosing c-Myc-related diseases, which includes measuring the expression level of the USP47 protein, its fragment, or the gene encoding it from a biological sample isolated from an individual.
  • the same parts as described above also apply to the above method.
  • the term “individual” as used herein refers to any organism that develops or is likely to develop a c-Myc-related disease, and specific examples include dogs, cats, mice, rats, monkeys, cows, pigs, mini-pigs, livestock, It may include mammals including humans, farmed fish, etc., but is not limited thereto.
  • sample refers to material derived from the subject and may specifically include, but is not limited to, tissue, cells, whole blood, serum, plasma, saliva, sputum, cerebrospinal fluid, urine, etc. . Additionally, gene and/or protein samples can be obtained from these samples, and the genetic sample may include nucleic acids, such as DNA, mRNA, or cDNA synthesized from mRNA, from which expression of a specific gene/protein may be performed. As long as the level can be confirmed, the type is not limited to this.
  • the method includes measuring the expression level of USP47 protein, a fragment thereof, or a gene encoding the same from a biological sample isolated from a control group; And it may further include comparing the expression levels of the subject and the control group.
  • control group may refer to a general individual who does not develop a c-Myc-related disease, a patient group with a non-c-Myc-related disease, or a non-patient group.
  • the method includes determining that the individual has a c-Myc-related disease or predicting the risk of developing it at a high level when the expression level of the USP47 protein, its fragment, or the gene encoding it in the individual is higher than the control group. It may additionally include.
  • the expression and activity of c-Myc, an oncogene can be inhibited by using a composition that inhibits the expression/activity of USP47, which can be usefully used for the treatment or screening of various cancers.
  • Figure 1A is a diagram showing the results of overexpressing USP47 and then using immunoprecipitation to confirm the binding between the overexpressed USP47 and the c-Myc protein present in the cell
  • B is a diagram showing the binding of the overexpressed USP47 and the c-Myc protein. This is a diagram showing the results of confirming the binding
  • C is a diagram showing the results of confirming the binding of overexpressed wild type and mutant USP47 to the overexpressed c-Myc protein
  • D is a diagram showing the results of confirming the binding of USP47 present in the cell and the intracellular c-Myc protein. This diagram shows the results of confirming binding to Myc protein.
  • Figure 2 is a diagram showing the results of confirming that USP47 and c-Myc proteins stained with immunofluorescence are co-located within cells using a confocal microscope.
  • Figure 3 is a diagram showing an explanation of the structure of the USP47 fragment.
  • Figure 4 is a diagram showing the results of confirming whether the USP47 protein or fragment binds to the overexpressed c-Myc protein by transfection.
  • Figure 5A is a diagram showing an explanation of the structure of the c-Myc fragment
  • B is a diagram showing the results of confirming whether the c-Myc protein or fragment binds to USP47 by transfection.
  • Figure 6 is a diagram showing the results of confirming whether c-Myc is ubiquitinated after overexpressing the wild type or mutant form (no enzyme activity) of USP47.
  • Figure 7A is a diagram showing the results of confirming the change in the expression level of c-Myc according to the expression level of USP47 by Western blot after overexpressing USP47 in the non-small cell lung cancer cell lines A549 cell line and Calu-1 cell line
  • B is a diagram showing the results.
  • This diagram shows the results of Western blot confirmation of changes in the expression level of c-Myc upon treatment with siUSP47 and/or MG132, a proteasome inhibitor.
  • Figure 8A shows the results of overexpressing USP47 and then treating it with cycloheximide and confirming the decomposition rate of c-Myc by Western blot.
  • B shows the decomposition rate of c-Myc after inhibiting the expression of USP47 and treating it with cycloheximide. This is a diagram showing the results confirmed by Western blot,
  • Figure 9A shows the results of confirming c-Myc gene expression by qRT-PCR when wild-type or mutant USP47 was overexpressed
  • B shows the downstream gene of c-Myc after inhibiting USP47 expression using siRNA. This is a diagram showing the results of confirming the expression level of these by qRT-PCR.
  • Figure 10A is a diagram showing the colony formation assay and Western blotting results after USP47 knockdown or USP47 knockdown in the A549 cell line or overexpression of c-Myc
  • B is a diagram showing the results of colony formation assay and Western blotting after USP47 knockdown or USP47 knockdown in the Calu-1 cell line. This diagram shows the results of colony formation assay and Western blotting after overexpressing -Myc.
  • 11A is a diagram showing the colony formation assay and Western blotting results when USP47 and/or c-Myc were respectively inhibited in the A549 cell line
  • B is a diagram showing the results of colony formation assay and Western blotting when USP47 and/or c-Myc were inhibited in the Calu-1 cell line. This diagram shows the colony formation assay and Western blotting results for each inhibition case
  • 12A is a diagram showing the results of analyzing the survival rate of lung cancer patients according to USP47 expression using the GEO (Gene Expression Omnibus) database
  • B is a diagram showing the results of analyzing the survival rate of lung cancer patients according to USP47 expression using the TCGA (THE CANCER GENOME ATLAS PROGRAM) database. This diagram shows the results of analyzing the survival rate of lung cancer patients.
  • Figure 13A is a diagram showing the results of analyzing the difference in USP47 mRNA expression levels between groups by dividing them into two groups according to KRAS mRNA levels using the TCGA-LUAD database (*** p ⁇ 0.001), and B is the GSE40275 database.
  • This diagram shows the results of analyzing the difference in USP47 mRNA expression levels between groups by dividing them into two groups according to KRAS mRNA levels.
  • Figure 14A shows the results of GSEA analysis on the GSE26939 data set using the GSEA_4.3.2 program
  • B shows the results of analyzing the expression level of USP47 in non-small cell lung cancer cell lines with various KRAS expression levels.
  • a in Figure 15 is the result of confirming the cell viability through WST-1 assay when the H358 lung cancer cell line sensitive to the AMG510 drug was treated in combination with the AMG510 drug and K-552, an inhibitor of USP47, and B is the result through the Bliss test. This is a drawing showing the analysis results.
  • Figure 16 shows the results of cell viability confirmed through WST-1 assay when the Calu-1 cell line, which is moderately sensitive to the AMG510 drug, was treated in combination with the AMG510 drug and K-552, an inhibitor of USP47.
  • Figure 17 is a diagram showing the results of analyzing the results of Figure 16 through the Bliss test.
  • Figure 18 shows the results of cell viability confirmed through WST-1 assay when the HCC-1171 cell line, which is moderately sensitive to the AMG510 drug, was treated in combination with the AMG510 drug and K-552, an inhibitor of USP47.
  • Figure 19 is a diagram showing the results of analyzing the results of Figure 18 through the Bliss test.
  • Figures 20A and 20B are diagrams showing the results of a colony formation assay when the Calu-1 cell line was treated with K-552, an inhibitor of AMG510 and/or USP47.
  • Figures 21A and 21B are diagrams showing the results of a colony formation assay when the HCC-1171 cell line was treated with K-552, an inhibitor of AMG510 and/or USP47.
  • Figure 22 is a diagram showing the results of confirming the protein expression level by Western blotting when the Calu-1 cell line was treated with AMG510 and/or K-552, an inhibitor of USP47
  • B is a diagram showing the results of AMG510 and AMG510 in the HCC-1171 cell line. /This is a diagram showing the results of confirming the protein expression level by Western blotting when treated with K-552, an inhibitor of USP47.
  • Figure 23A is a diagram showing the results of protein expression levels confirmed by Western blotting when the Calu-1 cell line was treated with AMG510 and/or siUSP47
  • B is a diagram showing the results of the HCC-1171 cell line treated with AMG510 and/or siUSP47. In this case, this is a diagram showing the results of confirming the protein expression level by Western blotting.
  • Lung cancer cell lines A549 cells, H359 cells, Calu-1 cells, and HEK293T cells were purchased from the Korea Cell Line Bank. All lung cancer cells were cultured in RPMI-1640 cell culture medium (GenDepot, USA) containing 10% FBS (GenDepot, USA) and 1% penicillin/streptomycin (GenDepot, USA). HEK293T cells were cultured in DMEM cell culture medium (GenDepot, USA) containing 10% FBS and 1% penicillin/streptomycin. All cells were cultured in an incubator supplying 5% carbon dioxide at a temperature of 37°C.
  • Each cell was obtained and lysed in protein lysis buffer [20mM Tris-Cl (pH 7.5), 150mM NaCl, 1mM EDTA, 1mM EGTA, 1% Triton Proteins were prepared using [3 VO 4 , 1X protease inhibitor (cOmplete, EDTA-free; Roche, Basel, Switzerland)]. 20 to 50 ⁇ g of protein was boiled with 6X SDS sample buffer at 95°C for 5 minutes and then separated by SDS-PAGE using an 8% gel. The proteins in the gel were transferred to a nitrocellulose membrane (Pall Corporation, USA), blocked using 5% non-fat milk, and incubated with primary antibodies at 4°C overnight.
  • protein lysis buffer 20mM Tris-Cl (pH 7.5), 150mM NaCl, 1mM EDTA, 1mM EGTA, 1% Triton Proteins were prepared using [3 VO 4 , 1X protease inhibitor (cOmplete, EDTA-free; Roche
  • the membrane was incubated with the secondary antibody for 1 hour at room temperature, reacted with ECL solution (Cytivia, USA), and visualized using ChemiDoc (ATTO Technology, USA).
  • Primary antibodies used in this experiment were as follows: USP47 (Bethyl Laboratories Inc.), Myc (Santa Cruz Biotechnology), HA (Santa Cruz Biotechnology), and Actin (AB frontier). Goat anti-Rabbit and Goat anti-Mouse (GenDepot, USA) were used as secondary antibodies.
  • Trizol ambient by life science
  • oligo-dt Genolution was used as a primer
  • cDNA was synthesized using ReverTra Ace qPCR RT Master Mix (TOYOBO, Japan).
  • Quantitative real-time PCR was performed using SYBR Green Real-time PCR Master Mix (TOYOBO, Japan).
  • sequence information of the primers used to perform quantitative real-time PCR in this specification is listed in the table below.
  • proteins were extracted from the cells 24 hours later and reacted with anti-Flag M2 Magnetic beads or anti-HA Agarose beads (Sigma Aldrich) at 4°C for 4 hours.
  • Western blot analysis was performed by extracting Flag protein or 2X SDS Sample buffer.
  • A549 cells were cultured in a 12-well cell culture plate and then transfected with the plasmid. After 24 hours, it was fixed with 4% formaldehyde for 20 minutes and treated with 0.5% Triton-X reagent for 10 minutes. After blocking with 3% BSA for 10 minutes, the primary antibody was treated at room temperature for 2 hours. Afterwards, the cells were treated with a secondary antibody linked to a fluorescent substance for 1 hour at room temperature, and then the cell nuclei were stained with DAPI for 10 minutes. Analysis was performed with confocal microscopy (Zeiss) at 63X magnification.
  • H358, Calu-1, and HCC-1171 cells were cultured at 8,000 (H358), 6,000-8,000 (Calu-1), and 10,000 (HCC1171) cells, respectively, in a 96-well cell culture plate. After 24 hours, each well was treated with K-552, a USP47 inhibitor, and sotorasib (AMG510), a KRAS G12C inhibitor, at a set concentration. After 72 hours, EZ-Cytox (DoGEN, EZ-3000) was diluted in the culture medium and incubated for 30 minutes, and then the absorbance was measured at a wavelength of 450 nm using a microplate absorbance reader (Bio-Rad).
  • Carbazole (2 g, 11.96 mmol), 1,3-dibromopropane (2.8 ml, 17.94 mmol), and t-BuOK (1.3 g, 11.96 mmol) were dissolved in THF (15 ml) in a reaction vessel, and then incubated at 40°C. It was heated and stirred for 10 hours. After completion of the reaction, the solution was concentrated under reduced pressure and diluted again with CH 2 Cl 2 . This solution was washed with H 2 O, dried with anhydrous Na 2 SO 4 and filtered.
  • the target compound was prepared in the same manner as Preparation Example 1, except that 1,4-dibromobutane was used instead of 1,3-dibromopropane.
  • the target compound was prepared in the same manner as Preparation Example 1, except that 1,5-dibromopentane was used instead of 1,3-dibromopropane.
  • the target compound was prepared in the same manner as Preparation Example 1, except that 1,6-dibromohexane was used instead of 1,3-dibromopropane.
  • HEK 293T cells were transduced with a plasmid expressing USP47 to overexpress USP47. Then, using immunoprecipitation, the binding between the overexpressed USP47 and the c-Myc protein present in the cells was confirmed. As a result, USP47 and c- It was confirmed that Myc existed in a bound state ( Figure 1A).
  • HEK 293T cells were transduced with a plasmid expressing USP47 and a plasmid expressing c-Myc to overexpress USP47 and c-Myc, and then the overexpressed USP47 and the overexpressed c-Myc were analyzed using immunoprecipitation. As a result of checking for binding, it was confirmed that USP47 and c-Myc existed in a bound state ( Figure 1B).
  • HEK 293T cells were transduced with a plasmid expressing USP47 wild type or mutant form and a plasmid expressing c-Myc to overexpress USP47 wild type or a mutant form without enzyme activity (USP47 C109S ) and c-Myc, As a result of confirming the binding of overexpressed wild type or mutant USP47 and overexpressed c-Myc using immunoprecipitation, it was confirmed that c-Myc was present in a bound state in both wild type and mutant USP47 ( Figure 1C).
  • A549 cells were transduced with a plasmid expressing USP47 and a plasmid expressing c-Myc to overexpress USP47 and c-Myc, and then USP47 and c-Myc were stained by immunofluorescence, and then as in Example 6.
  • USP47 and c-Myc co-localized in the cytoplasm and nucleus ( Figure 2).
  • the fragment containing the UBL3 and UBL4 domains shows weak interaction with c-Myc
  • the fragment containing the UBL1 to 3 domains or the UBL1 to 4 domains does not show interaction with c-Myc.
  • the UBL3 and UBL4 domains rather inhibit the interaction of the UBL1 and UBL2 domains with c-Myc ( Figure 4).
  • USP47 is involved in the stabilization of the oncoprotein c-Myc and can regulate its downstream activity through deubiquitination of c-Myc.
  • Example 4 the colony formation reaction described in Example 4 was used to confirm the proliferative ability of lung cancer cells.
  • A549 and Calu-1 cell lines were treated with siUSP47 to suppress the expression level of USP47, it was confirmed that colony formation was suppressed, and when c-Myc was overexpressed, the colonies were confirmed to proliferate ( Figure 10A and B).
  • c-Myc when c-Myc was inhibited, it was confirmed that colony formation was no longer reduced even if the expression level of USP47 was inhibited ( Figures 11A and B). Based on the above results, it can be seen that USP47 inhibits the proliferation of lung cancer cells by regulating the expression level of c-Myc protein.
  • KRAS known as an oncoprotein
  • non-small cell lung cancer cell lines H358, Calu-1, or HCC1171 expressing the KRAS G12C mutation were treated with Sotorasib (AMG510), a KRAS G12C inhibitor, and K-552 (compound of Formula 1), a USP47 inhibitor.
  • Sotorasib AMG510
  • KRAS G12C inhibitor a KRAS G12C inhibitor
  • K-552 compound of Formula 1
  • siUSP47 was treated to suppress the expression level of USP47 and KRAS Inhibitor was treated.
  • the expression level of USP47 was suppressed using siRNA
  • the expression level of c-Myc was decreased
  • the siUSP47-treated cells were treated with sotorasib, the expression levels of c-Myc and pERK were decreased compared to those treated alone. It was confirmed that it was significantly reduced compared to the case ( Figures 23A and B).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)

