WO2023205614A2 - Multicistronic chimeric protein expression systems - Google Patents
Multicistronic chimeric protein expression systems Download PDFInfo
- Publication number
- WO2023205614A2 WO2023205614A2 PCT/US2023/065860 US2023065860W WO2023205614A2 WO 2023205614 A2 WO2023205614 A2 WO 2023205614A2 US 2023065860 W US2023065860 W US 2023065860W WO 2023205614 A2 WO2023205614 A2 WO 2023205614A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- optionally
- amino acid
- sequence
- cell
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/15—Natural-killer [NK] cells; Natural-killer T [NKT] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4203—Receptors for growth factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4224—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4256—Tumor associated carbohydrates
- A61K40/4257—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/5443—IL-15
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70532—B7 molecules, e.g. CD80, CD86
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0646—Natural killers cells [NK], NKT cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
- A61K2239/13—Antibody-based
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/17—Hinge-spacer domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/21—Transmembrane domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/50—Cellular immunotherapy characterised by the use of allogeneic cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/20—Vector systems having a special element relevant for transcription transcription of more than one cistron
Definitions
- BACKGROUND Cell-based therapy platforms provide promising avenues for treating a variety of diseases.
- One such promising platform is CAR-T based therapies in the treatment of cancer. Given their promise, improvements in cell-based therapies are needed.
- An active area of exploration is engineering cell-based therapies to produce and/or secrete effector molecules such as cytokines, a process referred to as armoring, that enhance the cell-based therapy.
- unarmored CAR-T therapies have poor efficacy in solid tumors and armoring can impact the entire cancer immunity cycle and boost the activity of CAR-T.
- a cell-based therapy platform involving regulated armoring of the cell-based therapy, including chimeric antigen receptor (CAR)-based therapies (e.g. NK CARs), such as regulated secretion of payload effector molecules.
- CAR chimeric antigen receptor
- a combinatorial cell-based immunotherapy involving regulated armoring for the targeted treatment of cancer, such as ovarian cancer, breast cancer, colon cancer, lung cancer, and pancreatic cancer.
- the therapy provided herein can limit systemic toxicity of armoring.
- the immunotherapy provided herein can be tumor-specific and effective while limiting systemic toxicity and/or other off-target effects due to armoring.
- These therapies deliver proteins of interest, such as immunomodulatory effector molecules, in particular IL-15, in a regulated manner, including regulation of secretion kinetics, cell state specificity, and cell or tissue specificity.
- the design of the delivery vehicle is optimized to improve overall function in cell- based therapies, such as cancer therapy, including, but not limited to, optimization of the membrane-cleavage sites, promoters, linkers, signal peptides, delivery methods, combination, regulation, and order of the immunomodulatory effector molecules.
- the design of the delivery vehicle is also optimized for expression of multiple components for CAR-based therapies in a multicistronic system, including chimeric antigen receptors (both activating aCARs and inhibitory iCARs) and membrane-cleavable chimeric protein.
- a multicistronic expression system comprising an engineered nucleic acid comprising: (A) an exogenous polynucleotide encoding a membrane-cleavable chimeric protein, oriented from N-terminal to C-terminal, having the formula: S – C – MT or MT – C – S, wherein S comprises a secretable effector molecule, wherein the secretable effector molecule comprises IL-15, C comprises a protease cleavage site, and MT comprises a cell membrane tethering domain, wherein S – C – MT or MT – C – S is configured to be expressed as a single polypeptide; (B) an exogenous polynucleotide encoding an inhibitory chimeric antigen receptor (iCAR) comprising: (i) an antigen-binding domain specific for endomucin (EMCN); (ii) one or more intracellular inhibitory domains that inhibit an immune response, and (i
- the exogenous polynucleotides encoding each of the membrane- cleavable chimeric protein, the iCAR, and the bivalent aCAR are linked together by a polynucleotide linker encoding a 2A ribosome skipping element.
- the 2A ribosome skipping element is selected from the group consisting of: a T2A ribosome skipping element, a E2A ribosome skipping element, a P2A ribosome skipping element, a F2A ribosome skipping element, ribosome skipping element fusions thereof, and combinations thereof.
- the ribosome skipping element fusion comprises an E2A/T2A ribosome skipping element.
- the E2A/T2A ribosome skipping element comprises the amino acid sequence QCTNYALLKLAGDVESNPGPGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 221).
- the E2A/T2A ribosome skipping element is encoded by a polynucleotide sequence comprising the sequence CAGTGTACCAACTACGCCCTGCTGAAACTGGCCGGCGACGTGGAATCTAATCCTGG ACCTGGATCTGGCGAGGGACGCGGGAGTCTACTGACGTGTGGAGACGTGGAGGAA AACCCTGGACCT (SEQ ID NO: 222) or the sequence CAGTGCACAAATTATGCACTGCTGAAGCTCGCCGGGGATGTCGAGAGTAACCCAGG ACCTGGAAGCGGAGAAGGTCGTGGTAGTCTACTAACGTGTGGTGATGTAGAAGAAA ATCCTGGACCT (SEQ ID NO: 223).
- the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR are encoded in order from 5’ to 3’: (i) membrane-cleavable chimeric protein; (ii) bivalent aCAR; and (iii) iCAR.
- the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR are encoded in order from 5’ to 3’: (i) membrane-cleavable chimeric protein; (ii) iCAR; and (iii) bivalent aCAR.
- the secretable effector molecule comprises a signal peptide or a signal- anchor sequence.
- the signal peptide comprises a native signal peptide native to the secretable effector molecule. In some aspects, the signal peptide comprises a non-native signal peptide or the signal-anchor sequence comprises a non-native signal-anchor sequence non-native to the secretable effector molecule.
- the non-native signal peptide or the non-native signal-anchor sequence is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV- G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL-8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TNFR2, GMCSF, and GM-CSFRa.
- the non-native signal peptide comprises an IgE signal peptide.
- the IgE signal peptide comprises the amino acid sequence MDWTWILFLVAAATRVHS (SEQ ID NO: 228).
- the IgE signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCT (SEQ ID NO: 229).
- the IL-15 comprises the amino acid sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIH DTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS (SEQ ID NO: 224).
- the IL-15 is encoded by a polynucleotide sequence comprising the sequence AATTGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCAT GCACATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGA CCGCCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGAC GCCAGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTC CAGCAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAG AAGAACATCAAAGAGTTTCTGCAGAGCTTCGTCCACATCGTGCAGATGTTCATCAA CACCTCA (SEQ ID NO: 225).
- the protease cleavage site further comprises the N-terminal peptide linker, optionally selected from the group consisting of: SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS GGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGSGGGGGSGGGSGGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGSGGGGGGGGGGGSGGGGGGGS; GSTSGSGKPGSGEGSTKG; and EAAAKEAAAKEAAAK.
- the protease cleavage site further comprises the N-terminal peptide linker SGGGGSGGGGSG (SEQ ID NO: 230). In some aspects, the protease cleavage site further comprises a C-terminal peptide linker, optionally selected from the group consisting of: SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGGSGGGSGGGS; GGGSGGGSGGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGGGGSGGGGS; GGGGGGGSGGGGS; GGGGGGGGGGSGGGGGGGS; GGGGGGGGGGSGGGGGGGS; GGGGGGGGGGGGSGGGGGGGS; GGGGGGGGGGGGSGGGGGGGS; GGGGSGGGGGGGGGSGGGGGGGS; GGGGSGGGGGGSGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGSGGGGGGGG
- the protease cleavage site further comprises the C-terminal linker GGGSGGGGSGGGSLQ (SEQ ID NO: 231). In some aspects, the protease cleavage site comprises a Tumor Necrosis Factor- ⁇ Converting Enzyme (TACE)-specific cleavage site. In some aspects, the TACE-specific cleavage site comprises the amino acid sequence VTPEPIFSLI (SEQ ID NO: 191). In some aspects, the TACE-specific cleavage site comprises the amino acid sequence SGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGGSLQ (SEQ ID NO: 250).
- TACE Tumor Necrosis Factor- ⁇ Converting Enzyme
- the TACE-specific cleavage site is encoded by a polynucleotide sequence comprising the sequence TCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCTATCTT CAGCCTGATCGGCGGAGGTTCCGGAGGTGGCGGTTCCGGCGGAGGATCTCTTCAA (SEQ ID NO: 251).
- the cell membrane tethering domain comprises a transmembrane domain selected from the group consisting of: PDGFR-beta, CD8, CD28, CD3zeta-chain, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, LNGFR, NKG2D, EpoR, TNFR2, LIR1, B7-1, and BTLA.
- the cell membrane tethering domain comprises a B7-1 transmembrane domain.
- B7-1 transmembrane domain comprises the amino acid sequence LLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 204).
- B7-1 transmembrane domain is encoded by a polynucleotide sequence comprising the sequence TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGATCTGC TGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAACGAGCGGCT GAGAAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- the membrane-cleavable chimeric protein oriented from N-terminal to C-terminal, has the formula S – C – MT.
- the membrane-cleavable chimeric protein comprises the amino acid sequence MDWTWILFLVAAATRVHSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAM KCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQS FVHIVQMFINTSSGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGGSLQLLPSWAITLISV NGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 226).
- the membrane-cleavable chimeric protein is encoded by a polynucleotide sequence comprising the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCTAAT TGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCA CATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGACCG CCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGACGCC AGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTCCAG CAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAG AACATCAAAGAGTTTCTGCAGAGCTTCGTCCACATCGTGCAGATGTTCATCAACACC TCATCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCTAT CTTCAG
- the antigen-binding domain specific for EMCN comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the EMCN-VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 291), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 296), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 298)
- the EMCN-VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 299), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 300), and a
- the EMCN-VH comprises the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLEWVSVIWGNGNT HYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSS (SEQ ID NO: 302); and the EMCN-VL comprises the amino acid sequence DVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLNWFQQRPGQSPRRLIYQVSKL DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGIHLPWTFGQGTKLEIK (SEQ ID NO: 310).
- the EMCN-VH and the EMCN-VL are separated by a peptide linker.
- the antigen-binding domain specific for EMCN comprises the structure VH-L-VL or VL-L-VH, wherein L is the peptide linker.
- the peptide linker comprises the amino acid sequence SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS GGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGSGGGGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGSGGGGSGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGSGGGGGGSGGGGS; GSTSGSGKPGSGEGSTKG; or EAAAKEAAAKEAAAK.
- the peptide linker comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 244).