Abstract

본 발명은 USP47(Ubiquitin-specific protease47)의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 관련 질병의 예방 또는 치료용 약학 조성물 및 이의 용도에 관한 것이다. 일 양상에 따르면, USP47의 발현/활성을 저해하는 조성물을 활용하여 oncogene인 c-Myc의 발현과 그 활성을 저해시킬 수 있는 바, 이를 통해 다양한 암의 치료제 또는 이의 스크리닝에 유용하게 이용할 수 있다.

Description

USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도
본 발명은 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 관련 질병의 예방 또는 치료용 약학 조성물 및 이의 용도에 관한 것이다.
세포는 분열, 성장, 분화 그리고 세포사멸 등과 같은 복잡한 과정에 의해 조절되고 있으며 이러한 일련의 조절과정의 이상으로 비정상적인 세포의 증식이 일어나면서 세포의 암화가 진행된다. 그 중에서도 세포 분열의 이상은 암화의 직접적인 원인으로 생각되어 세포 분열 과정을 조절하는 물질들은 암의 예방 및 치료제 개발의 타깃으로 여겨지고 있다.
세포 분열 과정은 G1, S, G2, M기의 세포 주기를 순환 반복하면서 일어나는데, 각 과정마다 체크포인트가 존재하여 세포의 주기를 조절하고 있다. 세포 주기의 조절에 관여하는 단백질들은 추가적으로 인산화와 유비퀴틴화에 의해 그 활성이 조절된다. 유비퀴틴화와 함께 유비퀴틴을 떼어내는 탈유비퀴틴화에 의한 기작도 세포 분열 조절의 중요한 역할을 담당하고 있다.
일례로, 탈유비퀴틴화 효소 USP44는 cdc20를 탈유비퀴틴화 시켜 후기 개시(anaphase initiation)를 조절하고(Nature 2007;446:87681), 또 다른 탈유비퀴틴화 효소들인 USP1과 USP7은 DNA 손상 체크포인트(DNA damage checkpoint)를 조절하는 것으로 알려져 있다(Mol Cell 2005;17:3319, Nat Cell Biol 2006;8:33947). 또한 USP7은 Mdm2를 탈유비퀴틴화 시켜 p53의 안정화를 조절하는 것으로 알려져 있으며(Oncogene 2007;26:72626), USP16은 히스톤 H2A를 탈유비퀴틴화 시켜 유사분열(mitosis) 과정 중에 염색체 분리(chromosomal segregation)를 조절하는 것으로 알려져 있다(Nature 2007;449:106872).
이러한 배경하에 탈유비퀴틴화 효소 USP47에 의해 암이 조절되는 핵심인자가 c-Myc임을 발굴하였으며, 암의 대표적인 oncogene으로 알려진 c-Myc의 탈유비퀴틴화 조절을 통해 USP47 저해를 통한 암의 치료 효과를 확인하여 본 발명을 완성하였다.
일 양상은 USP47 (Ubiquitin-specific protease 47) 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 관련 질병의 예방 또는 치료용 약학 조성물을 제공한다.
다른 양상은 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 발현 또는 활성 억제용 조성물을 제공한다.
또 다른 양상은 1) USP47 단백질 또는 이의 단편을 발현하는 시험관 내 모델에 후보물질을 처리하는 단계; 및 2) 상기 모델의 c-Myc 단백질 또는 이의 단편의 발현 수준을 확인하는 단계를 포함하는, c-Myc 관련 질병 치료제 스크리닝 방법을 제공한다.
또 다른 양상은 USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정할 수 있는 제제를 포함하는, c-Myc 관련 질병 진단용 조성물을 제공한다.
또 다른 양상은 개체로부터 분리된 생물학적 시료로부터, USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계를 포함하는, c-Myc 관련 질병 진단을 위한 정보제공 방법을 제공한다.
일 양상은 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 관련 질병의 예방 또는 치료용 약학 조성물을 제공하는 것이다.
본 명세서에서의 용어 "USP47(Ubiquitin Specific Peptidase 47)"은 탈유비퀴틴화 효소로 DNA polymerase β, β-TrCP, SATB2 등을 조절하여 암화 과정을 조절하는 것으로 알려져 있다. 상기 USP47은 UniProt 번호 Q96K76의 아미노산 서열을 포함할 수 있다.
상기 USP47 단백질 또는 이의 단편은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 UCH 도메인을 포함하거나, UBL1 도메인 및 UBL2 도메인을 포함하거나, UCH 도메인, UBL1 도메인 및 UBL2 도메인을 포함하는 것일 수 있다.
상기 USP47 단백질은 서열번호 11의 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 11의 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 11의 아미노산 서열로 구성된 것일 수 있다.
상기 UCH 도메인은 서열번호 12의 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 12의 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 12의 아미노산 서열로 구성된 것일 수 있다.
상기 UBL1 도메인 및 UBL2 도메인을 포함하는 단편은 서열번호 11의 477번째 내지 753번째 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 11의 477번째 내지 753번째 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 11의 477번째 내지 753번째 아미노산 서열로 구성된 것일 수 있다.
본 명세서에서의 용어 "USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제할 수 있는 제제" 또는 "USP47 발현 또는 활성 억제제"란, USP47 단백질 또는 이의 단편을 코딩하는 유전자, mRNA 또는 단백질에 직접 또는 간접적으로 결합하여 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제할 수 있는 물질을 의미한다. 본 명세서에서, 상기 USP47의 발현 또는 활성을 억제할 수 있는 제제는 USP47의 저해제 또는 USP47의 억제제와 동일한 의미로 사용될 수 있다.
상기 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제할 수 있는 제제는 USP47의 발현 또는 활성을 억제함으로써 c-Myc의 발현 또는 활성을 억제하는 것일 수 있으며, 구체적으로 c-Myc의 분해를 촉진하는 것일 수 있다.
상기 c-Myc 단백질은 서열번호 15의 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 15의 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 15의 아미노산 서열로 구성된 것일 수 있다.
상기 제제는 특별히 이에 제한되지 않으나, 구체적인 예로, USP47 단백질 또는 이의 단편의 발현을 억제할 수 있는 제제는 USP47 유전자의 mRNA에 상보적으로 결합하는 miRNA, siRNA, shRNA, 안티센스 올리고뉴클레오티드 및 이들의 조합으로 구성된 군으로부터 선택되는 것을 특징으로 할 수 있으며, 상기 USP47 단백질 또는 이의 단편의 활성을 억제할 수 있는 제제는 USP47의 단백질에 상보적으로 결합할 수 있는 항체, 앱타머, 소분자 화합물(small molecules) 및 이들의 조합으로 구성된 군으로부터 선택되는 것을 특징으로 할 수 있다.
본 명세서에서의 용어 "miRNA, siRNA 또는 shRNA"란, RNA 방해 또는 유전자 사일런싱(silencing)을 매개하기 위하여 주로 목적 유전자로부터 전사된 mRNA에 결합하여, 상기 mRNA의 해독을 저해하는 핵산 분자를 의미한다 상기 siRNA 또는 shRNA는 표적 유전자의 발현을 해독수준에서 억제할 수 있기 때문에, 효율적인 유전자 넉다운(knockdown) 방법 또는 유전자치료 방법에 사용될 수 있으며, 본 명세서에서의 목적상, USP47의 발현을 억제하는데 사용될 수 있다.
본 명세서에서의 용어 "안티센스 올리고뉴클레오티드"란 특정 mRNA의 서열에 상보적인 핵산 서열을 함유하고 있는 DNA 또는 RNA 또는 이들의 유도체를 의미하는데, mRNA 내의 상보적인 서열에 결합하여 mRNA의 단백질로의 번역을 저해하는 효과를 나타내며, 본 명세서에서의 목적상, USP의 발현을 억제하는데 사용될 수 있다.
본 명세서에서의 용어 "항체"란, 단백질 또는 펩티드 분자의 항원성 부위에 특이적으로 결합할 수 있는 단백질성 분자를 의미하는데, 이러한 항체는, 각 유전자를 통상적인 방법에 따라 발현벡터에 클로닝하여 상기 마커 유전자에 의해 코딩되는 단백질을 얻고, 얻어진 단백질로부터 통상적인 방법에 의해 제조될 수 있다. 본 명세서에 있어서, 상기 항체는 활성화된 USP47 단백질에 결합함으로써, 상기 단백질의 활성을 억제할 수 있는 수단으로 해석될 수 있다. 구체적인 예로, USP47에 특이적으로 결합될 수 있는 폴리클로날 항체, 모노클로날 항체 또는 항원 결합성을 갖는 것이면 그것의 일부도 상기 항체에 포함되고, 모든 면역 글로불린 항체가 포함될 수 있을 뿐만 아니라 인간화 항체 등의 특수 항체를 포함할 수도 있다. 아울러, 상기 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 완전한 형태뿐만 아니라 항체 분자의 기능적인 단편을 포함하는 형태가 될 수도 있다. 항체 분자의 기능적인 단편이란 적어도 항원 결합 기능을 보유하고 있는 단편을 의미하며 Fab, F(ab'), F(ab') 2 및 Fv 등이 될 수 있다.
본 명세서에서의 용어 "앱타머(aptamer)"란 소정의 표적 분자에 대한 결합 활성을 갖는 핵산 분자를 의미한다. 상기 앱타머는 RNA, DNA, 수식(modified) 핵산 또는 이들의 혼합물일 수 있으며, 직쇄상 또는 환상의 형태일 수 있는데, 대체로, 상기 앱타머를 구성하는 뉴클레오티드의 서열이 짧을수록 화학합성 및 대량 생산이 보다 용이하고, 비용면에서의 장점이 우수하며, 화학수식이 용이하고, 생체 내 안정성이 우수하며, 독성이 낮다고 알려져 있다. 본 명세서에 있어서, 상기 앱타머는 활성화된 USP 단백질에 결합함으로써, 상기 단백질의 활성을 억제할 수 있는 수단으로 해석될 수 있다.
본 명세서의 용어 "소분자 화합물(small molecules)"이란, 분자량이 작은 유기 화합물로, 단백질 등의 생체 고분자에 결합하여 그 기능을 조절하는 분자를 의미한다. 천연유래이거나 인공적으로 합성될 수 있으며, 단백질의 기능을 저해하거나 단백질-단백질 상호작용을 방해할 수도 있으나, 이에 제한되지 않는다. 본 명세서의 목적상, 상기 소분자 화합물은 활성화된 USP 단백질의 활성을 억제하는 분자라면 제한 없이 포함하며, 구체적인 예로 활성화된 USP에 결합하여 활성을 억제하는 분자를 의미하나, 이에 제한되지 않는다.
상기 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제는 K-552, 이의 약학적으로 허용가능한 염, 이의 수화물, 및 이의 용매화물로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
본 명세서에서의 용어 "K-552" 또는 "K-552 화합물"은 카바졸 유도체로서, 9-(3-(4-(2-메톡시페닐)피페라진-1-일)프로필)-9H-카바졸로 명명되며, 하기 화학식 1로 표현될 수 있다.
[화학식 1]
Figure PCTKR2023016053-appb-img-000001
본 명세서에서의 용어 "약학적으로 허용가능한 염"이란, 양이온과 음이온이 정전기적 인력에 의해 결합하고 있는 물질인 염 중에서도 약제학적으로 사용될 수 있는 형태의 염을 의미하는데, 통상적으로 금속염, 유기 염기와의 염, 무기산과의 염, 유기산과의 염, 염기성 또는 산성 아미노산과의 염 등이 될 수 있다. 예를 들어, 금속염으로는 알칼리 금속염(나트륨염, 칼륨염 등), 알칼리 토금속염(칼슘염, 마그네슘염, 바륨염 등), 알루미늄염 등이 될 수 있고; 유기 염기와의 염으로는 트리에틸아민, 피리딘, 피콜린, 2,6-루티딘, 에탄올아민, 디에탄올아민, 트리에탄올아민, 시클로헥실아민, 디시클로헥실아민, N,N-디벤질에틸렌디아민 등과의 염이 될 수 있으며; 무기산과의 염으로는 염산, 브롬화수소산, 질산, 황산, 인산 등과의 염이 될 수 있고; 유기산과의 염으로는 포름산, 아세트산, 트리플루오로아세트산, 프탈산, 푸마르산, 옥살산, 타르타르산, 말레인산, 시트르산, 숙신산, 메탄술폰산, 벤젠술폰산, p-톨루엔술폰산 등과의 염이 될 수 있으며; 염기성 아미노산과의 염으로는 아르기닌, 라이신, 오르니틴 등과의 염이 될 수 있고; 산성 아미노산과의 염으로는 아스파르트산, 글루탐산 등과의 염이 될 수 있다. 특히 바람직한 염으로는, 화합물이 그 내에 산성관능기를 가지는 경우, 알칼리 금속염 (예컨대, 나트륨염, 칼륨염 등), 알칼리 토금속염 (예컨대, 칼슘염, 마그네슘염, 바륨염 등) 등과 같은 무기염, 및 암모늄염과 같은 유기 염이 있으며, 화합물이 그 내에 염기성 관능기를 가지는 경우, 염산, 브롬화수소산, 질산, 황산, 인산 등과 같은 무기산과의 염, 아세트산, 프탈산, 푸마르산, 옥살산, 타르타르산, 말레인산, 시트르산, 숙신산, 메탄술폰산, p-톨루엔술폰산 등과 같은 유기산과의 염이 있다.
상기 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제 또는 상기 제제를 포함하는 조성물은 c-Myc의 분해를 촉진하는 것일 수 있으며, 구체적으로 USP47의 c-Myc 탈유비퀴틴화 활성을 억제하여 c-Myc의 유비퀴틴화를 촉진하는 것일 수 있다.
본 명세서에서의 용어 "c-Myc(cellular Myc)"은 Myc 패밀리에 속하는 단백질로 전사인자로 작용하며 정상세포에서는 거의 발현하지 않으며 주로 암세포에서 암의 발생, 발달 및 진화에 관여하는 종양형성 인자 (oncogene)로 작용하는 것으로 알려져 있다. 상기 c-Myc은 UniProt 번호 Q6LBK7의 아미노산 서열을 포함할 수 있다.
상기 USP47의 발현 또는 활성을 억제하는 제제 또는 상기 제제를 포함하는 조성물은 c-Myc의 발현 또는 활성을 억제함으로서 c-Myc의 다운스트림 경로의 신호전달 경로의 발현 또는 활성을 억제할 수 있으며, 구체적으로 c-Myc의 표적 유전자로서 CCNE1, LDHA 등의 발현 또는 활성을 억제하는 것일 수 있다.
상기 조성물은 K-RAS의 발현 또는 활성을 억제하는 제제를 추가로 포함하는 것일 수 있다.
본 명세서에서의 용어 "K-RAS (Kirsten rat sarcoma virus, KRAS)"은 포의 증식, 성숙, 사멸 등 세포 신호전달경로에 관여하는 RAS 단백질 중 하나이다. KRAS 단백질은 신호전달 분자인 GTP와 결합하며 전등의 스위치처럼 '켜짐'과 '꺼짐' 상태를 전환하며 세포의 성장을 조절하지만, KRAS 단백질에 변이가 발생하면 암 관련 세포 성장 신호가 '켜짐' 상태로 지속되면서 암을 유발한다. KRAS 변이는 KRAS G12C, KRAS G12V 및 KRAS G12D 등이 알려져 있다. 상기 K-RAS는 UniProt 번호 P01116의 아미노산 서열을 포함할 수 있다.
상기 K-RAS의 발현 또는 활성을 억제하는 제제는 K-RAS의 야생형 및/또는 돌연변이형 발현 또는 활성을 억제하는 것일 수 있으며, 구체적으로 상기 K-RAS 돌연변이는 K-RAS 야생형을 암호화하는 유전자의 염기서열의 12번째 코돈 위치에서 글리신(G)이 시스테인(C)으로 치환된 돌연변이(KRAS G12C)일 수 있다. 구체적으로 상기 K-RAS 돌연변이를 암호화하는 염기서열은 서열번호 13 또는 서열번호 14의 염기서열일 수 있다.