- the peptide linker is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCT (SEQ ID NO:
- the antigen-binding domain specific for EMCN comprises the structure VH-L-VL and comprises the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLEWVSVIWGNGNT HYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSSGGG GSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLNWFQQRPG QSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGIHLP
- the antigen-binding domain specific for EMCN is encoded by a polynucleotide sequence comprising the sequence GAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATCTCTGAG ACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCACTGGGTCCG ACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGGGGCAACGGCAACA CACACTACCACAGCCCTGAAGTCCCGGTTCACCATCTCCAGAGACAACAGCAAG AACACCCTGTACCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGTGTACTA CTGCACCCTGAGAATCAAGGATTGGGGCCAGGGCACCATGGTCACCGTTTCTTCTG GAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCTGACGTGGTCAT GACACAGAGCCCTCTGAGCCTGCCTGACACTGGGACAGCCTGCCAGCAT GACACAGAGCCCTCTGAGCC
- the intracellular inhibitory domain comprises a LIR1 intracellular inhibitory domain.
- the LIR1 intracellular inhibitory domain comprises the amino acid sequence LRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKH TQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEED RQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH (SEQ ID NO: 285).
- the LIR1 intracellular inhibitory domain is encoded by a polynucleotide sequence comprising the sequence CTGCGGCACAGAAGGCAGGGCAAGCACTGGACAAGCACCCAGAGAAAGGCCGACT TTCAGCATCCTGCTGGCGCCGTTGGACCTGAGCCTACAGATAGAGGACTGCAGTGG CGGTCTAGCCCTGCCGCTGATGCCCAAGAGGAAAATCTTTACGCCGCCGTGAAGCA CACCCAGCCTGAGGATGGCGTGGAAATGGACACCAGATCTCCCCACGATGAGGACC CTCAGGCCGTGACATACGCAGAAGTGAAGCACTCCAGACCTCGGAGAGAGATGGC AAGCCCTCCATCTCCTCTGAGCGGCGAGTTCCTGGACACCAAAGACAGACAGGCCG AAGAGGACAGACAGATGGATACCGAAGCCGCCGCTTCTGAAGCCCCACAGGATGT GACATATGCCCAGCTGCATAGCCTGACACTGCGGAGAAAAGCCACAGAGCCTCCAC CTTCTGAGCG
- the signal peptide is present in the iCAR.
- the signal peptide of the iCAR comprises a native signal peptide native or a non-native signal peptide, optionally wherein the non-native signal peptide or the non-native signal-anchor sequence is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV-G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL-8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TNFR2, and GMCSF.
- the signal peptide of the iCAR comprises a CD8 signal peptide.
- the CD8 signal peptide comprises the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO: 137).
- the CD8 signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGCTGCT AGACCA (SEQ ID NO: 416).
- the hinge domain is present in the iCAR comprises.
- the hinge domain of the iCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- the hinge domain of the iCAR comprises a LIR1 hinge.
- the LIR1 hinge comprises the amino acid sequence HPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 417).
- the LIR1 hinge comprises is encoded by a polynucleotide sequence comprising the sequence CACCCATCCGATCCTCTCGAGCTGGTGGTTTCTGGACCTTCTGGCGGCCCTAGCAGC CCTACAACAGGACCTACAAGCACAAGCGGCCCTGAGGACCAACCTCTGACACCAAC AGGCAGCGATCCTCAGTCTGGACTGGGGAGACATCTGGGCGTT (SEQ ID NO: 418).
- the hinge domain of the iCAR comprises a CD8 hinge.
- the CD8 hinge comprises the amino acid sequence TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 271).
- the CD8 hinge comprises is encoded by a polynucleotide sequence comprising the sequence ACAACAACACCCGCACCTCGGCCTCCAACTCCAGCTCCAACAATTGCACTGCAACC CCTGAGTCTGAGGCCCGAGGCCTGTAGGCCAGCAGCTGGCGGAGCTGTTCACACTA GAGGCCTGGACTTTGCCTGTGAC (SEQ ID NO: 283).
- the transmembrane domain of the iCAR is present.
- the transmembrane domain of the iCAR comprises a transmembrane domain selected from the group consisting of: PDGFR-beta, CD8, CD28, CD3zeta-chain, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, LNGFR, NKG2D, EpoR, TNFR2, B7-1, LIR1, and BTLA.
- the transmembrane domain of the iCAR comprises a LIR1 transmembrane domain.
- the LIR1 transmembrane domain comprises the amino acid sequence VIGILVAVILLLLLLLLLFLI (SEQ ID NO: 259).
- the LIR1 transmembrane domain is encoded by a polynucleotide sequence comprising the sequence GTGATCGGCATTCTGGTCGCCGTGATCCTGCTCCTGTTGCTCCTGCTGCTTCTGTTCC TGATC (SEQ ID NO: 260).
- the iCAR comprises the amino acid sequence MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYD MHWVRQAPGKGLEWVSVIWGNGNTHYHSALKSRFTISRDNSKNTLYLQMNSLRAEDT AVYYCTLRIKDWGQGTMVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASI SCKSSQSLVASDENTYLNWFQQRPGQSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKIS RVEAEDVGVYYCLQGIHLPWTFGQGTKLEIKHPSDPLELVVSGPSGGPSSPTTGPTSTSG PEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRK ADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDE DP
- the iCAR is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGCTGCT AGACCAGAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATC TCTGAGACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCACTG GGTCCGACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGGGGCAACG GCAACACACACTACCACAGCGCCCTGAAGTCCCGGTTCACCATCTCCAGAGACAAC AGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGT GTACTACTGCACCCTGAGAATCAAGGATTGGGGCCAGGGCACCATGGTCACCGTTT CTTCTGGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCTGACGTG GTCATGACACAGAGCCC
- the iCAR comprises the amino acid sequence MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASGFTFSRYD MHWVRQAPGKGLEWVSVIWGNGNTHYHSALKSRFTISRDNSKNTLYLQMNSLRAEDT AVYYCTLRIKDWGQGTMVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASI SCKSSQSLVASDENTYLNWFQQRPGQSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKIS RVEAEDVGVYYCLQGIHLPWTFGQGTKLEIKTTTPAPRPPTPAPTIALQPLSLRPEACRP AAGGAVHTRGLDFACDVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHP AGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVT YAEVK
- the iCAR is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGCTGCT AGACCAGAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATC TCTGAGACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCACTG GGTCCGACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGGGGCAACG GCAACACACACTACCACAGCGCCCTGAAGTCCCGGTTCACCATCTCCAGAGACAAC AGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGT GTACTACTGCACCCTGAGAATCAAGGATTGGGGCCAGGGCACCATGGTCACCGTTT CTTCTGGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCTGACGTG GTCATGACACAGAGCCC
- the antigen-binding domain specific for FLT3 comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the FLT3-VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GGTFSSYAIS (SEQ ID NO: 360), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of GIIPIFGTANYAQKFQG (SEQ ID NO: 361), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of FALFGFREQAFDI (SEQ ID NO: 362)
- the FLT3-VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASQSISSYLN (SEQ ID NO: 363), a light chain complementarity determining region 2 (CDR- L2) having the amino acid sequence of AASSLQS (SEQ ID NO:
- the FLT3-VH comprises the amino acid sequence EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTAN YAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCATFALFGFREQAFDIWGQGTTV TVSS (SEQ ID NO: 315); and the FLT3-VL comprises the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDLATYYCQQSYSTPFTFGPGTKVDIK (SEQ ID NO: 316).
- the antigen-binding domain specific for CD33 comprises a heavy chain variable (VH) region and a light chain variable (VL) region
- the CD33-VH comprises: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of DYNMH (SEQ ID NO: 402), a heavy chain complementarity determining region 2 (CDR- H2) having the amino acid sequence of YIYPYNGGTGYNQKFKSKA (SEQ ID NO: 403), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of GRPAMDYWGQ (SEQ ID NO: 404), and the CD33-VL comprises: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASESVDNYGISFMN (SEQ ID NO: 405), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of AASNQGS (SEQ ID NO:
- the CD33-VH comprises the amino acid sequence QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGG TGYNQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTV SS (SEQ ID NO: 329); and the CD33-VL comprises the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQG SGVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQSKEVPWTFGQGTKVEIK (SEQ ID NO: 330).
- the FLT3-VH, the FLT3-VL, the CD33-VH, and the CD33-VL are separated by peptide linkers.
- the aCAR antigen binding domains comprises the structure (FLT3-VH) – L1 – (CD33-VH) – L2 – (CD33-VL) – L3 – (FLT3-VL), wherein L1, L2, and L3 are a first, a second, and a third peptide linker, respectively.
- the L1, L2, and/or L3 are each independently selected from the group consisting of: SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS ; GGGSGGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGSGGGGGSGGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGGSGGGGS; GGGGGGGSGGGGGGGS; GGGGSGGGGGGSGGGGS; GGGGGSGGGGSGGGGGGGSGGGGGGGS; GSTSGSGKPGSGEGSTKG; and EAAAKEAAAKEAAAK.
- the L1 peptide linker is the amino acid sequence GGGGS (SEQ ID NO: 242) or GGGGSGGGGS (SEQ ID NO: 243).
- the L1 peptide linker GGGGS (SEQ ID NO: 242) is encoded by a polynucleotide sequence comprising the sequence GGCGGCGGTGGCTCT (SEQ ID NO: 254) or the L1 peptide linker GGGGSGGGGS (SEQ ID NO: 243) is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGTGGTGGATCT (SEQ ID NO: 256).
- the L2 peptide linker is the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 247). In some aspects, the L2 peptide linker is encoded by a polynucleotide sequence comprising the sequence GGCTCTACATCTGGCTCTGGCAAACCTGGAAGCGGCGAGGGATCTACCAAGGGC (SEQ ID NO: 249). In some aspects, the L2 peptide linker is the amino acid sequence GGGGSGGGGS (SEQ ID NO: 243). In some aspects, the L2 peptide linker is encoded by a polynucleotide sequence comprising the sequence GGTGGCGGAGGAAGTGGCGGCGGAGGCTCT (SEQ ID NO: 257).
- the L3 peptide linker is the amino acid sequence GGGGS (SEQ ID NO: 242)or GGGGSGGGGS (SEQ ID NO: 243).
- the L3 peptide linker GGGGS (SEQ ID NO: 242) is encoded by a polynucleotide sequence comprising the sequence GGTGGCGGCGGATCC (SEQ ID NO: 255) or the L3 peptide linker GGGGSGGGGS (SEQ ID NO: 243) is encoded by a polynucleotide sequence comprising the sequence GGCGGTGGCGGATCTGGCGGAGGTGGCAGT (SEQ ID NO: 258).
- the aCAR intracellular signaling domains that stimulate an immune response is selected from the group consisting of: CD3-zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278, Fc ⁇ RI, DAP10, DAP12, CD66d, CD97, CD2, ICOS, CD27, CD154, CD8, OX40, 4-1BB, CD28, ZAP40, CD30, GITR, HVEM, DAP10, DAP12, MyD88, 2B4, CD40, PD-1, LFA-1, CD7, LIGHT, NKG2C, B7-H3, an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a SLAM protein, an activating NK cell receptor, BTLA, a Toll ligand receptor, CDS
- the aCAR intracellular signaling domains that stimulate an immune response comprise a CD28 co-stimulatory domain and a CD3 ⁇ signaling domain.