상기 K-RAS의 발현 또는 활성을 억제하는 제제는 소토라십(Sotorasib), 아다그라십 (Adagrasib), GFH925, LY3499446, LY3537982, JDQ443, JAB-21822, YL-15293, ELI-002 7P, HBI-2438, JNJ-74699157, D3S-001, BI 1823911, IBI351, MK-1084, GDC-6036, HS-10370, D-1553 및 GEC255로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 소토라십, 아다그라십, GFH925, LY3499446, LY3537982, JDQ443, GDC-6036 및 D-1553로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
상기 소토라십(Sotorasib)은 하기 화학식 2로 표현되며, 6-Fluoro-7-(2-fluoro-6-hydroxyphenyl)-1-[4-methyl-2-(1-methylethyl)-3-pyridinyl]-4-[(2S)-2-methyl-4-(1-oxo-2-propen-1-yl)-1-piperazinyl]pyrido[2,3-d]pyrimidin-2(1H)-one로 명명된다(CAS number: 2252403-56-6).
[화학식 2]
Figure PCTKR2023016053-appb-img-000002
상기 아다그라십 (Adagrasib)은 하기 화학식 3으로 표현되며, {(2S)-4-[7-(8-chloronaphthalen-1-yl)-2-{[(2S)-1methylpyrrolidin-2-yl]methoxy}-5,6,7,8tetrahydropyrido[3,4-d]pyrimidin-4-yl]-1-(2-fluoroprop2-enoyl)piperazin-2-yl}acetonitrile로 명명된다(CAS number: 2326521-71-3).
[화학식 3]
Figure PCTKR2023016053-appb-img-000003
상기 LY3537982은 하기 화학식 4로 표현되며, 4-(2-acryloyl-9-chloro-7-fluoro-5-oxo-2,3,11,11a-tetrahydro-1H,5H-benzo[f]imidazo[5,1-c][1,4]oxazepin-8-yl)-2-amino-7-fluorobenzo[b]thiophene-3-carbonitrile로 명명된다(CAS number: 2414198-64-2).
[화학식 4]
Figure PCTKR2023016053-appb-img-000004
상기 LY3499446은 하기 화학식 5로 표현되며, 1-[4-[7-(2-amino-7-fluoro-1,3-benzothiazol-4-yl)-6-chloro-8-fluoroquinazolin-4-yl]piperazin-1-yl]prop-2-en-1-one;methanesulfonic acid로 명명된다(CAS number: 2409131-50-4).
[화학식 5]
Figure PCTKR2023016053-appb-img-000005
상기 GFH925은 하기 화학식 6으로 표현되며, (7R)-16-chloro-14-fluoro-15-(2-fluoro-6-hydroxyphenyl)-9-methyl-5-prop-2-enoyl-2,5,9,12-tetrazatetracyclo[8.8.0.02,7.013,18]octadeca-1(10),11,13,15,17-pentaen-8-one로 명명된다 (CAS number: 2349393-95-7).
[화학식 6]
Figure PCTKR2023016053-appb-img-000006
상기 JDQ443은 하기 화학식 7로 표현되며, (1-[6-[4-(5-chloro-6-methyl-1H-indazol-4-yl)-5-methyl-3-(1-methylindazol-5-yl)pyrazol-1-yl]-2-azaspiro[3.3]heptan-2-yl]prop-2-en-1-one로 명명된다 (CAS number: 2653994-08-0).
[화학식 7]
Figure PCTKR2023016053-appb-img-000007
상기 GDC-6036 (Divarasib)은 하기 화학식 8로 표현되며, 1-[(3S)-4-[7-[6-amino-4-methyl-3-(trifluoromethyl)pyridin-2-yl]-6-chloro-8-fluoro-2-[[(2S)-1-methylpyrrolidin-2-yl]methoxy]quinazolin-4-yl]-3-methylpiperazin-1-yl]prop-2-en-1-one로 명명된다 (CAS number: 2417987-45-0).
[화학식 8]
Figure PCTKR2023016053-appb-img-000008
상기 D-1553 (Garsorasib)은 하기 화학식 9로 표현되며, 7-(2-amino-6-fluorophenyl)-1-(4,6-dicyclopropylpyrimidin-5-yl)-4-[(2S,5R)-2,5-dimethyl-4-prop-2-enoylpiperazin-1-yl]-6-fluoropyrido[2,3-d]pyrimidin-2-one로 명명된다 (CAS number: 2559761-14-5).
[화학식 9]
Figure PCTKR2023016053-appb-img-000009
상기 c-Myc 관련 질병은 폐암, 대장암 및 유방암으로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 폐암일 수 있다. 또한, 상기 폐암은 비소세포성 폐암일 수 있다.
상기 c-Myc 관련 질병은 c-Myc 단백질 또는 이를 암호화하는 유전자의 과발현 또는 과활성으로 인해 발병하는 질병을 의미하는 것일 수 있다. 또한, 상기 c-Myc 관련 질병은 USP47 과발현 또는 과활성으로 인해 발병하는 것일 수 있다.
상기 조성물은 암 또는 암세포의 성장, 증식, 전이 및 침투로 이루어진 군에서 선택된 하나 이상을 억제하는 것일 수 있으며, 구체적으로 c-Myc의 발현 및/또는 활성을 억제하여 암세포의 성장, 증식, 전이 또는 침투를 억제함으로서 폐암, 대장암 및 유방암 등의 질병을 치료 또는 예방하는 것일 수 있다.
본 명세서에서의 용어 "치료"는, 본 발명의 조성물의 투여에 의해 c-Myc 관련 질병의 증세가 호전되거나 이롭게 변경하는 모든 행위를 의미한다.
본 명세서에서의 용어 "예방"은, 본 발명의 조성물의 투여에 의해 c-Myc 관련 질병 또는 질병의 발병 가능성이 억제되거나 지연되는 모든 행위를 의미한다.
상기 약학적 조성물은 약학적으로 허용 가능한 담체를 포함할 수 있다. 상기 "약학적으로 허용 가능한 담체"란 생물체를 자극하지 않으면서, 주입되는 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 의미할 수 있다. 여기서 "약학적으로 허용되는"의 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 의미이다. 상기 약학적 조성물에 사용 가능한 상기 담체의 종류는 당해 기술 분야에서 통상적으로 사용되고 약학적으로 허용되는 담체라면 어느 것이든 사용할 수 있다. 상기 담체의 비제한적인 예로는, 락토스, 덱스트로스, 말토 덱스트린, 수크로스, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 글리세롤, 에탄올, 전분, 아카시아 고무, 알기네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로오스, 메틸 셀룰로스, 미정질 셀룰로스, 폴리비닐 피롤리돈, 물, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사 용액, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트, 또는 광물유 등을 들 수 있다. 이들은 단독으로 사용되거나 2 종 이상을 혼합하여 사용될 수 있다. 상기 약학적 조성물은 유효성분 이외에 약학적으로 허용되는 담체를 포함하여 당업계에 공지된 통상의 방법으로 투여 경로에 따라 경구용 제형 또는 비경구용 제형으로 제조될 수 있다. 상기 약학적 조성물은 각각 통상의 방법에 따라 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽, 에어로졸 등의 경구형 제형, 외용제, 좌제 또는 멸균 주사용액의 형태로 제제화하여 사용될 수 있다.
상기 약학적 조성물을 제제화할 경우, 일반적으로 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 또는 계면활성제 등의 희석제 또는 부형제를 사용하여 조제될 수 있으나, 이에 제한되지 않을 수 있다.
상기 약학적 조성물이 경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 분말, 과립, 정제, 환제, 당의정제, 캡슐제, 액제, 겔제, 시럽제, 현탁액, 웨이퍼 등의 제형으로 제조될 수 있다. 이때 약학적으로 허용되는 적합한 담체의 예로서는 락토스, 글루코스, 슈크로스, 덱스트로스, 솔비톨, 만니톨, 자일리톨 등의 당류, 옥수수 전분, 감자 전분, 밀 전분 등의 전분류, 셀룰로오스, 메틸셀룰로오스, 에틸셀룰로오스, 나트륨 카르복시메틸셀룰로오스, 하이드록시프로필메틸셀룰로오스 등의 셀룰로오스류, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 마그네슘 스테아레이트, 광물유, 맥아, 젤라틴, 탈크, 폴리올, 식물성유 등을 들 수 있다. 제제화활 경우 필요에 따라 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 및/또는 부형제를 포함하여 제제화할 수 있다.
상기 약학적 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사제로 제제화활 경우 적합한 담체로서는 멸균수, 에탄올, 글리세롤이나 프로필렌 글리콜 등의 폴리올 또는 이들의 혼합물을 들 수 있으며, 바람직하게는 링거 용액, 트리에탄올 아민이 함유된 PBS(phosphate buffered saline)나 주사용 멸균수, 5% 덱스트로스 같은 등장 용액 등을 사용할 수 있다. 경피 투여제로 제제화할 경우 연고제, 크림제, 로션제, 겔제, 외용액제, 파스타제, 리니멘트제, 에어롤제 등의 형태로 제제화될 수 있다. 비강 흡입제의 경우 디클로로플루오로메탄, 트리클로로플루오로메탄, 디클로로테트라플루오로에탄, 이산화탄소 등의 적합한 추진제를 사용하여 에어로졸 스프레이 형태로 제제화될 수 있으며, 좌제로 제제화할 경우 그 기제로는 위텝솔(witepsol), 트윈(tween) 61, 폴리에틸렌글리콜류, 카카오지, 라우린지, 폴리옥시에틸렌 소르비탄 지방산 에스테르류, 폴리옥시에틸렌 스테아레이트류, 소르비탄 지방산 에스테르류 등이 사용될 수 있다.
상기 약학적 조성물은 약학적으로 유효한 양으로 투여될 수 있다. 상기 용어 "약학적으로 유효한 양"이란 의학적 치료 또는 예방에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료 또는 예방하기에 충분한 양을 의미하며, 유효 용량 수준은 질환의 중증도, 약물의 활성, 환자의 연령, 체중, 건강, 성별, 환자의 약물에 대한 민감도, 사용된 본 발명 조성물의 투여 시간, 투여 경로 및 배출 비율 치료기간, 사용된 본 발명의 조성물과 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 약학적 조성물은 단독으로 투여하거나 공지된 c-Myc 관련 질병에 대한 치료 효과를 나타내는 것으로 알려진 성분과 병용하여 투여될 수 있다. 상기 요소를 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하다.
상기 약학적 조성물의 투여량은 사용목적, 질환의 중독도, 환자의 연령, 체중, 성별, 기왕력, 또는 유효성분으로서 사용되는 물질의 종류 등을 고려하여 당업자가 결정할 수 있다. 예를 들어, 본 발명의 약학적 조성물은 성인 1인당 약 0.1ng 내지 약 1,000 mg/kg, 바람직하게는 1 ng 내지 약 100 mg/kg로 투여할 수 있고, 본원의 조성물의 투여빈도는 특별히 이에 제한되지 않으나, 1일 1회 투여하거나 또는 용량을 분할하여 수회 투여할 수 있다. 상기 투여량 또는 투여횟수는 어떠한 면으로든 본원의 범위를 한정하는 것은 아니다.
다른 양상은 상기 c-Myc 관련 질병 치료 또는 예방용 약학 조성물을 개체에 투여하는 단계를 포함하는 c-Myc 관련 질병 치료 또는 예방 방법을 제공하는 것이다. 상기에서 설명한 내용과 동일한 부분은 상기 방법에도 공히 적용된다.
본 명세서에서 사용되는 용어 "개체"는 c-Myc 관련 질병이 발병되거나 발병할 위험이 있는 개, 고양이, 쥐, 가축, 인간 등을 포함하는 포유동물, 조류, 파충류, 양식어류 등을 제한 없이 포함할 수 있으며, 상기 개체는 인간을 제외하는 것일 수 있다.
상기 약학적 조성물은 약학적으로 유효한 양으로 단일 또는 다중 투여될 수 있다. 이때, 조성물은 액제, 산제, 에어로졸, 주사제, 수액제(링겔), 캡슐제, 환제, 정제, 좌제 또는 패치의 형태로 제형화되어 투여할 수 있다. 상기 c-Myc 관련 질병 예방 또는 치료용 약학 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여도 투여될 수 있다.
상기 약학적 조성물은 특별히 이에 제한되지 않으나, 목적하는 바에 따라 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 경피패치투여, 경구 투여, 비내 투여, 폐내 투여, 직장내 투여 등의 경로를 통해 투여 될 수 있다. 다만, 경구 투여 시에는 제형화되지 않은 형태로도 투여할 수 있고, 위산에 의하여 상기 약학 조성물의 유효성분이 변성 또는 분해될 수 있기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화된 형태 또는 경구용 패치형태로 구강내에 투여할 수도 있다. 또한, 상기 조성물은 활성 물질이 표적세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
또 다른 양상은 USP47의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 발현 또는 활성 억제용 조성물을 제공하는 것이다. 상기에서 설명한 내용과 동일한 부분은 상기 조성물에도 공히 적용된다.
상기 USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제는 K-552, 이의 약학적으로 허용가능한 염, 이의 수화물, 및 이의 용매화물로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
상기 조성물은 K-RAS의 발현 또는 활성을 억제하는 제제를 추가로 포함하는 것일 수 있다.
상기 K-RAS의 발현 또는 활성을 억제하는 제제는 K-RAS 야생형 및/또는 돌연변이형의 발현 또는 활성을 억제하는 것일 수 있으며, 구체적으로 KRAS G12C를 억제하는 것일 수 있다.
상기 K-RAS의 발현 또는 활성을 억제하는 제제는 Sotorasib, Adagrasib, GFH925, JAB-21822, YL-15293, ELI-002 7P, HBI-2438, JDQ443, JNJ-74699157, D3S-001, BI 1823911, IBI351, MK-1084, LY3499446, JAB-21822, LY3537982, GDC-6036, HS-10370, D-1553 및 GEC255로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있다.
또 다른 양상은 1) USP47 단백질 또는 이의 단편을 발현하는 시험관 내 모델에 후보물질을 처리하는 단계; 및 2) 상기 모델의 c-Myc 단백질 또는 이의 단편의 발현 수준을 확인하는 단계를 포함하는, c-Myc 관련 질병 치료제 스크리닝 방법을 제공한다. 상기에서 설명한 내용과 동일한 부분은 상기 방법에도 공히 적용된다.
상기 시험관 내 모델은 USP47 단백질 또는 이의 단편을 발현하는 세포일 수 있다. 또한, 상기 시험관 내 모델은 USP47 단백질 또는 이의 단편의 발현 또는 활성이 증가된 세포일 수 있으며, 구체적으로 상기 모델은 음성 대조군 또는 정상군에 비해 USP47 단백질 또는 이의 단편의 발현 또는 활성이 증가되어 과발현 또는 과활성된 것일 수 있다.
상기 USP47 단백질 또는 이의 단편의 발현 또는 활성이 증가된 세포는 USP47 단백질 또는 이의 단편의 발현 또는 활성이 증가된 개체로부터 수득하거나, 정상 세포에 USP47 단백질 또는 이의 단편을 과발현 또는 과활성시킴으로서 수득할 수 있다.
상기 USP47 단백질 또는 이의 단편은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 UCH 도메인을 포함하거나, UBL1 도메인 및 UBL2 도메인을 포함하는 단편을 포함하거나, 및/또는 UCH 도메인, UBL1 도메인 및 UBL2 도메인을 포함하는 단편을 포함하는 것일 수 있다.
또한, 상기 USP47 단백질 또는 이의 단편은 USP47의 UBL3 도메인 및 UBL4 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 영역 또는 단편을 포함하지 않는 것일 수 있다.
상기 UBL3 도메인을 포함하는 영역 또는 단편은 서열번호 11의 753번째 내지 934번째 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 11의 753번째 내지 934번째 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 11의 753번째 내지 934번째 아미노산 서열로 구성된 것일 수 있다.
상기 UBL4 도메인을 포함하는 영역 또는 단편은 서열번호 11의 934번째 내지 1287번째 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 11의 934번째 내지 1287번째 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 11의 934번째 내지 1287번째 아미노산 서열로 구성된 것일 수 있다.
상기 UBL3 도메인 및 UBL4 도메인을 포함하는 영역 또는 단편은 서열번호 11의 753번째 내지 1287번째 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 11의 753번째 내지 1287번째 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 11의 753번째 내지 1287번째 아미노산 서열로 구성된 것일 수 있다.
일 구현예에 있어서, 상기 UBL3 도메인 및/또는 UBL4 도메인은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인의 c-Myc과의 상호작용을 억제하는 것을 확인하였는 바, c-Myc 분해를 유도하는 치료제 스크리닝에 있어서 효율을 감소시킬 수 있다.
상기 시험관 내 모델은 c-Myc 단백질 또는 이의 단편을 발현하는 세포일 수 있다. 또한, 상기 시험관 내 모델은 c-Myc 단백질 또는 이의 단편의 발현 또는 활성이 증가된 세포일 수 있으며, 구체적으로 상기 모델은 음성 대조군 또는 정상군에 비해 c-Myc 단백질 또는 이의 단편의 발현 또는 활성이 증가된 것일 수 있다.
상기 c-Myc 단백질 또는 이의 단편의 발현 또는 활성이 증가된 세포는 c-Myc 단백질 또는 이의 단편의 발현 또는 활성이 증가된 개체로부터 수득하거나, 정상 세포에 c-Myc 단백질 또는 이의 단편을 과발현 또는 과활성시킴으로서 수득할 수 있다.
상기 c-Myc 단백질 또는 이의 단편은 c-Myc의 bHLH-LZ 도메인을 포함하는 것일 수 있다.
상기 bHLH-LZ 도메인을 포함하는 영역 또는 단편은 서열번호 15의 354번째 내지 434번째 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 15의 354번째 내지 434번째 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 15의 354번째 내지 434번째 아미노산 서열로 구성된 것일 수 있다.
또한, 상기 bHLH-LZ 도메인은 서열번호 16의 아미노산 서열을 포함하는 것일 수 있으며, 구체적으로 상기 서열번호 16의 아미노산 서열과 70% 이상, 75% 이상, 80% 이상, 85% 이상, 90% 이상 또는 95% 이상 상동성을 나타내는 것일 수 있으며, 보다 구체적으로 서열번호 16의 아미노산 서열로 구성된 것일 수 있다.
일 구현예에 있어서, 상기 시험관 내 모델은 1) USP47 단백질 또는 이의 단편; 및 2) c-Myc 단백질 또는 이의 단편이 발현되거나 과발현되는 세포일 수 있다.
상기 후보물질은 USP47 단백질 또는 이의 단편의 발현 및/또는 활성을 저해하는 제제일 수 있다.
상기 방법은 후보 물질 처리에 따라 상기 모델의 USP47 단백질 또는 이의 단편의 발현/활성 수준을 확인하는 단계를 추가로 포함하는 것일 수 있다.
상기 방법에 있어서, 3) 상기 후보물질 처리에 따라 c-Myc 단백질 또는 이의 단편의 발현 수준이 감소하는 경우, 상기 후보물질을 c-Myc 관련 질병 치료제로 판단하는 단계를 추가로 포함하는 것일 수 있다. 구체적으로, 상기 단계는 상기 후보물질 처리에 따라 c-Myc의 선택적 스플라이싱 수준이 증가하는 경우, 상기 후보물질을 c-Myc 관련 질병 치료제로 판단하는 단계를 추가로 포함하는 것일 수 있다.
상기 후보물질은 USP47 단백질 또는 이의 단편과 c-Myc 단백질 또는 이의 단편의 상호작용 및/또는 결합을 저해하는 제제일 수 있다.
상기 방법은 2) USP47 단백질 또는 이의 단편과 c-Myc 단백질 또는 이의 단편의 상호작용 및/또는 결합 수준을 확인하는 단계를 포함하는 것일 수 있다.
상기 방법에 있어서, 3) 상기 후보물질 처리에 따라 USP47 단백질 또는 이의 단편과 c-Myc 단백질 또는 이의 단편의 상호작용 및/또는 결합 수준이 감소하는 경우, 상기 후보물질을 c-Myc 관련 질병 치료제로 판단하는 단계를 추가로 포함하는 것일 수 있다.
상기 후보물질은 USP47 단백질 또는 이의 단편의 탈유비퀴틴화 활성을 저해하는 제제일 수 있다.
상기 방법은 2) c-Myc 단백질 또는 이의 단편의 유비퀴틴화 및/또는 탈유비퀴틴화 수준을 확인하는 단계를 포함하는 것일 수 있다.
상기 방법에 있어서, 3) 상기 후보물질 처리에 따라 c-Myc 단백질 또는 이의 단편의 유비퀴틴화 수준이 증가하거나 및/또는 탈유비퀴틴화 수준이 감소하는 경우, 상기 후보물질을 c-Myc 관련 질병 치료제로 판단하는 단계를 추가로 포함하는 것일 수 있다.
일 구현예에 있어서, 상기 c-Myc의 발현 및 선택적 탈유비퀴틴화를 확인하는 것은 세포내에서 c-Myc을 pull down assay로 농축한 후 웨스턴 블랏팅을 이용하여 c-Myc의 발현 또는 활성의 증가 및 감소 수준을 확인하는 것일 수 있다.
상기 c-Myc 관련 질병은 폐암, 대장암 및 유방암으로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 폐암일 수 있다. 또한, 상기 폐암은 비소세포성 폐암일 수 있다.
또 다른 양상은 시험관 내(in vitro)에서 암세포에 USP47의 발현 또는 활성을 억제하는 제제를 처리하여 암세포 내 c-Myc의 발현을 감소시키는 방법을 제공한다. 상기에서 설명한 내용과 동일한 부분은 상기 방법에도 공히 적용된다.
상기 암세포는 폐암 세포, 유방암 세포 및 대장암 세포로 구성된 군에서 선택된 하나 이상을 포함할 수 있으며, 구체적으로 폐암 세포일 수 있다.
또 다른 양상은 시험관 내(in vitro)에서 암세포에 USP47의 발현 또는 활성을 억제하는 제제를 처리하여 암세포의 c-Myc의 발현을 감소시키는 단계를 포함하는, 암세포의 증식, 전이 또는 침투를 억제하는 방법을 제공한다. 상기에서 설명한 내용과 동일한 부분은 상기 방법에도 공히 적용된다.
상기 암세포는 폐암 세포, 유방암 세포 및 대장암 세포로 구성된 군에서 선택된 하나 이상을 포함할 수 있으며, 구체적으로 폐암 세포일 수 있다.
또 다른 양상은 USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정할 수 있는 제제를 포함하는, c-Myc 관련 질병 진단용 조성물을 제공한다. 상기에서 설명한 내용과 동일한 부분은 상기 조성물에도 공히 적용된다.
상기 조성물은 USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 검출 또는 측정함으로서 특정 개체의 c-Myc 관련 질병을 진단하거나 및/또는 예후를 예측할 수 있다.
상기 조성물은 USP47 단백질 또는 이의 단편과 c-Myc 단백질 또는 이의 단편의 상호작용 및/또는 결합 수준을 검출 또는 측정함으로서 특정 개체의 c-Myc 관련 질병을 진단하거나 및/또는 예후를 예측할 수 있다.
상기 조성물은 USP47 단백질 또는 이의 단편의 탈유비퀴틴화 활성을 검출 또는 측정함으로서 특정 개체의 c-Myc 관련 질병을 진단하거나 및/또는 예후를 예측할 수 있다.
본 명세서에서의 용어 "진단"은 병리 상태의 존재 또는 특징을 확인하는 것을 의미한다. 본 발명의 목적상,　진단이란 c-Myc 관련 질병의 발병 여부를 판별하는 것을 의미하는 것일 수 있다.
본 명세서에서의 용어 "예후"는 병세의 진행, 회복에 관한 예측을 의미하는 것으로, 전망 내지는 예비적 평가를 말한다. 본 발명의 목적상, 예후란 c-Myc 관련 질병의 치료 후 해당 개체에서 치료 성공 여부, 생존, 재발, 전이, 약물반응성, 내성 등과 같은 여부를 판단하는 것을 의미한다. 즉, 의학적 귀추(예컨대, 장기 생존 가능성, 무병생존율 등)에 대한 예상을 의미하며, 양성적 예후(긍정적 예후) 또는 음성적 예후(부정적 예후)를 포함하며, 상기 음성적 예후는 재발, 종양 성장, 전이, 약 저항성 등의 병의 진행 또는 치명성(mortality)을 포함하고, 양성적 예후는 질병이 없는 상태 등의 질병의 차도, 종양 퇴행 등의 질병의 개선 또는 안정화(stabilization)를 포함한다.
본 명세서에서의 용어 "예측"은 의학적 귀추에 대하여 미리 헤아려 짐작하는 것을 의미하며, 본 발명의 목적 상 c-Myc 관련 질병으로　진단받은 환자의 병의 경과(병의 진행, 개선, 암의 재발, 종양 성장, 약 저항성)를 미리 짐작하는 것을 의미하는 것일 수 있다.
본 명세서에서의 용어 "발현 수준의 측정"은 특정 단백질(펩타이드) 또는 상기 단백질을 암호화하는 유전자의 존재 여부, 발현 여부 또는 발현 정도를 측정하는 것으로서, 구체적으로 USP47 단백질, 이의 단편 또는 이를 암호화하는 mRNA 또는 유전자의 발현 수준을 측정하는 것일 수 있다.
상기 진단용 조성물을 이용하여 발현 수준을 측정할 수 있는 상기 USP47 단백질 또는 이의 단편은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 것일 수 있으며, 구체적으로 UCH 도메인을 포함하거나, UBL1 도메인 및 UBL2 도메인을 포함하는 단편을 포함하거나, UCH 도메인, UBL1 도메인 및 UBL2 도메인을 포함하는 단편을 포함하는 것일 수 있다.
상기 단백질의 발현 수준을 측정하는 방법은 웨스턴 블랏팅(Western blotting), ELISA(enzyme linked immunosorbent assay), 방사선면역분석(RIA: radioimmunoassay), 방사 면역 확산법(radical immunodiffusion), 오우크테로니면역 확산법(Ouchterlony immunodiffusion), 로케트 면역전기영동(rocket immunoeletrophoresis), 면역조직화학염색법(immunohistochemical staining), 면역침전분석법(immunoprecipitation assay), 보체 고정 분석법(complenent Fixation Assay), 면역형광법(immunofluorescence), 면역크로마토그래피법(immunochromatography), FACS 분석법(fluorescenceactivated cell sorter analysis), 단백질 칩 방법(protein chip technology) 또는 바이오센서(biosensor)인 것일 수 있다.
상기 mRNA 또는 유전자의 발현 수준을 측정하는 방법은 역전사효소 중합반응(RT-PCR), 경쟁적 역전사효소 중합효소반응(competitive RT-PCR), 실시간 역전사 효소 중합효소반응(real time quantitative RT-PCR), 정량적 중합효소반응(quantitative RT-PCR), RNase 보호 분석법(RNase protection method), 노던 블랏팅(Nothern blotting), DNA 칩 방법(DNA chip technology) 또는 바이오센서(biosensor)인 것일 수 있다.
본 명세서에서의 용어 "발현 수준을 측정할 수 있는 제제"는 특정 단백질 또는 이를 암호화하는 유전자의 발현 수준을 확인하기 위하여 사용될 수 있는 분자를 의미하며, 구체적으로 상기 단백질 또는 상기 유전자를 검출 및/또는 증폭할 수 있는 제제를 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 "특정 단백질 또는 이를 암호화하는 유전자를 검출할 수 있는 제제"는 상기 특정 유전자 또는 단백질에 특이적으로 결합하여 인식할 수 있도록 하거나, 검출하여 증폭시킬 수 있는 제제를 의미하고, "특정 유전자 또는 단백질을 증폭할 수 있는 제제"는 상기 특정 유전자 또는 단백질의 복제를 반복하여 그 수를 증가시킬 수 있는 제제를 의미하며, 예를 들어 상기 유전자를 포함하는 폴리뉴클레오티드를 특이적으로 증폭할 수 있는 프라이머 또는 특이적으로 결합할 수 있는 프로브를 의미하는 것일 수 있으나, 이에 제한되는 것은 아니다.
상기 진단용 조성물은 USP47 단백질, 이의 단편 또는 이를 암호화하는 mRNA 또는 유전자에 특이적으로 결합하는 프라이머, 프로브, 뉴클레오티드, 항체, 항체 단편 또는 이의 항원 결합 단편, 리간드, 수용체, 단백질 또는 그 조합을 포함하는 것일 수 있다.
또 다른 양상은 상기 c-Myc 관련 질병 진단용 조성물을 포함하는 c-Myc 관련 질병 진단용 키트를 제공하는 것이다. 상기에서 설명한 내용과 동일한 부분은 상기 키트에도 공히 적용된다.
상기 키트는 USP47 단백질, 이의 단편 또는 이를 암호화하는 mRNA 또는 유전자의 발현을 검출하거나 발현 수준을 측정함으로서 상기 c-Myc 관련 질병을 진단할 수 있다.
상기 키트는 SP47 단백질, 이의 단편 또는 이를 암호화하는 mRNA 또는 유전자의 발현을 검출하거나 발현 수준을 측정하기 위한 프라이머, 프로브 또는 선택적으로 마커를 인지하는 항체 또는 항원 결합능을 유지하는 이의 단편뿐만 아니라,　상기 측정 또는 분석 방법에 적합한 하나 또는 그 이상의 다른 구성 성분 조성물 또는 장치가 포함될 수 있다.
예를 들어, 폴리뉴클레오티드 또는 유전자의 검출 또는 발현 수준 측정을 위한　c-Myc 관련 질병 진단용 키트는 상기 USP47 단백질 또는 이의 단편을 암호하하는 폴리뉴클레오티드 또는 유전자에 특이적으로 결합하는 1 종 이상의 올리고 뉴클레오티드를 포함할 수 있는데, 상기 유전자 또는 이의 일부 서열에 대응하는 프라이머, 역전사 효소, Taq 폴리머레이즈, PCR용 프라이머 및 dNTP를 포함할 수 있으며, 폴리뉴클레오티드 발현 수준을 측정하기 위해 상기 mRNA 또는 유전자의 발현 수준과 관련하여 기술된 측정 방법을 이용한 키트를 이용할 수 있다.
또한, 폴리펩타이드 또는 단백질의 검출 또는 발현 수준 측정을 위한　c-Myc 관련 질병 진단용 키트는 상기 USP47 단백질 또는 이의 단편에 특이적으로 결합하는 항체 또는 항체 단편을 포함할 수 있으며, 폴리펩타이드의 발현 수준을 측정하기 위해 상기 단백질의 발현 수준과 관련하여 기술된 측정 방법을 이용한 키트를 이용할 수 있다.
또 다른 양상은 개체로부터 분리된 생물학적 시료로부터, USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계를 포함하는, c-Myc 관련 질병 진단을 위한 정보제공 방법을 제공하는 것이다. 상기에서 설명한 내용과 동일한 부분은 상기 방법에도 공히 적용된다.
본 명세서에서의 용어 "개체"는 c-Myc 관련 질병이 발병되거나 발병될 가능성이 있는 모든 생물체를 의미하며, 구체적인 예로, 개, 고양이, 마우스, 래트, 원숭이, 소, 돼지, 미니돼지, 가축, 인간 등을 포함하는 포유동물, 양식어류 등을 포함할 수 있으며, 이에 제한되는 것은 아니다.
본 명세서에서의 용어 "시료"는 상기 개체로부터 유래한 물질을 의미하며, 구체적으로 조직, 세포, 전혈, 혈청, 혈장, 타액, 객담, 뇌척수액, 소변 등을 포함할 수 있으며, 이에 제한되는 것은 아니다. 또한, 이들 시료로부터 유전자 및/또는 단백질 시료를 얻을 수 있으며, 유전자 시료는 핵산, 예를 들어, DNA, mRNA, 또는 mRNA로부터 합성되는 cDNA 등을 포함할 수 있으며, 이로부터 특정 유전자/단백질의 발현 수준을 확인할 수 있는 한, 그 종류는 이에 제한되는 것은 아니다.