- the CD28 co-stimulatory domain comprises the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 287).
- the CD28 co-stimulatory domain is encoded by a polynucleotide sequence comprising the sequence AGAAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCTAGAC GGCCCGGACCTACCAGAAAGCACTACCAGCCTTACGCTCCTCCTAGAGATTTCGCC GCCTACCGGTCC (SEQ ID NO: 288).
- the CD3 ⁇ signaling domain comprises the amino acid sequence RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 289).
- the CD3 ⁇ signaling domain is encoded by a polynucleotide sequence comprising the sequence AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACC AGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAG AGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGG AAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGAT TGGGATGAAAGGCGAGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGT CTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCC TCGC (SEQ ID NO: 290).
- the hinge domain of the aCAR is present.
- the hinge domain of the aCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- the hinge domain of the aCAR comprises a CD8 hinge.
- the CD8 hinge comprises the amino acid sequence ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGL DFACD (SEQ ID NO: 272).
- the CD8 hinge comprises is encoded by a polynucleotide sequence comprising the sequence GCCCTGAGCAACAGCATCATGTACTTCAGCCACTTCGTGCCCGTGTTTCTGCCCGCC AAGCCTACAACAACCCCTGCTCCTAGACCACCTACACCAGCTCCTACAATCGCCAG CCAGCCTCTGTCTCTGAGGCCCGAAGCTTGTAGACCAGCTGCTGGCGGAGCCGTGC ATACAAGAGGACTGGATTTTGCCTGCGAC (SEQ ID NO: 284).
- the transmembrane domain of the aCAR is present.
- the transmembrane domain of the aCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- the transmembrane domain of the aCAR comprises a CD8 hinge.
- the CD8 transmembrane comprises the amino acid sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206). In some aspects, the CD8 transmembrane comprises is encoded by a polynucleotide sequence comprising the sequence ATCTATATCTGGGCCCCTCTGGCTGGCACATGCGGAGTTCTGCTGCTCAGCCTGGTC ATCACCCTGTACTGCAACCACAGA (SEQ ID NO: 261). In some aspects, the aCAR signal peptide of the aCAR is present.
- the signal peptide of the aCAR is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV-G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL-8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TNFR2, GMCSF, and GM-CSFRa.
- the signal peptide of the aCAR comprises a GM-CSFRa signal peptide.
- the GM-CSFRa signal peptide comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIP (SEQ ID NO: 423).
- the GM-CSFRa signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGCTGCTGCTGGTTACATCTCTGCTGCTGTGCGAGCTGCCCCATCCTGCCTTTCTGC TTATTCCT (SEQ ID NO: 424).
- the aCAR comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCA TFALFGFREQAFDIWGQGTTVTVSSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGYT FTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYNQKFKSKATITADESTNTAYMELSSL RSEDTAVYYCARGRPAMDYWGQGTLVTVSSGSTSGSGKPGSGEGSTKGDIQMTQSPSS LSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGSGVPSRFSGS GSGTDFTLTISSLQPDDFATYYCQSKEVPWTFGQGTKVEIKG
- the aCAR comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCA TFALFGFREQAFDIWGQGTTVTVSSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCK ASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYNQKFKSKATITADESTNTAY MELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSSGGGGSGGSDIQMTQSPSSLS ASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGSGVPSRFSGSGS GTDFTLTISSLQPDDFATYYCQSKEVPWTFGQGTKVEIKGGGGSGGGGSD
- an expression vector comprising any of the multicistronic expression systems provided herein.
- the expression vector comprises the polynucleotide of SEQ ID NO: 425, SEQ ID NO: 426, SEQ ID NO: 427, SEQ ID NO: 428, SEQ ID NO: 433, SEQ ID NO: 432, or SEQ ID NO: 429.
- an isolated cell comprising any of the multicistronic expression systems provided herein or any of the expression vectors provided herein. In some aspects, the cell comprises an immune cell.
- the cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a Natural Killer T (NKT) cell, a myeloid cell, a macrophage, a human embryonic stem cell (ESC), an ESC-derived cell, a pluripotent stem cell, and induced pluripotent stem cell (iPSC), and an iPSC-derived cell.
- the cell is an NK cell.
- polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 425, SEQ ID NO: 426, SEQ ID NO: 427, SEQ ID NO: 428, SEQ ID NO: 433, SEQ ID NO: 432, or SEQ ID NO: 429. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 425. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 426. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 427.
- a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 428. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 429. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 432. Also provided herein is a polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 433. Also provided herein is a method of treating a subject in need thereof, the method comprising administering a therapeutically effective dose of any of the isolated cells provided herein or any of the polynucleotides provided herein.
- Also provided herein is a method of treating a subject with cancer, the method comprising administering to the subject an immunotherapy comprising of any of the isolated cells provided herein or any of the polynucleotides provided herein.
- a method of stimulating a cell-mediated immune response to a tumor cell in a subject the method comprising administering to a subject having a tumor a therapeutically effective dose of any of the isolated cells of any of the isolated cells provided herein or any of the polynucleotides provided herein.
- the isolated cell is derived from the subject.
- the isolated cell is allogeneic with reference to the subject.
- FIG. 1 provides a schematic illustrating components and organization of the overall FLT3 OR CD33 NOT EMCN logic-gated CAR-NK cell system.
- FIG. 2 provides a schematic illustrating components assessed in the optimization of the FLT3 OR CD33 NOT EMCN logic-gated CAR-NK cell system.
- FIG. 3 shows the gating strategy for assessing iCAR and aCAR expression by flow cytometry.
- FIG. 4 shows aCAR and iCAR expression at Day 15 for the indicated series of RetroVec constructs.
- FIG. 5 shows aCAR and iCAR expression at Day 15 for the indicated series of self-inactivated (SIN) ⁇ -retroviral SINvec constructs.
- FIG. 6 shows representative flow cytometry plots for membrane-bound IL-15 expression at Day 15 for the indicated series of RetroVec constructs.
- FIG. 7 shows representative flow cytometry plots for membrane-bound IL-15 expression at Day 15 for the indicated series of SINvec constructs.
- FIG. 8 shows a first series of comparisons for aCAR, iCAR expression, and membrane-bound IL-15 for the indicated series of RetroVec and SINvec constructs.
- FIG. 9 shows a second series of comparisons for aCAR, iCAR expression, and membrane- bound IL-15 for the indicated series of RetroVec and SINvec constructs.
- FIG. 10 shows a third series of comparisons for aCAR, iCAR expression, and membrane-bound IL-15 for the indicated series of RetroVec and SINvec constructs.
- FIG. 11 shows a summary of aCAR and iCAR expression at Day 15 as assessed by MFI for the indicated series of RetroVec and SINvec constructs.
- FIG. 12 shows a general summary of expression considerations for the various components and organizations assessed.
- FIG. 13 shows total cytotoxicity against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) for constructs using a LIR1 ICD, both for constructs ordered in an aCAR to iCAR organization (top panel) and an iCAR to aCAR organization (bottom panel).
- FIG. 14 shows normalized cytotoxicity against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) for constructs using a LIR1 ICD.
- FIG. 14 shows normalized cytotoxicity against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) for constructs using a LIR1 ICD.
- FIG. 15 shows total cytotoxicity at Day 17 against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at the indicated effector:target ratios for constructs using a LIR1 ICD for constructs ordered in an aCAR to iCAR organization.
- FIG. 15 shows total cytotoxicity at Day 17 against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at the indicated effector:target ratios for constructs using a LIR1 ICD for constructs ordered in an aCAR to iCAR organization.
- FIG. 16 shows normalized cytotoxicity at Day 10 against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at the indicated effector:target ratios for constructs using a LIR1 ICD, both for constructs ordered in an aCAR to iCAR organization (top panel) and an iCAR to aCAR organization (bottom panel).
- FIG. 17 illustrates a schematic of the Membrane-Cleavable system described herein in which a desired payload is expressed as a chimeric protein in which a protease cleavage site is inserted between the payload and membrane-tethering domain.
- the left panel illustrates a schematic of the Membrane-Cleavable system using a transmembrane spanning architecture (e.g., the chimeric protein contains a transmembrane domain).
- the right panel illustrates a schematic of the Membrane-Cleavable system using a membrane-associated architecture (e.g., the chimeric protein contains a post-translational modification tag allowing association with a cell membrane).
- FIG. 18 illustrates a representative Membrane-Cleavable system for the regulated secretion of IL-15 in which IL-15 is expressed as a chimeric protein having a cleavage site capable of cleavage by TACE inserted between the IL-15 payload and membrane-tethering domain.
- the left panel illustrates a Type I transmembrane architecture (e.g., S – C – MT) through use of Type I transmembrane domains, such as PDGFR-beta and CD8.
- the right panel a Type II transmembrane architecture (e.g., MT – C – S) through use of Type II transmembrane domains, such as NKG2D and TNFR2.
- FIG. 19 shows components and their order of the indicated constructs encoding either bivalent FLT3 OR CD33 aCARs or monospecific aCARs.
- FIG. 20 shows survival curves in MV4-11 murine tumor models for bivalent FLT3 OR CD33 CAR-NK cells and monospecific CAR-NK cells.
- FIG. 21 shows representative tumor imaging in MV4-11 murine tumor models for bivalent FLT3 OR CD33 CAR-NK cells and monospecific CAR-NK cells.
- FIG. 22 illustrates various tagged and tagless combinations of aCARs and iCARS.
- FIG. 23 shows representative flow cytometry plots for a “no virus” control used for assessing tagged and tagless CARs.
- FIG. 24 shows representative flow cytometry plots for tagless constructs SB07401 and SB07405 at Day 8.
- FIG. 25 shows representative flow cytometry plots for iCAR tagged only construct SB06467 at Day 8.
- FIG. 26 shows a summary of CD33/EMCN double positive cell percentage for the indicated constructs having either Loop 6 (top panel) or Loop 4 (bottom panel) linkers.
- FIG. 22 illustrates various tagged and tagless combinations of aCARs and iCARS.
- FIG. 23 shows representative flow cytometry plots for a “no virus” control used for assessing tagged
- FIG. 27 shows a summary of expression for each of the CD33, FLT3, and EMCN CARs for the indicated constructs having Loop 4 linkers.
- FIG. 28 shows a summary of expression for each of the CD33, FLT3, and EMCN CARs for the indicated constructs having Loop 6 linkers.
- FIG. 29 shows total cytotoxicity against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at a 1:2 effector:target ratio for constructs using a LIR1 ICD.
- FIG. 30 shows normalized cytotoxicity (normalized to no-virus control) against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at a 1:2 effector:target ratio for constructs using a LIR1 ICD.