상기 방법은 대조군으로부터 분리된 생물학적 시료로부터, USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계; 및 상기 개체 및 상기 대조군의 발현 수준을 비교하는 단계를 추가로 포함하는 것일 수 있다.
본 명세서에서의 용어 "대조군"은 c-Myc 관련 질병이 발병되지 않은 일반 개체, 비-c-Myc 관련 질병 환자군, 비환자군 등을 의미하는 것일 수 있다.
상기 방법은 상기 개체에서의 USP47 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준이 상기 대조군보다 높은 경우, 상기 개체를 c-Myc 관련 질병이 발병한 것으로 판별하거나 발병 위험을 높은 수준으로 예측하는 단계를 추가로 포함하는 것일 수 있다.
일 양상에 따르면, USP47의 발현/활성을 저해하는 조성물을 활용하여 oncogene인 c-Myc의 발현과 그 활성을 저해시킬 수 있는 바, 이를 통해 다양한 암의 치료제 또는 이의 스크리닝에 유용하게 이용할 수 있다.
도 1의 A는 USP47을 과발현시킨 후 면역침강법을 이용하여 과발현된 USP47과 세포 내 존재하는 c-Myc 단백질의 결합 여부를 확인한 결과를 나타낸 도면이고, B는 과발현된 USP47과 c-Myc 단백질의 결합 여부를 확인한 결과를 나타낸 도면이고, C는 과발현된 야생형 및 돌연변이형 USP47이 과발현된 c-Myc 단백질과의 결합 여부를 확인한 결과를 나타낸 도면이고, D는 세포내 존재하는 USP47와 세포내 c-Myc 단백질과의 결합 여부를 확인한 결과를 나타낸 도면이다.
도 2는 공초점 현미경을 사용하여 면역 형광으로 염색된 USP47 및 c-Myc 단백질이 세포내에서 공동으로 위치함을 확인한 결과를 나타낸 도면이다.
도 3은 USP47 단편의 구조에 대한 설명을 나타낸 도면이다.
도 4는 USP47 단백질 또는 단편을 형질주입하여 과발현된 c-Myc 단백질과의 결합 여부를 확인한 결과를 나타낸 도면이다.
도 5의 A는 c-Myc 단편의 구조에 대한 설명을 나타낸 도면이고, B는 c-Myc 단백질 또는 단편을 형질주입하여 USP47과의 결합 여부를 확인한 결과를 나타낸 도면이다.
도 6은 USP47의 야생형 또는 돌연변이형(효소 활성이 없음)을 과발현시킨 후, c-Myc의 유비퀴틴화 여부를 확인한 결과를 나타낸 도면이다.
도 7의 A는 비소세포폐암 세포주인 A549 세포주와 Calu-1 세포주에서 USP47을 과발현시킨 후 USP47의 발현양에 따른 c-Myc의 발현 수준의 변화를 웨스턴 블랏으로 확인한 결과를 나타낸 도면이고, B는 siUSP47 및/또는 프로테아좀 저해제인 MG132 처리 시 c-Myc의 발현 수준의 변화를 웨스턴 블랏으로 확인한 결과를 나타낸 도면이다.
도 8의 A는 USP47을 과발현시킨 후 cycloheximide를 처리하고 c-Myc 의 분해 속도를 웨스턴 블랏으로 확인한 결과를 나타낸 도면이고, B는 USP47의 발현을 억제한 후 cycloheximide를 처리하고 c-Myc의 분해 속도를 웨스턴 블랏으로 확인한 결과를 나타낸 도면이고,
도 9의 A는 야생형 또는 돌연변이형의 USP47을 과발현시킨 경우 c-Myc의 유전자 발현을 qRT-PCR로 확인한 결과를 나타낸 도면이고, B는 siRNA를 이용하여 USP47 발현 저해 후 c-Myc의 다운스트림 유전자들의 발현 수준을 qRT-PCR로 확인한 결과를 나타낸 도면이다.
도 10의 A는 A549 세포주에서 USP47 넉다운하거나 USP47 넉다운 후 c-Myc을 과발현시킨 후, 콜로니 형성 어세이 및 웨스턴 블랏팅 결과를 나타낸 도면이고, B는 Calu-1 세포주에서 USP47 넉다운하거나 USP47 넉다운 후 c-Myc을 과발현시킨 후, 콜로니 형성 어세이 및 웨스턴 블랏팅 결과를 나타낸 도면이다.
도 11의 A는 A549 세포주에서 USP47 및/또는 c-Myc 을 각각 억제한 경우, 콜로니 형성 어세이 및 웨스턴 블랏팅 결과를 나타낸 도면이고, B는 Calu-1 세포주에서 USP47 및/또는 c-Myc을 각각 억제한 경우, 콜로니 형성 어세이 및 웨스턴 블랏팅 결과를 나타낸 도면이고,
도 12의 A는 GEO (Gene Expression Omnibus) 데이터베이스를 이용하여 USP47 발현에 따른 폐암환자들의 생존률을 분석한 결과를 나타낸 도면이고, B는 TCGA (The CANCER GENOME ATLAS PROGRAM) 데이터베이스를 이용하여 USP47 발현 정도에 따른 폐암환자들의 생존률을 분석한 결과를 나타낸 도면이다.
도 13의 A는 TCGA-LUAD 데이터베이스를 이용하여 KRAS mRNA 수준에 따라 두 그룹으로 나누어 그룹 간 USP47 mRNA 발현 수준의 차이를 분석한 결과를 나타낸 도면이고 (*** p < 0.001), B는 GSE40275 데이터베이스를 이용하여 KRAS mRNA 수준에 따라 두 그룹으로 나누어 그룹 간 USP47 mRNA 발현 수준의 차이를 분석한 결과를 나타낸 도면이다.
도 14의 A는 GSEA_4.3.2 프로그램을 사용하여 GSE26939 데이터 세트에 대해 GSEA 분석을 수행한 결과를 나타내고, B는 KRAS 발현 수준이 다양한 비소세포폐암 세포주에서 USP47의 발현 수준을 분석한 결과를 나타낸다.
도 15의 A는 AMG510 약물에 민감한 H358 폐암 세포주에 AMG510 약물과 USP47의 저해제인 K-552를 병용처리한 경우 세포 생존율을 WST-1 assay를 통하여 확인한 결과이고, B는 상기 결과를 Bliss test를 통해 분석한 결과를 나타낸 도면이다.
도 16은 AMG510 약물에 중간 수준으로 민감한 Calu-1 세포주에 AMG510 약물과 USP47의 저해제인 K-552를 병용처리한 경우 세포 생존율을 WST-1 assay를 통하여 확인한 결과이다.
도 17은 상기 도 16의 결과를 Bliss test를 통해 분석한 결과를 나타낸 도면이다.
도 18은 AMG510 약물에 중간 수준으로 민감한 HCC-1171 세포주에 AMG510 약물과 USP47의 저해제인 K-552를 병용처리한 경우 세포 생존율을 WST-1 assay를 통하여 확인한 결과이다.
도 19는 상기 도 18의 결과를 Bliss test를 통해 분석한 결과를 나타낸 도면이다.
도 20의 A 및 B는 Calu-1 세포주에 AMG510 및/또는 USP47의 저해제인 K-552를 처리한 경우, 콜로니 형성 어세이 결과를 나타낸 도면이다.
도 21의 A 및 B는 HCC-1171 세포주에 AMG510 및/또는 USP47의 저해제인 K-552를 처리한 경우, 콜로니 형성 어세이 결과를 나타낸 도면이다.
도 22의 A는 Calu-1 세포주에 AMG510 및/또는 USP47의 저해제인 K-552를 처리한 경우, 단백질 발현 수준을 웨스턴 블랏팅으로 확인한 결과를 나타낸 도면이고, B는 HCC-1171 세포주에 AMG510 및/또는 USP47의 저해제인 K-552를 처리한 경우, 단백질 발현 수준을 웨스턴 블랏팅으로 확인한 결과를 나타낸 도면이다.
도 23의 A는 Calu-1 세포주에 AMG510 및/또는 siUSP47를 처리한 경우, 단백질 발현 수준을 웨스턴 블랏팅으로 확인한 결과를 나타낸 도면이고, B는 HCC-1171 세포주에 AMG510 및/또는 siUSP47를 처리한 경우, 단백질 발현 수준을 웨스턴 블랏팅으로 확인한 결과를 나타낸 도면이다.
이하 실시예를 통하여 보다 상세하게 설명한다. 그러나, 이들 실시예는 예시적으로 설명하기 위한 것으로 본 발명의 범위가 이들 실시예에 한정되는 것은 아니다.
실시예 1: 세포 배양
폐암세포주인 A549 세포, H359 세포, Calu-1 세포, 그리고 HEK293T 세포는 한국세포주은행에서 구입하였다. 모든 폐암 세포들은 10% FBS (GenDepot, USA)와 1% 페니실린/스트렙토마이신 (penicillin/streptomycin) (GenDepot, USA)이 포함된 RPMI-1640 세포배양액 (GenDepot, USA)으로 배양하였다. HEK293T 세포는 10% FBS와 1% 페니실린/스트렙토마이신 (penicillin/streptomycin)이 포함된 DMEM 세포배양액 (GenDepot, USA)으로 배양하였다. 모든 세포는 37 ℃ 온도에서 5% 이산화탄소를 공급하는 배양기 안에서 배양하였다.
실시예 2: 웨스턴 블랏 분석 (Western Blot Assay)
각 세포를 수득하여 단백질 용해 버퍼 [20mM Tris-Cl (pH 7.5), 150mM NaCl, 1mM EDTA, 1mM EGTA, 1% Triton X-100, 2.5mM sodium pyrophosphate, 50mM NaF, 5mM Beta-glycero phosphate, 1mM Na3VO4, 1X protease inhibitor (cOmplete, EDTA-free; Roche, Basel, Switzerland)]을 이용하여 단백질을 준비하였다. 20 내지 50 μg의 단백질을 6X SDS 샘플 버퍼와 함께 95 ℃에서 5분간 끓여준 후, 8% 겔로 SDS-PAGE로 분리하였다. 겔에 있는 단백질을 니트로셀룰로오즈 막 (Pall Corporation, USA)으로 옮긴 후, 5% 무지방 우유를 이용하여 블락킹하고 일차 항체와 함께 4 ℃에서 하룻밤 동안 인큐베이션하였다. 이 후 막을 이차 항체와 함께 상온에서 1시간 인큐베이션 하고 ECL 용액 (Cytivia, USA)으로 반응시켜 ChemiDoc (ATTO Technology, USA)을 사용하여 시각화하였다. 본 실험에 사용한 일차 항체는 다음과 같다: USP47 (Bethyl Laboratories Inc.), Myc (Santa Cruz Biotechnology), HA (Santa Cruz Biotechnology), and Actin (AB frontier). 이차 항체는 Goat anti-Rabbit과 Goat anti-Mouse (GenDepot, USA)를 사용하였다.
실시예 3: 정량적 실시간 PCR (Quantitative real-time PCR)
세포를 수득하여 Trizol(ambion by life science)을 이용하여 RNA를 추출하였다. USP47, c-Myc 및 다운스트림 유전자들의 발현을 확인하기 위해 oligo-dt (Genolution)를 프라이머로 사용하고, ReverTra Ace qPCR RT Master Mix (TOYOBO, Japan) 를 이용하여 cDNA를 합성하였다. 정량적 실시간 PCR은 SYBR Green Real-time PCR Master Mix (TOYOBO, Japan)을 사용하여 수행하였다.
본 명세서에서 정량적 실시간 PCR을 수행하기 위해 사용한 프라이머의 서열 정보는 하기 표에 기재하였다.
유전자 서열 (5` - 3`) 서열
번호
USP47 F ATGGAAGAATCCTGGCACTG 1
R CTGGAAGGGATCCAACTTCA 2
c-Myc F CCACCTCCAGCTTGTACCTG 3
R GAGCAGAGAATCCGAGGACG 4
LDHA F AGGCTACACATCCTGGGCTA 5
R TCTTCAAACGGGCCTCTTCC 6
CCNE F GAACTGTGTCAAGTGGATGGT 7
R CCGCTGCTCTGCTTCTTAC 8
β-actin F CACTCTTCCAGCCTTCCTTCC 9
R CGGACTCGTCATACTCCTGCTT 10
실시예 4: 콜로니 형성 반응 (Colony formation)
A549 세포에 플라스미드 또는 siRNA를 형질주입한 후, 그 중 500개의 세포만 35 mm 세포 디쉬로 옮긴 후, 10일 동안 배양하였다. 이 후 세포를 4% 포름알데히드와 메탄올로 고정시키고 크리스탈 바이올렛 염색제로 염색하였다.
실시예 5: 면역침강법 (Immunoprecipitation)
HEK 293T 세포에 플라스미드를 면역 주입한 후, 24시간 뒤 세포에서 단백질을 추출하고, anti-Flag M2 Magnetic beads 혹은 anti-HA Agarose beads(Sigma Aldrich)를 4 ℃에서 4시간 반응시켰다. Flag 단백질 혹은 2X SDS Sample buffer로 추출하여 웨스턴 블랏 분석을 수행하였다.
실시예 6: 면역 형광 공초점 현미경법 Immunofluorescence confocal microscopy)
A549 세포를 12-웰 세포 배양용 플레이트에 배양 후 플라스미드를 형질 주입하였다. 24시간 후 4% 포름알데히드로 20분간 고정하고 0.5% 트리톤-X 시약을 10분 간 처리하여싿. 이후 3% BSA로 10분간 블락킹 처리 후 1차 항체를 실온에서 2시간 처리하였다. 이 후 형광물질이 연결된 2차 항체를 실온에서 1시간 처리 후 세포 핵을 DAPI로 10분간 염색하였다. 분석은 Confocal microscopy (Zeiss)로 63X 배율로 수행하였다.
실시예 7: 세포 증식 분석법(WST-1 assay)
H358, Calu-1, HCC-1171 세포를 96-웰 세포 배양용 플레이트에 각각 8000개(H358), 6000-8000개(Calu-1), 10000개(HCC1171)씩 배양하였다. 24시간 후 USP47 저해제인 K-552와 KRASG12C 저해제인 sotorasib (AMG510)를 각 웰에 정해진 농도에 따라 처리하였다. 72시간 후, EZ-Cytox (DoGEN, EZ-3000)를 배양액에 희석하여 30분간 배양한 뒤, microplate absorbance reader (Bio-Rad)를 이용하여 450nm의 파장에서 흡광도를 측정하였다.
제조예 1: 9-(3-브로모헥실)-9H-카바졸 합성
반응용기에 카바졸(2　g, 11.96 mmol)과 1,3-다이브로모프로판(2.8 ml, 17.94 mmol), t-BuOK(1.3 g, 11.96 mmol)를 THF(15 ml)에 녹인 후, 40 ℃에서 10 시간 동안 가열 교반하였다. 반응 종결 후, 용액을 감압 농축시키고 다시 CH2Cl2로 희석시켰다. 이 용액을 H2O로 씻어주고 무수 Na2SO4로 건조시킨 후, 여과하였다. 여과액을 감압 농축시켜 농축액을 실리카 겔 관 크로마토그래피(hexane:MC=8:1)로 분리 정제하여 목적 화합물인 9-(3-브로모헥실)-9H-카바졸 2.1 g(6.36 mmol, 53% 수율)을 얻었다.
제조예 2: 9-(4-브로모부틸)-9H-카바졸 합성
1,3-다이브로모프로판 대신에 1,4-다이브로모부탄을 사용한 것을 제외하고는 제조예 1과 동일한 방법으로 목적 화합물을 제조하였다.
제조예 3: 9-(5-브로모펜틸)-9H-카바졸 합성
1,3-다이브로모프로판 대신에 1,5-다이브로모펜탄을 사용한 것을 제외하고는 제조예 1과 동일한 방법으로 목적 화합물을 제조하였다.
제조예 4: 9-(6-브로모헥실)-9H-카바졸 합성
1,3-다이브로모프로판 대신에 1,6-다이브로모헥산을 사용한 것을 제외하고는 제조예 1과 동일한 방법으로 목적 화합물을 제조하였다.
제조예 5: 화합물 1(K-552) 합성
제조예 1에 따라 제조된 9-(3-브로모헥실)-9H-카바졸(176 mg, 0.61 mmol), 1-(2-메톡시페닐)피페라진(0.13 ml, 0.73 mmol)을 아세토나이트릴(10 ml)에 녹이고 40 ℃에서 다음날까지 가열환류하였다. 반응 완결 후 반응 혼합물을 CH2Cl2로 묽힌 후, H2O를 넣고 수층을 CH2Cl2로 추출하여 얻은 유기층을 무수 Na2SO4로 건조시킨 후, 여과하였다. 여과액을 감압 농축시켜 농축액을 실리카겔 관 크로마토그래피(MC:MeOH=20:1)로 분리 정제하여, 하기 화학식 1로 표현되는 목적 화합물인 9-(3-(4-(2-메톡시페닐)피페라진-1-일)프로필)-9H-카바졸 145.8 mg(0.36 mmol,　60　% yield)을 얻었다.
[화학식 1]
Figure PCTKR2023016053-appb-img-000010
1H NMR(400 MHz, CDCl3) δ 8.07(d, J=7.7 Hz, 2H), 7.46-7.41(m, 4H), 7.24-7.15(m, 3H), 7.08-7.03(m, 1H), 6.94(dd, J=6.0 Hz, J=1.4 Hz, 1H), 6.85(td, J=7.6 Hz, J=1.5 Hz, 1H), 4.36(t, J=6.6 Hz, 2H), 2.85(t, J=4.7 Hz, 4H), 2.47(brs, 4H), 2.30(t, J=6.7 Hz, 2H), 2.01(quint, J=6.6 Hz, 2H).
실험예 1: USP47과 c-Myc의 결합 여부 확인
USP47과 c-Myc이 세포 내 또는 생체 내에서 상호작용하여 결합하는 지 확인하기 위해, 하기와 같은 실험을 수행하였다.
구체적으로, 실시예 5에 기재된 면역침강법을 이용하여 세포 내에서 USP47과 c-Myc이 결합할 수 있는지 여부를 확인하였다.
먼저, HEK 293T 세포에 USP47을 발현하는 플라스미드를 형질도입하여 USP47을 과발현시킨 후, 면역침강법을 이용하여 과발현된 USP47과 세포 내 존재하는 c-Myc 단백질의 결합 여부를 확인한 결과, USP47과 c-Myc이 결합한 상태로 존재하는 것을 확인하였다 (도 1A).
다음으로, HEK 293T 세포에 USP47을 발현하는 플라스미드 및 c-Myc을 발현하는 플라스미드를 형질도입하여 USP47 및 c-Myc을 과발현시킨 후, 면역침강법을 이용하여 과발현된 USP47과 과발현된 c-Myc의 결합 여부를 확인한 결과, USP47과 c-Myc이 결합한 상태로 존재하는 것을 확인하였다 (도 1B).
다음으로, HEK 293T 세포에 USP47 야생형 또는 돌연변이형을 발현하는 플라스미드 및 c-Myc을 발현하는 플라스미드를 형질도입하여 USP47 야생형 또는 효소활성이 없는 돌연변이형(USP47C109S)과 c-Myc을 과발현시킨 후, 면역침강법을 이용하여 과발현된 USP47 야생형 또는 돌연변이형과 과발현된 c-Myc의 결합 여부를 확인한 결과, USP47 야생형 및 돌연변이형 모두 c-Myc이 결합한 상태로 존재하는 것을 확인하였다 (도 1C).
다음으로, HEK 293T 세포 내 존재하는 USP47 및 c-Myc의 결합 여부를 면역침강법을 이용하여 확인한 결과, 세포 내 존재하는 USP47 및 c-Myc 또한 상호작용하여 결합하는 것을 확인하였다 (도 1D).
다음으로, A549 세포에 USP47을 발현하는 플라스미드 및 c-Myc을 발현하는 플라스미드를 형질도입하여 USP47 및 c-Myc을 과발현시킨 후, USP47 및 c-Myc을 면역형광으로 염색시킨 후, 실시예 6에 기재된 면역 형광 공초점 현미경법을 이용하여 세포 내 위치를 확인한 결과, USP47 및 c-Myc이 세포질과 핵 인에서도 공동 위치함을 확인하였다 (도 2).
상기 결과들을 토대로, USP47 및 c-Myc은 세포내에서 결합하여 상호작용하는 것을 알 수 있다.
실험예 2: USP47과 c-Myc의 상호작용과 관련된 영역 확인
USP47과 c-Myc의 세포 내 상호작용과 관련하여, 상기 상호작용에서 중요하게 작용하는 영역을 확인하기 위해, 하기와 같은 실험을 수행하였다.
먼저, USP47의 일부 영역이 절단된 다양한 단편을 제조하였으며 (도 3), 상기 USP47 단편과 c-Myc의 상호작용 여부를 면역침강법을 이용하여 확인하였다. 그 결과, UBL 1 및 UBL 2 도메인 또는 UCH 도메인을 포함하는 단편이 USP27 전장 단백질보다 c-Myc과의 결합이 현저히 우수한 것을 확인하였는 바, UBL1 및 UBL2 도메인뿐만 아니라, USP47의 효소 활성을 나타내는 UCH 도메인이 c-Myc과의 상호작용에 관여하는 것임을 알 수 있다. 또한, UBL3 및 UBL4 도메인을 포함하는 단편이 c-Myc과 약한 상호작용을 나타내고 있음에도 불구하고, UBL1 내지 3 도메인 또는 UBL1 내지 4 도메인을 포함하는 단편의 경우, c-Myc과의 상호작용을 나타내지 않는 것을 확인하였는 바, UBL3 및 UBL4 도메인은 UBL1 및 UBL2 도메인의 c-Myc에 대한 상호작용을 오히려 억제하는 것을 알 수 있다 (도 4).
다음으로, c-Myc의 일부 영역이 절단된 다양한 단편을 제조하였으며 (도 5A), 상기 c-Myc 단편과 USP47의 상호작용 여부를 HA 아가로즈 비드를 이용한 면역침강법을 이용하여 확인하였다. 그 결과, c-Myc의 C-말단 단편이 USP47과의 상호작용에 중요하게 작용하는 영역임을 확인하였다 (도 5B).
상기 USP47 및 c-Myc의 전장 아미노산 서열을 하기 표에 기재하였다.
단백질 서열 서열
번호
USP47 ITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD 11
c-Myc MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA 15
실험예 3: USP47의 c-Myc 안정화 효능 평가
USP47이 c-Myc과 상호작용함으로서 c-Myc의 분해를 억제하여 안정화시키는 지 확인하기 위해, 하기와 같은 실험을 수행하였다.
먼저, c-Myc에서 USP47에 의한 탈유비퀴틴화(deubiquitination) 활성을 확인하기 위해 Ni-NTA 풀다운 분석을 수행하였다. 그 결과, USP47의 존재하에 c-Myc의 유비퀴틴화는 감소되었으며, c-Myc과의 결합능이 있는 것으로 확인된 효소활성이 없는 돌연변이형(USP47C109S)은 c-Myc의 유비퀴틴화를 감소시키지 못하는 것을 확인하였다 (도 6).
다음으로, A549 및 Calu-1 세포주에서 USP47을 과발현시키는 경우, 농도의존적으로 c-Myc의 발현 수준이 증가하는 것을 확인하였고 (도 7A), 반면에 USP47을 억제할 경우 c-Myc 단백질의 발현 수준은 감소되는 것을 확인하였다. 또한, 프로테아좀 억제제인 MG132를 처리할 경우 c-Myc 단백질의 발현 수준은 다시 회복되는 것을 확인하였다 (도 7B).
다음으로, USP47이 c-Myc 단백질 안정성에 미치는 영향을 추가로 확인하기 위해, A549 세포에 사이클로헥시미드(cycloheximide)를 처리하고 시간 경과에 따른 c-Myc 단백질의 발현 수준을 평가하였다. 그 결과, USP47을 과발현시킨 세포주의 경우 c-Myc 단백질의 안정화를 유도하였음을 확인하였으며 (도 8A), 반면에 USP47를 억제할 경우 c-Myc 의 분해를 가속화하였음을 확인하였다 (도 8B).
다음으로, USP47이 c-Myc의 mRNA 수준에 미치는 영향을 조사한 결과, USP47에 의해 c-Myc의 mRNA 발현 수준 자체에는 유의한 변화를 유도하지 않았음을 확인하였는 바(도 9A), USP47이 탈유비퀴틴화를 통해 프로테오좀에 의한 분해를 방해함으로서 c-Myc의 단백질 발현 수준을 조절하는 것임을 알 수 있다.
다음으로, USP47이 c-Myc을 전사 인자로서 조절하는 역할을 하는지 확인하기 위해, siUSP47(5`-TGAAAAGGGATGTGCAAAA-3`, 서열번호 17) 처리 후 c-Myc 및 이의 다운스트림 유전자의 mRNA 수준을 확인하였다. 그 결과, USP47에 의해 c-Myc의 다운스트림 유전자 중 CCNE1(cyclin E1) 및 LDHA (lactate dehydrogenase A)만이 유의미하게 영향을 받았으며, 다른 유전자들은 크게 영향을 받지 않은 것을 확인하였다 (도 9B).
상기 결과들을 종합해보면, USP47은 종양단백질 c-Myc의 안정화에 관여하며, c-Myc의 탈유비퀴틴화를 통해 다운스트림 활성을 조절할 수 있음을 알 수 있다.
실험예 4: USP47 억제에 따른 폐암 세포 증식 억제 효능 평가
USP47의 억제가 c-Myc 단백질 수준을 조절하여 비소세포폐암 등과 같은 폐암 세포 증식에 영향을 미치는 지 확인하기 위해, 하기와 같은 실험을 수행하였다.
구체적으로, 폐암 세포의 증식능을 확인하기 위해 실시예 4에 기재된 콜로니 형성 반응을 이용하였다. 먼저, A549 및 Calu-1 세포주에 siUSP47을 처리하여 USP47의 발현 수준을 억제한 결과, 콜로니 형성이 억제되는 것을 확인하였으며, c-Myc을 과발현시키는 경우, 상기 콜로니가 증식하는 것을 확인하였다 (도 10A 및 B). 반대로, c-Myc이 억제된 경우에는 USP47의 발현 수준을 억제하여도 콜로니 형성이 더 이상 감소되지 않았음을 확인하였다 (도 11A 및 B). 상기 결과를 토대로, USP47이 c-Myc 단백질의 발현 수준을 조절함으로서 폐암 세포의 증식을 억제하는 것임을 알 수 있다.
다음으로, 비소세포폐암 환자에서 USP47 발현 수준과 생존율의 상관 관계를 확인하기 위해, 생물정보학적 분석을 수행했다. GEO 데이터 세트(accession number GSE26939)를 확인한 결과, USP47의 높은 발현 수준을 보이는 환자 그룹의 전체 생존율이 상당히 낮은 것을 확인하였다(도 12A). 또한, TCGA 데이터 세트 분석 결과도 상기와 동일한 결과를 나타냈다(도 12B). 상기 결과를 토대로, USP47이 비소세포폐암 환자의 생존율 감소에 기여하는 요인이며, USP47을 표적으로 치료법을 진행하는 것이 비소세포폐암의 치룔를 위한 잠재적인 치료적 접근법으로서 가능성이 있음을 알 수 있다.
실험예 5: USP47과 KRAS 신호전달 경로와의 연관성 확인
종양단백질로 알려진 KRAS는 폐암에서 자주 과발현되고 돌연변이되며, KRAS 돌연변이는 비소세포폐암의 약 25%를 차지하는 것으로 알려져 잇다. 이에, KRAS와 USP47의 연관성을 확인하기 위해, 하기와 같은 실험을 수행하였다.
먼저, TCGA 및 GEO의 데이터 세트를 분석한 결과, KRAS mRNA 발현이 높은 그룹이 낮은 KRAS 그룹에 비해 USP47 mRNA 수준이 더 높은 것으로 확인되었으며, USP47과 KRAS mRNA 발현 수준 사이에는 통계적으로 유의한 양의 상관관계가 있음을 확인하였다 (p-값 < 0.0001)(도 13A 및 B).
다음으로, GSEA(gene set enrichment analysis) 분석 결과에서도 비소세포폐암에서 USP47이 상향 조절된 KRAS 신호 전달 경로와 양의 상관관계를 나타내는 것을 확인하였다 (도 14A).
다음으로, 다양한 유형의 비소세포폐암 세포주에서의 USP47 발현 수준을 웨스턴 블랏팅을 이용하여 확인하였다. 그 결과, 야생형 KRAS가 발현하는 것으로 알려진 비소세포폐암 세포주인 H1650과 비교하여, KRAS 돌연변이가 발현되는 세포주에서 USP47 발현이 증가했음을 확인하였다 (도 14B).
상기 결과를 종합해보면, 발암성 KRAS-돌연변이 폐암에서 USP47의 발현 수준이 높음을 알 수 있는 바, 발암성 KRAS와 USP47을 모두 표적으로 하는 치료법이 비소세포폐암 환자의 치료를 위한 보다 효과적인 전략이 될 수 있음을 알 수 있다.
실험예 6: USP47 억제제와 KRAS 억제제의 병용 처리에 따른 생존율 억제 효능 평가
상기 실험예 5에서 확인한 USP47과 KRAS의 상관관계를 고려하여, KRAS 돌연변이가 발현되는 세포주에서 KRAS 억제제 및 USP47 억제제의 병용 처리에 따른 세포 생존율 억제 효능을 평가하기 위해, 하기와 같은 실험을 수행하였다.
먼저, KRAS G12C 돌연변이를 발현하는 비소세포폐암 세포주인 H358, Calu-1 또는 HCC1171에 KRAS G12C 억제제인 소토라십(Sotorasib, AMG510) 및 USP47 억제제인 K-552(화학식 1의 화합물)를 처리하였다. 그 결과, 소토라십 및 K-552 처리에 따라 농도의존적으로 세포 생존율이 유의미하게 감소되는 것을 확인하였으며(도 15A, 16 및 18), 이러한 시너지 효과는 Bliss 시너지 점수를 이용하여 확인하였다 (도 15B, 17 및 19).
다음으로, 상기 KRAS 억제제 및 USP47 억제제의 병용 처리에 따른 세포 생존율 억제 효능을 보다 자세히 평가하기 위해, Calu-1 및 HCC1171 세포주에서 KRAS G12C 억제제인 소토라십 및/또는 USP47 억제제인 K-552를 처리한 후 콜로니 형성 분석을 수행하였다. 그 결과, 소토라십 또는 K-552를 단일 처리한 경우에도 콜로니 형성이 감소되었으나, 소토라십 및 K-552를 병용 처리한 경우 콜로니 형성이 현저히 감소되는 것을 확인하였다(도 20 및 21).
다음으로, 상기 KRAS 억제제 및 USP47 억제제의 병용 처리에 따른 효능을 추가로 평가하기 위해, pERK 및 c-Myc의 발현 수준을 확인하였다. 그 결과, 소토라십 또는 K-552를 단일 처리한 경우 pERK 및 c-Myc의 발현 수준이 감소하였으며, 소토라십 및 K-552를 병용 처리한 경우에는 pERK 및 c-Myc의 발현 수준이 현저히 감소하는 것을 확인하였다 (도 22A 및 B). 상기 결과를 토대로, KRAS 억제제 및 USP47 억제제의 병용 처리는 pERK 및 c-Myc의 발현 수준을 감소시키는 기전을 토대로 폐암 치료 효과를 나타낼 수 있음을 알 수 있다.
다음으로, 상기 pERK 및 c-Myc의 발현 수준에 대한 KRAS 억제제 및 USP47 억제제의 병용 처리 효과가 USP47의 발현 수준 억제에 의해 매개되는 것임을 확인하기 위해, siUSP47를 처리하여 USP47의 발현 수준을 억제시키고 KRAS 억제제를 처리하였다. 그 결과, siRNA를 사용한여 USP47의 발현 수준을 억제할 경우 c-Myc의 발현 수준을 감소시켰으며, siUSP47이 처리된 세포에 소토라십을 처리할 경우 c-Myc 및 pERK 발현 수준은 단독 처리한 경우보다 현저히 감소되는 것을 확인하였다 (도 23A 및 B).
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야만 한다.
서열번호 1 - USP47 프라이머 서열(F)
ATGGAAGAATCCTGGCACTG
서열번호 2 - USP47 프라이머 서열(R)
CTGGAAGGGATCCAACTTCA
서열번호 3 - c-Myc 프라이머 서열(F)
CCACCTCCAGCTTGTACCTG
서열번호 4 - c-Myc 프라이머 서열(R)
GAGCAGAGAATCCGAGGACG
서열번호 5 - LDHA 프라이머 서열(F)
AGGCTACACATCCTGGGCTA
서열번호 6 - LDHA 프라이머 서열(R)
TCTTCAAACGGGCCTCTTCC
서열번호 7 - CCNE 프라이머 서열(F)
GAACTGTGTCAAGTGGATGGT
서열번호 8 - CCNE 프라이머 서열(R)
CCGCTGCTCTGCTTCTTAC
서열번호 9 - β-actin 프라이머 서열(F)
CACTCTTCCAGCCTTCCTTCC
서열번호 10 - β-actin 프라이머 서열(R)
CGGACTCGTCATACTCCTGCTT
서열번호 11 - USP47 전장 아미노산 서열
ITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGMTVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDINISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESSSVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVSTLNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRVTYSPRKEKALKIYLDGAPNKDLTQD
서열번호 12 - USP47 UCH 도메인 아미노산 서열
TGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAAGGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAFASSTNAYMLIYRLKD
서열번호 13 - K-RAS 돌연변이 염기서열
atgtaacatgtttacctggaatgtattttaactatttttgtatagtgtaaactgaaacatgcacattttgtacattgtgctttcttttgtgggacatatgcagtgtgatccagttgttttccatcatttggttgcgctgacctaggaatgttggtcatatcaaacattaaaaatgaccactcttttaattgaaattaacttttaaatgtttataggagtatgtgctgtgaagtgatctaaaatttgtaatatttttgtcatgaactgtactactcctaattattgtaatgtaataaaaatagttacagtgac
서열번호 14 - K-RAS 돌연변이 염기서열 2
catttggttgcgctgacctaggaatgttggtcatatcaaacattaaaaatgaccactcttttaattgaaattaacttttaaatgtttataggagtatgtgctgtgaagtgatctaaaatttgtaatatttttgtcatgaactgtactactcctaattattgtaatgtaataaaaatagttacagtgac
서열번호 15 - c-Myc 전장 아미노산 서열
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
서열번호 16 - c-Myc bHLH-LZ 도메인 아미노산 서열
VKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQL
서열번호 17 - siUSP47 염기서열
TGAAAAGGGATGTGCAAAA