- FIG. 31 shows normalized cytotoxicity (normalized to no-virus control) against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at a 1:4 effector:target ratio for constructs using a LIR1 ICD.
- FIG. 30 shows normalized cytotoxicity (normalized to no-virus control) against target cell lines expressing FLT3/CD33 (AML cell line MV4-11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) at a 1:4 effector
- FIG. 32 shows specific cytotoxicity of target cell lines expressing CD33 (SEM) and target cell lines also expressing the NOT gate target antigen (SEM + EMCN) at a 1:2 effector:target ratio.
- SEM target cell lines expressing CD33
- SEM + EMCN NOT gate target antigen
- FIG. 33A shows specific cytotoxicity of target cell lines expressing CD33 and target cell lines also expressing the NOT gate target antigen (SEM + EMCN) at a 1:2 effector:target ratio in a serial killing assay at 24 hours.
- FIG. 33B shows specific cytotoxicity of target cell lines expressing CD33 and target cell lines also expressing the NOT gate target antigen (SEM + EMCN) at a 1:2 effector:target ratio in a serial killing assay at 48 hours.
- FIG. 33C shows specific cytotoxicity of target cell lines expressing CD33 and target cell lines also expressing the NOT gate target antigen (SEM + EMCN) at a 1:2 effector:target ratio in a serial killing assay at 96 hours. EMCN+ right columns, respectively.
- FIG. 34A shows a general schematic of the in vivo experiment to assess the NOT-logic gated CAR-NK cells.
- FIG. 34B shows the characterization the 50:50 mixture of SEM CD33+ and SEM CD33+/EMCN+ cells shown in FIG. 34A.
- FIG. 35 shows the results of an in vivo experiment where a 1:1 mixture of SEM +/- EMCN was injected into mice and treated with NK cells transduced with the respective vector.
- FIG. 36 shows the results of FIG. 35, where the region of interest (ROI) is quantified at days 11 and 19.
- FIG. 37A shows the proportion of healthy cells in mice on day 14 of the in vivo study where mice were injected with a 1:1 mixture of SEM +/- EMCN and treated with NK cells transduced with the respective constructs.
- the circled portion compares the percentage of EMCN+ SEM cells between OR/NOT- and OR- GATED CAR-NK cell treatments showing a significantly higher percentage of EMCN+ SEM cells in the animal treated with OR/NOT GATED CAR-NK cells, demonstrating NOT GATE protection of EMCN+ cells.
- FIG. 37B shows the proportion of EMCN+ SEM cells on day 21 of the study shown in FIG. 37A.
- FIG. 37C shows the proportion of EMCN+ SEM cells on day 27 of the study shown in FIG. 37A.
- FIG. 38A shows the average BLI measurement of mice on the respective days of the in vivo study where mice were injected with MV4-11 cells and treated with NK cells transduced with the respective constructs.
- FIG. 38B shows the quantified BLI signal of the mice shown in FIG. 38A over the course of the in vivo study shown in FIG. 38A.
- FIG. 39A shows the BLI measurement of mice on the respective days of the in vivo study where mice were injected with MV4-11 cells and treated with NK cells transduced with the respective constructs.
- FIG. 39A shows the BLI measurement of mice on the respective days of the in vivo study where mice were injected with MV4-11 cells and treated with NK cells transduced with the respective constructs.
- FIG. 39B shows a representative image on day 55 post tumor transplantation of mice treated with PBS, untransduced NK cells, or NK cells transduced with SB07412 or SB07418.
- FIG. 39C shows a survival curve and the media survival (days) of the tested treated groups.
- FIG. 39D shows a continuation of the study shown in FIG. 39C, where data has been collected until day 120.
- FIG. 40 shows testing of NK cells expressing an aCAR and different iCAR intracellular domains in a cytotoxicity assay.
- FIG. 41A shows a comparison of cell-mediated cytotoxicity against MOLM-13 using non- engineered or engineered NK cells.
- FIG. 41B shows a comparison of cell-mediated cytotoxicity against MV4-11 using non- engineered or engineered NK cells.
- FIG. 41C shows a comparison of cell-mediated cytotoxicity against SEM-CD33 using non- engineered or engineered NK cells.
- FIG. 41D shows NK cytotoxicity of MOLM-13 cells at multiple E:T ratios.
- FIG. 41E shows NK cytotoxicity of MV4-11 at multiple E:T ratios.
- FIG. 41F shows NK cytotoxicity of engineered NK cells and non-engineered NK cells from multiple experiments plotted against CD33 CAR expression.
- FIG. 42 shows a heat map to visualize fold expression analysis of cytokine production by NK cells following co-culture with MV4-11 or MOLM-13.
- FIG. 43A shows NK-cell cytotolxicity of engineered and non engineered NK cells derived from donor A that are co-cultured with primary AML samples.
- FIG. 43B shows NK-cell cytotolxicity of engineered and non engineered NK cells derived from donor B that are co-cultured with primary AML samples.
- FIG. 44 shows a heat map analysis of NK activation markers as analyzed by flow cytometry.
- FIG. 45A shows expression of surface associated IL15 in transduced NK cells derived from different donors.
- FIG. 45B shows expression of secreted IL15 in transduced NK cells derived from different donors.
- FIG. 45C shows expression of the CD33/FLT3 bivalent aCAR in transduced NK cells derived from different donors.
- FIG. 45D shows expression of the EMCN iCAR in engineered NK cells derived from different donors.
- FIG. 46A shows results from a cytotoxicity assay of engineered NK cells incubated with human stem cells expressing EMCN.
- FIG. 46B shows results from a cytoxicity assay of engineered NK cells incubated with AML (Leukemia cells).
- FIG. 46C shows results from a cytoxicity assay of engineerered NK cells incubated with human stem progenitor cells.
- FIG. 46D shows results from a cytoxicity assay of engineered NK cells incubated with primary healthy MPPs. Shown are results for the whole healthy MPP population.
- FIG. 46A shows results from a cytotoxicity assay of engineered NK cells incubated with human stem cells expressing EMCN.
- FIG. 46B shows results from a cytoxicity assay of engineered NK cells incubated with AML (Leukemia cells).
- FIG. 46C shows
- FIG. 46E shows results from a cytoxicity assay of engineered NK cells incubated with primary healthy MPPs. Shown are results for the healthy EMCN+ MPPs population.
- FIG. 47 shows EMCN expression on various hematopoietic stem and progenitor cell (HSPC) subpopulations in CD34-enriched primary human bone marrow cells, including hematopoietic progenitor cells (HPC), lympho-myeloid primed progenitor cells (LMPPs), multipotent progenitor cells (MPPs), in addition to HSCs, across two representative donors.
- FIG. 48 shows a flow cytometry gating strategy to count the number of live remaining EMCN+ HSCs after killing assay.
- the present disclosure provides multicistronic expression systems.
- the multicistronic systems encode (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR.
- the multicistronic systems include FLT3 OR CD33 NOT EMCN logic-gated CARs and a membrane-cleavable chimeric protein encoding IL-15.
- multicistronic expression systems that include an engineered nucleic acid encoding: (A) an exogenous polynucleotide encoding a membrane-cleavable chimeric protein, oriented from N-terminal to C-terminal, having the formula: S – C – MT or MT – C – S wherein S includes a secretable effector molecule, wherein the secretable effector molecule includes IL-15, C includes a protease cleavage site , and MT includes a cell membrane tethering domain.
- an exogenous polynucleotide encoding an inhibitory chimeric antigen receptor including: (i) an antigen-binding domain specific for endomucin (EMCN); (ii) one or more intracellular inhibitory domains that inhibit an immune response, and (iii) one or more polypeptides selected from the group consisting of: a signal peptide, a transmembrane domain, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof; and (C) an exogenous polynucleotide encoding a bivalent activating chimeric antigen receptor (aCAR ) including: (i) an antigen-binding domain specific for FLT3; (ii) an antigen-binding domain specific for CD33; (iii) one or more intracellular signaling domains that stimulate an immune response,
- the expression systems described herein are multicistronic, . ., more than one separate polypeptide (e.g., multiple chimeric proteins) can be produced from a single mRNA transcript.
- Engineered nucleic acids can be multicistronic through the use of various linkers, e.g., a polynucleotide sequence encoding a first chimeric proteins can be linked to a nucleotide sequence encoding a second chimeric protein, such as in a first gene:linker:second gene 5’ to 3’ orientation.
- a linker can encode a 2A ribosome skipping element, such as T2A.
- Other 2A ribosome skipping elements include, but are not limited to, E2A, P2A, and F2A.
- 2A ribosome skipping elements allow production of separate polypeptides encoded by the first and second genes are produced during translation.
- 2A ribosome skipping elements can include fusion peptides of 2A ribosome skipping elements, including, but not limited to, an E2A/T2A ribosome skipping element.
- the E2A/T2A ribosome skipping element comprises the amino acid sequence of GSGQCTNYALLKLAGDVESNPGPGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 219).
- One exemplary nucleic acid encoding the E2A/T2A ribosome skipping element is GGTAGCGGCCAGTGTACCAACTACGCCCTGCTGAAACTGGCCGGCGACGTGGAATC TAATCCTGGACCTGGATCTGGCGAGGGACGCGGGAGTCTACTGACGTGTGGAGACG TGGAGGAAAACCCTGGACCT (SEQ ID NO: 220).
- a nucleic acid encoding the E2A/T2A ribosome skipping element includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 220.
- an engineered nucleic acid disclosed herein comprises an E2A/T2A ribosome skipping element.
- the E2A/T2A ribosome skipping element comprises the amino acid sequence of QCTNYALLKLAGDVESNPGPGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 221).
- One exemplary nucleic acid encoding the E2A/T2A ribosome skipping element is CAGTGTACCAACTACGCCCTGCTGAAACTGGCCGGCGACGTGGAATCTAATCCTGG ACCTGGATCTGGCGAGGGACGCGGGAGTCTACTGACGTGTGGAGACGTGGAGGAA AACCCTGGACCT (SEQ ID NO: 222).
- Another exemplary nucleic acid encoding the E2A/T2A ribosome skipping element is CAGTGCACAAATTATGCACTGCTGAAGCTCGCCGGGGATGTCGAGAGTAACCCAGG ACCTGGAAGCGGAGAAGGTCGTGGTAGTCTACTAACGTGTGGTGATGTAGAAGAAA ATCCTGGACCT (SEQ ID NO: 223).
- a nucleic acid encoding the E2A/T2A ribosome skipping element includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 222 or SEQ ID NO: 223.
- a linker can encode a cleavable linker polypeptide sequence, such as a Furin cleavage site or a TEV cleavage site, wherein following expression the cleavable linker polypeptide is cleaved such that separate polypeptides encoded by the first and second genes are produced.
- a cleavable linker can include a polypeptide sequence, such as such a flexible linker (e.g., a Gly- Ser-Gly sequence), that further promotes cleavage.
- a linker can encode an Internal Ribosome Entry Site (IRES), such that separate polypeptides encoded by the first and second genes are produced during translation.
- IRS Internal Ribosome Entry Site
- a linker can encode a splice acceptor, such as a viral splice acceptor.
- a linker can be a combination of linkers, such as a Furin-2A linker that can produce separate polypeptides through 2A ribosome skipping followed by further cleavage of the Furin site to allow for complete removal of 2A residues.
- a combination of linkers can include a Furin sequence, a flexible linker, and 2A linker. Accordingly, in some embodiments, the linker is a Furin-Gly-Ser-Gly-2A fusion polypeptide. In some embodiments, a linker of the present disclosure is a Furin-Gly-Ser-Gly-T2A fusion polypeptide.
- a multicistronic system can use any number or combination of linkers, to express any number of genes or portions thereof (e.g., an engineered nucleic acid can encode a first, a second, and a third chimeric protein, each separated by linkers such that separate polypeptides encoded by the first, second, and third chimeric proteins are produced).
- the exogenous polynucleotides encoding each of the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR can be encoded in any order.
- the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR can be encoded by the multicistronic system in order from 5’ to 3’: (i) membrane-cleavable chimeric protein; (ii) bivalent aCAR; and (iii) iCAR.
- the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR can be encoded by the multicistronic system in order from 5’ to 3’: i) membrane-cleavable chimeric protein; (ii) iCAR; and (iii) bivalent aCAR.
- Membrane Cleavable Chimeric Proteins The multicistronic systems herein encode membrane-cleavable chimeric proteins having the formula S – C – MT or MT – C – S, oriented from N-terminal to C-terminal and expressed as a single polypeptide.
- S refers to a secretable effector molecule.
- C refers to a protease cleavage site.
- MT refers to a cell membrane tethering domain.
- the membrane-cleavable chimeric protein is engineered such that secretion of the effector molecule can be regulated in a protease- dependent manner.
- the membrane-cleavable chimeric protein is engineered such that secretion of the effector molecule can be regulated as part of a “Membrane-Cleavable” system, where incorporation of a protease cleavage site (“C”) and a cell membrane tethering domain (“MT”) allow for regulated secretion of an effector molecule in a protease-dependent manner.
- C protease cleavage site
- MT cell membrane tethering domain
- the components of the Membrane-Cleavable system present in the membrane-cleavable chimeric protein generally regulate secretion through the below cellular processes: - MT:
- the cell membrane tethering domain contains a transmembrane domain (or a transmembrane-intracellular domain) that directs cellular-trafficking of the chimeric protein such that the protein is inserted into, or otherwise associated with, a cell membrane (“tethered”)
- - C Following expression and localization of the chimeric protein into the cell membrane, the protease cleavage site directs cleavage of the chimeric protein such that the effector molecule is released (“secreted”) into the extracellular space.
- the protease cleavage site is protease-specific, including sites engineered to be protease-specific.
- the protease cleavage site can be selected or engineered to achieve optimal protein expression, cell-type specific cleavage, cell-state specific cleavage, and/or cleavage and release of the payload at desired kinetics (e.g., ratio of membrane-bound to secreted chimeric protein levels)
- FIG. 17 illustrates a schematic of the Membrane-Cleavable system described herein in which a desired payload is expressed as a chimeric protein in which a protease cleavage site is inserted between the payload and membrane-tethering domain.
- the left panel illustrates a schematic of the Membrane-Cleavable system using a transmembrane spanning architecture (e.g., the chimeric protein contains a transmembrane domain).
- the right panel illustrates a schematic of the Membrane-Cleavable system using a membrane-associated architecture (e.g., the chimeric protein contains a post-translational modification tag allowing association with a cell membrane).
- FIG. 18 illustrates a representative Membrane-Cleavable system for the regulated secretion of IL-15 in which IL-15 is expressed as a chimeric protein having a cleavage site capable of cleavage by TACE inserted between the IL-15 payload and membrane-tethering domain.
- the left panel illustrates a Type I transmembrane architecture (e.g., S – C – MT) through use of Type I transmembrane domains, such as PDGFR-beta and CD8.
- the right panel a Type II transmembrane architecture (e.g., MT – C – S) through use of Type II transmembrane domains, such as NKG2D and TNFR2.
- membrane-cleavable chimeric proteins (or engineered nucleic acids encoding the membrane-cleavable chimeric proteins) are provided for herein having a protein of interest (e.g., any of the effector molecules described herein), a protease cleavage site, and a cell membrane tethering domain.
- an effector molecule may act as a ligand to increase or decrease enzymatic activity, gene expression, or cell signaling.
- an effector molecule modulates (activates or inhibits) different immunomodulatory mechanisms.
- an effector molecule may also indirectly modulate a second, downstream molecule.
- an effector molecule is a secretable effector molecule (e.g., referred to as “S” in the formula S – C – MT or MT – C – S for membrane-cleavable chimeric proteins described herein).
- Non-limiting examples of effector molecules include cytokines, chemokines, enzymes that modulate metabolite levels, growth factors, co-activation molecules, tumor microenvironment modifiers, ligands, peptides, enzymes, antibodies, antibodies or decoy molecules that modulate cytokines, homing molecules, and/or integrins.
- modulate encompasses maintenance of a biological activity, inhibition (partial or complete) of a biological activity, and stimulation/activation (partial or complete) of a biological activity. The term also encompasses decreasing or increasing (e.g., enhancing) a biological activity.
- Two different effector molecules are considered to “modulate different tumor-mediated immunosuppressive mechanisms” when one effector molecule modulates a tumor-mediated immunosuppressive mechanism (e.g., stimulates T cell signaling) that is different from the tumor-mediated immunosuppressive mechanism modulated by the other effector molecule (e.g., stimulates antigen presentation and/or processing).
- Modulation by an effector molecule may be direct or indirect. Direct modulation occurs when an effector molecule binds to another molecule and modulates activity of that molecule. Indirect modulation occurs when an effector molecule binds to another molecule, modulates activity of that molecule, and as a result of that modulation, the activity of yet another molecule (to which the effector molecule is not bound) is modulated.
- modulation of a tumor-mediated immunosuppressive mechanism by at least one effector molecule results in an increase in an immunostimulatory and/or anti- tumor immune response (e.g., systemically or in the tumor microenvironment) by at least 10% (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 200%).
- modulation of a tumor-mediated immunosuppressive mechanism may result in an increase in an immunostimulatory and/or anti-tumor immune response by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%.
- modulation of a tumor-mediated immunosuppressive mechanism results in an increase in an immunostimulatory and/or anti-tumor immune response 10-20%, 10-30%, 10- 40%, 10-50%, 10-60%, 10-70%, 10-80%, 10-90%, 10-100%, 10-200%, 20-30%, 20-40%, 20- 50%, 20-60%, 20-70%, 20-80%, 20-90%, 20-100%, 20-200%, 50-60%, 50-70%, 50-80%, 50- 90%, 50-100%, or 50-200%.
- an increase in an immunostimulatory and/or anti-tumor immune response is relative to the immunostimulatory and/or anti-tumor immune response that would otherwise occur, in the absence of the effector molecule(s).
- modulation of a tumor-mediated immunosuppressive mechanism by at least one effector molecule results in an increase in an immunostimulatory and/or anti- tumor immune response (e.g., systemically or in the tumor microenvironment) by at least 2 fold (e.g., 2, 3, 4, 5, 10, 25, 20, 25, 50, or 100 fold).
- modulation of a tumor-mediated immunosuppressive mechanism may result in an increase in an immunostimulatory and/or anti- tumor immune response by at least 3 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold.
- modulation of a tumor-mediated immunosuppressive mechanism results in an increase in an immunostimulatory and/or anti- tumor immune response by 2-10, 2-20, 2-30, 2-40, 2-50, 2-60, 2-70, 2-80, 2-90, or 2-100 fold.
- Non-limiting examples of immunostimulatory and/or anti-tumor immune mechanisms include T cell signaling, activity and/or recruitment, antigen presentation and/or processing, natural killer cell-mediated cytotoxic signaling, activity and/or recruitment, dendritic cell differentiation and/or maturation, immune cell recruitment, pro-inflammatory macrophage signaling, activity and/or recruitment, stroma degradation, immunostimulatory metabolite production, stimulator of interferon genes (STING) signaling (which increases the secretion of IFN and Th1 polarization, promoting an anti-tumor immune response), and/or Type I interferon signaling.
- STING stimulator of interferon genes
- An effector molecule may stimulate at least one (one or more) of the foregoing immunostimulatory mechanisms, thus resulting in an increase in an immunostimulatory response.
- Changes in the foregoing immunostimulatory and/or anti-tumor immune mechanisms may be assessed, for example, using in vitro assays for T cell proliferation or cytotoxicity, in vitro antigen presentation assays, expression assays (e.g., of particular markers), and/or cell secretion assays (e.g., of cytokines).
- modulation of a tumor-mediated immunosuppressive mechanism by at least one effector molecule results in a decrease in an immunosuppressive response (e.g., systemically or in the tumor microenvironment) by at least 10% (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 200%).
- modulation of a tumor-mediated immunosuppressive mechanism may result in a decrease in an immunosuppressive response by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%.
- modulation of a tumor-mediated immunosuppressive mechanism results in a decrease in an immunosuppressive response 10- 20%, 10-30%, 10-40%, 10-50%, 10-60%, 10-70%, 10-80%, 10-90%, 10-100%, 10-200%, 20- 30%, 20-40%, 20-50%, 20-60%, 20-70%, 20-80%, 20-90%, 20-100%, 20-200%, 50-60%, 50- 70%, 50-80%, 50-90%, 50-100%, or 50-200%.
- a decrease” in an immunosuppressive response for example, systemically or in a tumor microenvironment, is relative to the immunosuppressive response that would otherwise occur, in the absence of the effector molecule(s).
- modulation of a tumor-mediated immunosuppressive mechanism by at least one effector molecule results in a decrease in an immunosuppressive response (e.g., systemically or in the tumor microenvironment) by at least 2 fold (e.g., 2, 3, 4, 5, 10, 25, 20, 25, 50, or 100 fold).
- modulation of a tumor-mediated immunosuppressive mechanism may result in a decrease in an immunosuppressive response by at least 3 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold.
- modulation of a tumor-mediated immunosuppressive mechanism results in a decrease in an immunosuppressive response by 2-10, 2-20, 2-30, 2-40, 2-50, 2-60, 2-70, 2-80, 2-90, or 2-100 fold.
- immunosuppressive mechanisms include negative costimulatory signaling, pro-apoptotic signaling of cytotoxic cells (e.g., T cells and/or NK cells), T regulatory (Treg) cell signaling, tumor checkpoint molecule production/maintenance, myeloid-derived suppressor cell signaling, activity and/or recruitment, immunosuppressive factor/metabolite production, and/or vascular endothelial growth factor signaling.