Claims (16)

  1. USP47 (Ubiquitin-specific protease 47) 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 관련 질병의 예방 또는 치료용 약학 조성물.
  2. 청구항 1에 있어서, 상기 USP47 단백질 또는 이의 단편은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 것인, 조성물.
  3. 청구항 1에 있어서, 상기 조성물은 c-Myc의 분해를 촉진하는 것인, 조성물.
  4. 청구항 1에 있어서, 상기 USP47의 발현 또는 활성을 억제하는 제제는 K-552, 이의 약학적으로 허용가능한 염, 이의 수화물 및 이의 용매화물로 구성된 군에서 선택된 하나 이상을 유효성분으로 포함하는 것인, 조성물.
  5. 청구항 1에 있어서, 상기 조성물은 K-RAS의 발현 또는 활성을 억제하는 제제를 추가로 포함하는 것인, 조성물.
  6. 청구항 5에 있어서, 상기 K-RAS의 발현 또는 활성을 억제하는 제제는 Sotorasib, Adagrasib, GFH925, JAB-21822, YL-15293, ELI-002 7P, HBI-2438, JDQ443, JNJ-74699157, D3S-001, BI 1823911, IBI351, MK-1084, LY3499446, JAB-21822, LY3537982, GDC-6036, HS-10370, D-1553 및 GEC255로 구성된 군에서 선택된 하나 이상을 포함하는 것인, 조성물.
  7. 청구항 1에 있어서, 상기 c-Myc 관련 질병은 폐암, 대장암 및 유방암으로 구성된 군에서 선택된 하나 이상을 포함하는 것인, 조성물.
  8. 청구항 1에 있어서, 상기 c-Myc 관련 질병은 USP47의 과발현 또는 과활성으로 인해 발병하는 것인, 조성물.
  9. 청구항 1에 있어서, 상기 조성물은 암 또는 암세포의 성장, 증식, 전이 및 침투로 이루어진 군에서 선택된 하나 이상을 억제하는 것인, 조성물.
  10. USP47 단백질 또는 이의 단편의 발현 또는 활성을 억제하는 제제를 포함하는, c-Myc 발현 또는 활성 억제용 조성물.
  11. 1) USP47 단백질 또는 이의 단편을 발현하는 시험관 내 모델에 후보물질을 처리하는 단계; 및
    2) 상기 모델의 c-Myc 단백질 또는 이의 단편의 발현 수준을 확인하는 단계
    를 포함하는, c-Myc 관련 질병 치료제 스크리닝 방법.
  12. 청구항 11에 있어서, 상기 USP47 단백질 또는 이의 단편은 USP47의 UCH 도메인, UBL1 도메인 및 UBL2 도메인으로 구성된 군에서 선택된 하나 이상을 포함하는 것인, 방법.
  13. 청구항 11에 있어서, 상기 c-Myc 단백질 또는 이의 단편은 c-Myc의 bHLH-LZ 도메인을 포함하는 것인, 방법.
  14. 청구항 11에 있어서, 상기 방법은
    3) 상기 후보물질 처리에 따라 c-Myc 단백질 또는 이의 단편의 발현 수준이 감소하는 경우, 상기 후보물질을 c-Myc 관련 질병 치료제로 판단하는 단계
    를 추가로 포함하는 것인, 방법.
  15. USP47 (Ubiquitin-specific protease) 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정할 수 있는 제제를 포함하는, c-Myc 관련 질병 진단용 조성물.
  16. 개체로부터 분리된 생물학적 시료로부터, USP47 (Ubiquitin-specific protease) 단백질, 이의 단편 또는 이를 암호화하는 유전자의 발현 수준을 측정하는 단계를 포함하는, c-Myc 관련 질병 진단을 위한 정보제공 방법.
PCT/KR2023/016053 2022-10-18 2023-10-17 USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도 WO2024085603A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2022-0134462 2022-10-18
KR20220134462 2022-10-18
KR1020230109267A KR20240055632A (ko) 2022-10-18 2023-08-21 USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도
KR10-2023-0109267 2023-08-21