- An effector molecule may inhibit at least one (one or more) of the foregoing immunosuppressive mechanisms, thus resulting in a decrease in an immunosuppressive response.
- Changes in the foregoing immunosuppressive mechanisms may be assessed, for example, by assaying for an increase in T cell proliferation and/or an increase in IFN ⁇ production (negative co-stimulatory signaling, Treg cell signaling and/or MDSC); Annexin V/PI flow staining (pro-apoptotic signaling); flow staining for expression, e.g., PDL1 expression (tumor checkpoint molecule production/maintenance); ELISA, LUMINEX®, RNA via qPCR, enzymatic assays, e.g., IDO tryptophan catabolism (immunosuppressive factor/metabolite production); and phosphorylation of PI3K, Akt, p38 (VEGF signaling).
- effector molecules function additively: the effect of two effector molecules, for example, may be equal to the sum of the effect of the two effector molecules functioning separately.
- effector molecules function synergistically: the effect of two effector molecules, for example, may be greater than the combined function of the two effector molecules.
- Effector molecules that modulate tumor-mediated immunosuppressive mechanisms and/or modify tumor microenvironments may be, for example, secreted factors (e.g., cytokines, chemokines, antibodies, and/or decoy receptors that modulate extracellular mechanisms involved in the immune system), inhibitors (e.g., antibodies, antibody fragments, ligand TRAP and/or small blocking peptides), intracellular factors that control cell state (e.g., microRNAs and/or transcription factors that modulate the state of cells to enhance pro-inflammatory properties), factors packaged into exosomes (e.g., microRNAs, cytosolic factors, and/or extracellular factors), surface displayed factors (e.g., checkpoint inhibitors, TRAIL), and and/or metabolic genes (e.g., enzymes that produce/modulate or degrade metabolites or amino acids).
- secreted factors e.g., cytokines, chemokines, antibodies, and/or decoy receptors that modulate extracellular mechanisms involved in the immune
- At least one of the effector molecules stimulates an immunostimulatory mechanism in the tumor microenvironment and/or inhibits an immunosuppressive mechanism in the tumor microenvironment.
- at least one of the effector molecules (a) stimulates T cell signaling, activity and/or recruitment, (b) stimulates antigen presentation and/or processing, (c) stimulates natural killer cell-mediated cytotoxic signaling, activity and/or recruitment, (d) stimulates dendritic cell differentiation and/or maturation, (e) stimulates immune cell recruitment, (f) stimulates pro-inflammatory macrophage signaling, activity and/or recruitment or inhibits anti-inflammatory macrophage signaling, activity and/or recruitment, (g) stimulates stroma degradation, (h) stimulates immunostimulatory metabolite production, (i) stimulates Type I interferon signaling, (j) inhibits negative costimulatory signaling, (k) inhibits pro- apoptotic signaling of anti-tumor immune cells, (l) inhibits T regulatory (T
- effector molecules may be selected from the following non- limiting classes of molecules: cytokines, antibodies, chemokines, nucleotides, peptides, and enzymes.
- Non-limiting examples of the foregoing classes of effector molecules are listed in Table 1 and specific sequences encoding exemplary effector molecules are listed in Table 2.
- Effector molecules can be human, such as those listed in Table 1 or Table 2 or human equivalents of murine effector molecules listed in Table 1 or Table 2.
- Effector molecules can be human-derived, such as the endogenous human effector molecule or an effector molecule modified and/or optimized for function, e.g., codon optimized to improve expression, modified to improve stability, or modified at its signal sequence (see below).
- the effector molecule comprises interleukin 12 (IL-12), for example, p35 and p40 as a dimer that is generally referred to in the art as IL12p70.
- the first effector molecule comprises an IL12p70 fusion protein.
- the IL12p70 fusion protein is a human IL12p70 fusion protein.
- the human IL12p70 fusion protein comprises the sequence shown in SEQ ID NO: 203.
- the effector molecule comprises interleukin 15 (IL-15).
- the effector molecule consists of IL-15 (see, e.g., SEQ ID NO: 199).
- the effector molecule comprises a fusion protein including IL-15 and an extracellular portion of IL-15 Receptor ⁇ (IL-15R ⁇ ), such as the sushi domain as shown in SEQ ID NO: 201.
- IL-15R ⁇ extracellular portion of IL-15 Receptor ⁇
- An exemplary IL-15/IL-15R ⁇ sushi domain fusion is provided as SEQ ID NO: 202.
- the effector molecule includes IL-15 having the amino acid sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIH DTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS (SEQ ID NO: 224).
- IL-15 is encoded by a polynucleotide sequence comprising the sequence AATTGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCAT GCACATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGA CCGCCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGAC GCCAGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTC CAGCAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAG AAGAACATCAAAGAGTTTCTGCAGAGCTTCGTCCACATCGTGCAGATGTTCATCAA CACCTCA (SEQ ID NO: 225).
- IL-15 is encoded by a polynucleotide sequence that includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to AATTGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCAT GCACATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGA CCGCCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGAC GCCAGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTC CAGCAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAG AAGAACATCAAAGAGTTTCTGCAGAGCTTCGTCCACATCGTGCAGATGTTCATCAA CACCTCA (SEQ ID NO:
- the membrane-cleavable chimeric protein includes the amino acid sequence MDWTWILFLVAAATRVHSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAM KCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQS FVHIVQMFINTSSGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGGSLQLLPSWAITLISV NGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 226).
- the membrane-cleavable chimeric protein is encoded by a polynucleotide sequence comprising the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCTAAT TGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCA CATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGACCG CCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGACGCC AGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTCCAG CAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAG AACATCAAAGAGTTTCTGCAGAGCTTCGTCCACATCGTGCAGATGTTCATCAACACC TCATCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCTAT CTTCTCGGCATCG
- the membrane-cleavable chimeric protein is encoded by a polynucleotide sequence that includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCTAAT TGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAGAGCATGCA CATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCTGCAAAGTGACCG CCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCTGGAAAGCGGCGACGCC AGCATCCACGATACCGTGGAAAATCTGATCATCCTGGCCAACAACAGCCTGTCCAG CAACGGCAATGTGACCGAGAGCGGCTGCAAAGAGTGCGAGGAACTGGAAGAGAAG AACATC
- the one or more effector molecules of the chimeric proteins provided for herein can be secretable effector molecules having a secretion signal peptide (also referred to as a signal peptide or signal sequence) at the chimeric protein’s N-terminus (e.g., an effector molecule’s N- terminus for S – C – MT) that direct newly synthesized proteins destined for secretion or membrane localization (also referred to as membrane insertion) to the proper protein processing pathways.
- a secretion signal peptide also referred to as a signal peptide or signal sequence
- a membrane tethering domain generally has a signal-anchor sequence (e.g., signal-anchor sequences of a Type II transmembrane protein) that direct newly synthesized proteins destined for membrane localization to the proper protein processing pathways.
- a membrane tethering domain having a reverse signal-anchor sequence e.g., signal-anchor sequences of certain Type III transmembrane proteins
- a reverse signal-anchor sequence e.g., signal-anchor sequences of certain Type III transmembrane proteins
- the one or more effector molecules are secretable effector molecules (referred to as “S” in the formula S – C – MT or MT – C – S).
- each chimeric protein can comprise a secretion signal.
- each chimeric protein can comprise a secretion signal such that each effector molecule is capable of secretion from an engineered cell following cleavage of the protease cleavage site.
- the secretion signal peptide operably associated with an effector molecule can be a native secretion signal peptide (e.g., the secretion signal peptide generally endogenously associated with the given effector molecule).
- the secretion signal peptide operably associated with an effector molecule can be a non-native secretion signal peptide native secretion signal peptide.
- Non-native secretion signal peptides can promote improved expression and function, such as maintained secretion, in particular environments, such as tumor microenvironments.
- Non-limiting examples of non-native secretion signal peptide are shown in Table 3.
- a secretion signal peptide can be an IgE signal peptide.
- An IgE signal peptide can include the amino acid sequence MDWTWILFLVAAATRVHS (SEQ ID NO: 228).
- An IgE signal peptide can be encoded by a polynucleotide sequence that includes the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCT (SEQ ID NO: 229).
- An IgE signal peptide can be encoded by a polynucleotide sequence that includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCT (SEQ ID NO: 229).
- a secretion signal peptide of the membrane-cleavable chimeric protein e.g., IL-15
- IL-15 can be an IgE signal peptide.
- An IgE signal peptide of the membrane-cleavable chimeric protein can include the amino acid sequence MDWTWILFLVAAATRVHS (SEQ ID NO: 228).
- An IgE signal peptide of the membrane-cleavable chimeric protein e.g., IL-15
- An IgE signal peptide of the membrane-cleavable chimeric protein (e.g., IL- 15) can be encoded by a polynucleotide sequence that includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACTCT (SEQ ID NO: 229).
- Table 3 Exemplary Signal Secretion Peptides
- the chimeric proteins provided for herein contain a protease cleavage site (e.g., referred to as “C” in the formula S – C – MT or MT – C – S for membrane-cleavable chimeric proteins described herein).
- a protease cleavage site e.g., referred to as “C” in the formula S – C – MT or MT – C – S for membrane-cleavable chimeric proteins described herein.
- the protease cleavage site can be any amino acid sequence motif capable of being cleaved by a protease.
- protease cleavage sites include, but are not limited to, a Type 1 transmembrane protease cleavage site, a Type II transmembrane protease cleavage site, a GPI anchored protease cleavage site, an ADAM8 protease cleavage site, an ADAM9 protease cleavage site, an ADAM10 protease cleavage site, an ADAM12 protease cleavage site, an ADAM15 protease cleavage site, an ADAM17 protease cleavage site, an ADAM19 protease cleavage site, an ADAM20 protease cleavage site, an ADAM21 protease cleavage site, an ADAM28 protease cleavage site, an ADAM30 protease cleavage site, an ADAM33 protease cleavage site, a BACE1 protease cleavage site,
- protease cleavage site is a hepatitis C virus (HCV) nonstructural protein 3 (NS3) protease cleavage site, including, but not limited to, a NS3/NS4A, a NS4A/NS4B, a NS4B/NS5A, or a NS5A/NS5B cleavage site.
- HCV hepatitis C virus
- NS3 protease and representative sequences of its cleavage sites for various strains of HCV see, e.g., Hepatitis C Viruses: Genomes and Molecular Biology (S.L. Tan ed., Taylor & Francis, 2006), Chapter 6, pp.
- HCV NS4A/4B protease cleavage site HCV NS5A/5B protease cleavage site
- C-terminal degron with NS4A/4B protease cleavage site N-terminal degron with HCV NS5A/5B protease cleavage site
- Representative NS3 sequences are listed in the National Center for Biotechnology Information (NCBI) database. See, for example, NCBI entries: Accession Nos.