Publications (1)

Publication Number Publication Date
WO2024085603A1 true WO2024085603A1 (ko) 2024-04-25

Family

ID=90738157

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/016053 WO2024085603A1 (ko) 2022-10-18 2023-10-17 USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도

Country Status (1)

Country Link
WO (1) WO2024085603A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150121897A (ko) * 2014-04-22 2015-10-30 한국과학기술연구원 5-ht7 수용체에 작용하는 카바졸 유도체
US20220040191A1 (en) * 2018-12-11 2022-02-10 Af Chemicals, Llc Methods, compositions and devices for treating cancer with illudofulvenes
WO2022207673A1 (en) * 2021-03-31 2022-10-06 Sevenless Therapeutics Limited Sos1 inhibitors and ras inhibitors for use in the treatment of pain

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20150121897A (ko) * 2014-04-22 2015-10-30 한국과학기술연구원 5-ht7 수용체에 작용하는 카바졸 유도체
US20220040191A1 (en) * 2018-12-11 2022-02-10 Af Chemicals, Llc Methods, compositions and devices for treating cancer with illudofulvenes
WO2022207673A1 (en) * 2021-03-31 2022-10-06 Sevenless Therapeutics Limited Sos1 inhibitors and ras inhibitors for use in the treatment of pain

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
JIANCHAO GE: "USP16 regulates castration-resistant prostate cancer cell proliferation by deubiquitinating and stablizing c-Myc", JOURNAL OF EXPERIMENTAL & CLINICAL CANCER RESEARCH, BIOMED CENTRAL LTD, LONDON UK, vol. 40, no. 1, 1 December 2021 (2021-12-01), London UK , XP093162817, ISSN: 1756-9966, DOI: 10.1186/s13046-021-01843-8 *
MING-JER YOUNG: "The role of ubiquitin-specific peptidases in cancer progression", JOURNAL OF BIOMEDICAL SCIENCE, KLUWER ACADEMIC PUBLISHERS, DO, vol. 26, no. 1, 1 December 2019 (2019-12-01), Do , XP093162815, ISSN: 1423-0127, DOI: 10.1186/s12929-019-0522-0 *

Similar Documents

Publication Publication Date Title
WO2016036172A1 (ko) 단백질 키나제 억제제에 대한 감수성 예측용 바이오 마커 및 이의 용도
WO2016018088A1 (ko) Met 저해제에 대한 감수성 예측용 신규한 바이오 마커 및 이의 용도
WO2016018087A1 (ko) Egfr-표적제제에 대한 감수성 예측용 신규한 바이오 마커 및 이의 용도
WO2023003417A1 (ko) Kras 돌연변이 특이적 저해제 및 이를 포함하는 암 예방 또는 치료용 조성물
WO2012128521A2 (ko) 프로게린 발현 억제제를 유효성분으로 함유하는 노화 관련 질환 치료용 약학조성물 및 상기 프로게린 발현 억제제의 스크리닝 방법
WO2024085603A1 (ko) USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도
WO2014157965A1 (ko) P34의 발현 억제제 또는 활성 억제제를 유효성분으로 포함하는 암의 치료 또는 전이 억제용 조성물
WO2011090283A2 (ko) Ｓｈ３ｒｆ２ 발현 또는 활성 억제제를 함유하는 암의 예방 또는 치료용 조성물
WO2017048069A1 (ko) 신규한 피라졸린 유도체 및 이의 용도
WO2022014975A1 (ko) Bi-1 길항제 및 그의 용도
WO2010137770A1 (ko) 신규한 ｇｐｃｒ 단백질 및 이의 용도
WO2018174506A1 (ko) Sulf2 유전자를 이용한 소라페닙 치료에 대한 감수성 예측방법 및 sulf2 저해제를 포함하는 암 치료용 조성물
WO2017061828A1 (ko) Plrg1 (pleiotropic regulator 1) 억제제를 유효성분으로 포함하는 암의 예방 또는 치료용 약학 조성물
WO2019245269A1 (ko) Flt3 억제제를 유효성분으로 포함하는 만성 골수성 백혈병 약물 내성 억제용 조성물
WO2021015419A1 (ko) 인산화된 베타-카테닌에 특이적으로 결합하는 항체 및 이의 용도
WO2017164486A1 (ko) Tesk1 억제제를 포함하는 항암제 내성 억제용 조성물 및 tesk1 억제제의 스크리닝 방법
WO2017023001A1 (ko) 비알콜성 지방간 조절인자 14-3-3 단백질
WO2021194276A1 (ko) 13-하이드록시옥타데카디에노산을 유효성분으로 포함하는 암의 예방 또는 치료용 약제학적 조성물
WO2021085888A1 (ko) 암세포 성장 억제 효과를 나타내는 신규한 헤테로 고리 치환 피리미딘 유도체 및 그를 포함하는 약제학적 조성물
WO2023167544A1 (ko) Fam167a를 포함하는 bcr-abl 비의존성 타이로신 키나아제 억제제 내성을 진단하기 위한 바이오마커 및 fam167a를 타겟으로 하는 만성 골수성 백혈병 예방 또는 치료용 조성물
WO2024177416A1 (ko) Egfr 표적치료제 내성암 치료용 약학 조성물
WO2023068835A1 (ko) Ｐａｋ4 저해제 및 그의 용도
KR20240055632A (ko) USP47 (Ubiquitin-specific protease 47) 발현 억제를 통한 c-Myc 관련 질병의 예방 또는 치료용 조성물 및 이의 용도
WO2023018168A1 (ko) Msh2 또는 msh6 억제제를 유효성분으로 포함하는 암 예방 또는 치료용 조성물
WO2022169342A2 (ko) 암 전이 억제용 약학 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23880180

Country of ref document: EP

Kind code of ref document: A1