- ADAM17-specific protease also referred to as Tumor Necrosis Factor- ⁇ Converting Enzyme [TACE]
- TACE Tumor Necrosis Factor- ⁇ Converting Enzyme
- An ADAM17-specific protease cleavage site can be an endogenous sequence of a substrate naturally cleaved by ADAM17.
- An ADAM17-specific protease cleavage site can be an engineered sequence capable of being cleaved by ADAM17.
- An engineered ADAM17-specific protease cleavage site can be an engineered for specific desired properties including, but not limited to, optimal expression of the chimeric proteins, specificity for ADAM17, rate-of- cleavage by ADAM17, ratio of secreted and membrane-bound chimeric protein levels, and cleavage in different cell states.
- a protease cleavage site can be selected for specific cleavage by ADAM17.
- certain protease cleavage sites capable of being cleaved by ADAM17 are also capable of cleavage by additional ADAM family proteases, such as ADAM10.
- an ADAM17-specific protease cleavage site can be selected and/or engineered such that cleavage by other proteases, such as ADAM10, is reduced or eliminated.
- a protease cleavage site can be selected for rate-of-cleavage by ADAM17.
- it can be desirable to select a protease cleavage site demonstrating a specific rate-of-cleavage by ADAM17, such as reduced cleavage kinetics relative to an endogenous sequence of a substrate naturally cleaved by ADAM17.
- a specific rate-of-cleavage can be selected to regulate the rate of processing of the chimeric protein, which in turn regulates the rate of release/secretion of the payload effector molecule.
- an ADAM17-specific protease cleavage site can be selected and/or engineered such that the sequence demonstrates a desired rate-of-cleavage by ADAM17.
- a protease cleavage site can be selected for both specific cleavage by ADAM17 and rate-of-cleavage by ADAM17.
- ADAM17-specific protease cleavage sites including those demonstrating particular specificity and rate-of-cleavage kinetics, are shown in Table 4A below with reference to the site of cleavage (P5-P1: N-terminal; P1'-P5': C-terminal). Further details of ADAM17 and ADAM10, including expression and protease cleavage sites, are described in Sharma, et al. (J Immunol October 15, 2017, 199 (8) 2865-2872), Pham et al. (Anticancer Res. 2017 Oct;37(10):5507-5513), Caescu et al. (Biochem J. 2009 Oct 23; 424(1): 79–88), and Tucher et al. (J.
- the protease cleavage site comprises a first region having the amino acid sequence of PRAE (SEQ ID NO: 176). In some embodiments, the protease cleavage site comprises a second region having the amino acid sequence of KGG (SEQ ID NO: 177). In some embodiments, the first region is located N-terminal to the second region.
- the protease cleavage site comprises the amino acid sequence of PRAEX 1 X 2 KGG (SEQ ID NO: 178), wherein X1 is A, Y, P, S, or F, and wherein X2 is V, L, S, I, Y, T, or A.
- the protease cleavage site comprises the amino acid sequence of PRAEX 1 X 2 KGG (SEQ ID NO: 178), wherein X 1 is A, Y, P, S, or F, and wherein X 2 is V, L, S, I, Y, or T.
- the protease cleavage site comprises the amino acid sequence of PRAEAVKGG (SEQ ID NO: 179). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEALKGG (SEQ ID NO: 180). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEYSKGG (SEQ ID NO: 181). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEPIKGG (SEQ ID NO: 182). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEAYKGG (SEQ ID NO: 183).
- the protease cleavage site comprises the amino acid sequence of PRAESSKGG (SEQ ID NO: 184). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEFTKGG (SEQ ID NO: 185). In some embodiments, the protease cleavage site comprises the amino acid sequence of PRAEAAKGG (SEQ ID NO: 186). In some embodiments, the protease cleavage site comprises the amino acid sequence of DEPHYSQRR (SEQ ID NO: 187). In some embodiments, the protease cleavage site comprises the amino acid sequence of PPLGPIFNPG (SEQ ID NO: 188).
- the protease cleavage site comprises the amino acid sequence of PLAQAYRSS (SEQ ID NO: 189). In some embodiments, the protease cleavage site comprises the amino acid sequence of TPIDSSFNPD (SEQ ID NO: 190). In some embodiments, the protease cleavage site comprises the amino acid sequence of VTPEPIFSLI (SEQ ID NO: 191). The protease cleavage sites of SEQ ID NOs: 187, 189, and 191 are cleavable by ADAM17. In some embodiments, the protease cleavage site can include an N-terminal peptide linker, such as SGGGGSGGGGSG (SEQ ID NO: 230).
- the protease cleavage site can include a C-terminal peptide linker, such as GGGSGGGGSGGGSLQ (SEQ ID NO: 231).
- the protease cleavage site can include an N-terminal peptide linker and a C-terminal peptide linker, such as both table (SEQ ID NO: 230) and GGGSGGGGSGGGSLQ (SEQ ID NO: 231).
- the protease cleavage site can include a Tumor Necrosis Factor- ⁇ Converting Enzyme (TACE )-specific cleavage site (also referred to as ADAM17), an N- terminal peptide linker, and a C-terminal peptide linker.
- TACE Tumor Necrosis Factor- ⁇ Converting Enzyme
- ADAM17 Tumor Necrosis Factor- ⁇ Converting Enzyme
- the protease cleavage site can include the TACE -specific cleavage site VTPEPIFSLI (SEQ ID NO: 191), an N-terminal peptide linker, and a C-terminal peptide linker.
- the protease cleavage site can include the TACE -specific cleavage site, an N-terminal peptide linker, and a C-terminal peptide linker and have the amino acid sequence SGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGGSLQ (SEQ ID NO: 250).
- the protease cleavage site can include the TACE -specific cleavage site, an N- terminal peptide linker, and a C-terminal peptide linker encoded by a polynucleotide sequence comprising the sequence TCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCTATCTT CAGCCTGATCGGCGGAGGTTCCGGAGGTGGCGGTTCCGGCGGAGGATCTCTTCAA (SEQ ID NO: 251).
- the protease cleavage site can include the TACE - specific cleavage site, an N-terminal peptide linker, and a C-terminal peptide linker encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to TCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCTATCTT CAGCCTGATCGGCGGAGGTTCCGGAGGTGGCGGTTCCGGCGGAGGATCTCTTCAA (SEQ ID NO: 251).
- the protease cleavage site comprises the amino acid sequence of ITQGLAVSTISSFF (SEQ ID NO: 198), which is a cleavage site that is native to CD16 and is cleavable by ADAM17.
- the protease cleavage site can be C-terminal of the secretable effector molecule.
- the protease cleavage site can be N-terminal of the secretable effector molecule.
- the protease cleavage site is either: (1) C-terminal of the secretable effector molecule and N-terminal of the cell membrane tethering domain (in other words, the protease cleavage site is in between the secretable effector molecule and the cell membrane tethering domain); or (2) N-terminal of the secretable effector molecule and C-terminal of the cell membrane tethering domain (also between the secretable effector molecule and the cell membrane tethering domain with domain orientation inverted).
- the protease cleavage site can be connected to the secretable effector molecule by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of the effector molecule or protease cleavage site.
- the protease cleavage site can be connected to the cell membrane tethering domain by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of the cell membrane tethering domain or protease cleavage site.
- a polypeptide linker can be any amino acid sequence that connects a first polypeptide sequence and a second polypeptide sequence.
- a polypeptide linker can be a flexible linker (e.g., a Gly-Ser-Gly sequence).
- polypeptide linkers include, but are not limited to, GSG linkers (e.g., [GS]4GG [SEQ ID NO: 182]), A(EAAAK)3A (SEQ ID NO: 183), and Whitlow linkers (e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK linker such as the amino acid sequence EGKSSGSGSESKST (SEQ ID NO: 185), and linkers described in more detail in Issued U.S. Pat. No. 5,990,275 herein incorporated by reference).
- GSG linkers e.g., [GS]4GG [SEQ ID NO: 182]
- A(EAAAK)3A SEQ ID NO: 183
- Whitlow linkers e.g., a “KEGS” link
- polypeptide linkers include SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 196, and SEQ ID NO: 197.
- Other polypeptide linkers may be selected based on desired properties (e.g., length, flexibility, amino acid composition etc.) and are known to those skilled in the art.
- the protease cleavage site directs cleavage of the chimeric protein such that the effector molecule is released (“secreted”) into the extracellular space of a cell.
- a protease that cleaves the protease cleavage site is a protease specific for that specific protease cleavage site.
- the protease that cleaves a specific ADAM protease cleavage site is generally limited to the ADAM protease(s) that specifically recognize the specific ADAM protease cleavage site motif.
- a protease cleavage site can be selected and/or engineered such that cleavage by undesired proteases is reduced or eliminated.
- Proteases can be membrane- bound or membrane-associated.
- Proteases can be secreted, e.g., secreted in a specific cellular environment, such as a tumor microenvironment (“TME”).
- TME tumor microenvironment
- a protease that cleaves the protease cleavage site of the chimeric protein can be expressed in the same cell that expresses the chimeric protein.
- a protease that cleaves the protease cleavage site of the chimeric protein can be endogenous to a cell expressing the chimeric protein.
- a cell engineered to express the chimeric protein can endogenously express the protease specific for the protease cleavage site present in the chimeric protein.
- Endogenous expression of the protease refers to both expression under generally homeostatic conditions (e.g., a cell generally considered to be healthy), and also to differential expression under non-homeostatic conditions (e.g., upregulated expression in a tumor cell).
- the protease cleavage site can be selected based on the known proteases endogenously expressed by a desired cell population. In such cases, in general, the cleavage of the protease cleavage site (and thus release/secretion of a payload) can be restricted to only those cells of interest due to the cell-restricted protease needing to come in contact with the protease cleavage site of chimeric protein expressed in the same cell.
- ADAM17 is believed to be restricted in its endogenous expression to NK cell and T cells.
- selection of an ADAM17-specific protease cleavage site may restrict the cleavage of the protease cleavage site to NK cell and T cells co-expressing the chimeric protein.
- a protease cleavage site can be selected for a specific tumor-associated protease known to be expressed in a particular tumor population of interest (e.g., in a specific tumor cell engineered to express the chimeric protein).
- Protease and/or expression databases can be used to select an appropriate protease cleavage site, such as selecting a protease cleavage site cleaved by a tumor-associated proteases through consulting Oncomine (www.oncomine.org), the European Bioinformatic Institute (www.ebi.ac.uk) in particular (www.ebi.ac.uk/gxa), PMAP (www.proteolysis.org), ExPASy Peptide Cutter (ca.expasy.org/tools/peptide cutter) and PMAP.Cut DB (cutdb.burnham.org), each of which is incorporated by reference for all purposes.
- Oncomine www.oncomine.org
- the European Bioinformatic Institute www.ebi.ac.uk
- PMAP www.proteolysis.org
- ExPASy Peptide Cutter ca.expasy.org/tools/peptide cutter
- PMAP.Cut DB cutdb.burnham
- a protease that cleaves the protease cleavage site of the chimeric protein can be heterologous to a cell expressing the chimeric protein.
- a cell engineered to express the chimeric protein can also be engineered to express a protease not generally expressed by the cell that is specific for the protease cleavage site present in the chimeric protein.
- a cell engineered to express both the chimeric protein and the protease can be engineered to express each from separate engineered nucleic acids or from a multicistronic systems (multicistronic and multi-promoter systems are described in greater detail in the Section herein titled “Multicistronic and Multiple Promoter Systems”).
- Heterologous proteases and their corresponding protease cleavage site can be selected as described above with reference to endogenous proteases.
- a protease that cleaves the protease cleavage site of the chimeric protein can be expressed on a separate distinct cell than the cell that expresses the chimeric protein.
- the protease can be generally expressed in a specific cellular environment, such as a tumor microenvironment.
- the cleavage of the protease cleavage site can be restricted to only those cellular environments of interest (e.g., a tumor microenvironment) due to the environment-restricted protease needing to come in contact with the protease cleavage site.
- the secretion of the effector molecule can be restricted to only those cellular environments of interest (e.g., a tumor microenvironment) due to the environment-restricted protease needing to come in contact with the protease cleavage site.
- a protease that cleaves the protease cleavage site of the chimeric protein can be endogenous to the separate distinct cell.
- a protease that cleaves the protease cleavage site of the chimeric protein can be heterologous to the separate distinct cell.
- the separate distinct cell can be engineered to express a protease not generally expressed by the separate distinct cell.
- Proteases include, but are not limited to, a Type 1 transmembrane protease, a Type II transmembrane protease, a GPI anchored protease, an ADAM8 protease, an ADAM9 protease, an ADAM10 protease, an ADAM12 protease, an ADAM15 protease, an ADAM17 protease, an ADAM19 protease, an ADAM20 protease, an ADAM21 protease, an ADAM28 protease, an ADAM30 protease, an ADAM33 protease, a BACE1 protease, a BACE2 protease, a SIP protease, an MT1-MMP protease, an MT3-MMP protease, an MT5-MMP protease, a furin protease, a PCSK7 protease, a matriptase proteas
- a protease can be an NS3 protease.
- a protease can be an ADAM17 protease.
- Proteases can be tumor associated proteases, such as, a cathepsin, a cysteine protease, an aspartyl protease, a serine protease, or a metalloprotease.
- tumor associated proteases include Cathepsin B, Cathepsin L, Cathepsin S, Cathepsin D, Cathepsin E, Cathepsin A, Cathepsin G, Thrombin, Plasmin, Urokinase, Tissue Plasminogen Activator, Metalloproteinase 1 (MMP1), MMP2, MMP3, MMP4, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, MMP14, MMP15, MMP16, MMP17, MMP20, MMP21, MMP23, MMP24, MMP25, MMP26, MMP28, ADAM, ADAMTS, CD10 (CALLA), or prostate specific antigen.
- MMP1 Metalloproteinase 1
- MMP2 MMP3, MMP4, MMP7, MMP8, MMP9
- MMP10 Metalloproteinase 1
- MMP2 MMP3, MMP4, MMP
- Proteases can also include, but are not limited to, proteases listed in Table 4B below. Exemplary cognate protease cleavage sites for certain proteases are also listed in Table 4B. Table 4B: Exemplary Proteases with Cognate Cleavage Sites and Inhibitors
- a protease can be any of the following human proteases (MEROPS peptidase database number provided in parentheses; Rawlings N. D., Morton F. R., Kok, C. Y., Kong, J. & Barrett A. J. (2008) MEROPS: the peptidase database. Nucleic Acids Res.
- pepsin A (MER000885), gastricsin (MER000894), memapsin-2 (MER005870), renin (MER000917), cathepsin D (MER000911), cathepsin E (MER000944), memapsin-1 (MER005534), napsin A (MER004981), Mername- AA034 peptidase (MER014038), pepsin A4 (MER037290), pepsin A5 (Homo sapiens) (MER037291), hCG1733572 (Homo sapiens)-type putative peptidase (MER107386), napsin B pseudogene (MER004982), CYMP g.p.
- taspase-1 (MER016969), gamma-glutamyltransferase 5 (mammalian-type) (MER001977), gamma-glutamyltransferase 1 (mammalian-type) (MER001629), gamma-glutamyltransferase 2 (Homo sapiens) (MER001976), gamma-glutamyltransferase-like protein 4 (MER002721).
- gamma- glutamyltransferase-like protein 3 (MER016970). similar to gamma-glutamyltransferase 1 precursor (Homo sapiens) (MER026204).
- EGF-like module containing mucin-like hormone receptor-like 2 (MER037230). CD97 antigen (human type) (MER037286). EGF-like module containing mucin-like hormone receptor-like 3 (MER037288). EGF-like module containing mucin-like hormone receptor-like 1 (MER037278). EGF-like module containing mucin-like hormone receptor-like 4 (MER037294).
- EGF LAG seven-pass G-type receptor 2 precursor (Homo sapiens) (MER045397), Gpr64 (Mus musculus)-type protein (MER123205).
- GPR56 Homo sapiens)-type protein (MER122057).
- latrophilin 2 (MER122199).
- latrophilin-1 (MER126380).
- latrophilin 3 (MER124612).
- protocadherin Flamingo 2 (MER124239).
- ETL protein (MER126267).
- G protein-coupled receptor 112 (MER126114). seven transmembrane helix receptor (MER125448).
- Gpr114 protein (MER159320).
- GPR126 vascular inducible G protein-coupled receptor (MER140015).
- GPR125 Homo sapiens-type protein (MER159279).
- GPR116 Homo sapiens-type G-protein coupled receptor (MER159280).
- GPR128 Homo sapiens-type G-protein coupled receptor (MER162015).
- GPR133 Homo sapiens-type protein (MER159334) GPR110 G-protein coupled receptor (MER159277), GPR97 protein (MER159322), KPG_006 protein (MER161773) KPG_008 protein (MER161835), KPG_009 protein (MER159335), unassigned homologue (MER166269), GPR113 protein (MER159352), brain-specific angiogenesis inhibitor 2 (MER159746), PIDD auto-processing protein unit 1 (MER020001), PIDD auto-processing protein unit 2 (MER063690), MUC1 self-cleaving mucin (MER074260), dystroglycan (MER054741), proprotein convertase 9 (MER022416), site-1 peptidase (MER001948), furin (MER000375), proprotein convertase 1 (MER000376), proprotein convertase 2 (MER000377), proprotein convertase 4 (MER028255), PACE4 proprotein convertase (
- proteases can be inactivated by the presence or absence of a specific agent (e.g., that binds to the protease, such as specific small molecule inhibitors). Such proteases can be referred to as a “repressible protease.” Exemplary inhibitors for certain proteases are listed in Table 4B.
- an NS3 protease can be repressed by a protease inhibitor including, but not limited to, simeprevir, danoprevir, asunaprevir, ciluprevir, boceprevir, sovaprevir, paritaprevir, telaprevir, grazoprevir, glecaprevir, and voxiloprevir.
- a protease inhibitor including, but not limited to, simeprevir, danoprevir, asunaprevir, ciluprevir, boceprevir, sovaprevir, paritaprevir, telaprevir, grazoprevir, glecaprevir, and voxiloprevir.
- protease activity can be regulated through regulating expression of the protease itself, such as engineering a cell to express a protease using an inducible promoter system (e.g., Tet On/Off systems) or cell-specific promoters (promoters that can be used to express a heterologous protease are described in more detail in the Section herein titled “Promoters”).
- a protease can also contain a degron, such as any of the degrons described herein, and can be regulated using any of the degron systems described herein.
- Protease enzymatic activity can also be regulated through selection of a specific protease cleavage site.
- a protease cleavage site can be selected and/or engineered such that the sequence demonstrates a desired rate-of-cleavage by a desired protease, such as reduced cleavage kinetics relative to an endogenous sequence of a substrate naturally cleaved by the desired protease.
- a protease cleavage site can be selected and/or engineered such that the sequence demonstrates a desired rate-of-cleavage in a cell-state specific manner.
- various cell states e.g., following cellular signaling, such as immune cell activation
- ADAM17 protein levels and localization is known to be influenced by signaling, such as through Protein kinase C (PKC) signaling pathways (e.g., activation by the PKC activator Phorbol-12-myristat-13-acetat [PMA]).
- PKC Protein kinase C
- PMA Phorbol-12-myristat-13-acetat
- a protease cleavage site can be selected and/or engineered such that cleavage of the protease cleavage site and subsequent release of an effector molecule is increased or decreased, as desired, depending on the protease properties (e.g., expression and/or localization) in a specific cell state.
- a protease cleavage site (particularly in combination with a specific membrane tethering domain) can be selected and/or engineered for optimal protein expression of the chimeric protein.
- Cell Membrane Tethering Domain The membrane-cleavable chimeric proteins provided for herein contain a cell-membrane tethering domain (referred to as “MT” in the formula S – C – MT or MT – C – S).
- the cell-membrane tethering domain can be any amino acid sequence motif capable of directing the chimeric protein to be localized to (e.g., inserted into), or otherwise associated with, the cell membrane of the cell expressing the chimeric protein.
- the cell-membrane tethering domain can be a transmembrane-intracellular domain.
- the cell-membrane tethering domain can be a transmembrane domain.
- the cell-membrane tethering domain can be an integral membrane protein domain (e.g., a transmembrane domain).
- the cell-membrane tethering domain can be derived from a Type I, Type II, or Type III transmembrane protein.
- the cell-membrane tethering domain can include post-translational modification tag, or motif capable of post-translational modification to modify the chimeric protein to include a post-translational modification tag, where the post-translational modification tag allows association with a cell membrane.
- post-translational modification tags include, but are not limited to, lipid-anchor domains (e.g., a GPI lipid-anchor, a myristoylation tag, or palmitoylation tag).
- cell- membrane tethering domains include, but are not limited to, a transmembrane-intracellular domain and/or transmembrane domain derived from PDGFR-beta, CD8, CD28, CD3zeta-chain, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, LNGFR, NKG2D, EpoR, TNFR2, B7-1, or BTLA.
- the cell membrane tethering domain can be a cell surface receptor or a cell membrane-bound portion thereof.
- the cell-membrane tethering domain comprises a transmembrane domain derived from a B7-1 polypeptide.
- the B7-1 transmembrane domain comprises the sequence LLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 204).
- the B7-1 transmembrane domain is encoded by a polynucleotide sequence having the sequence TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGATCTGC TGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAACGAGCGGCT GAGAAGAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- the B7-1 transmembrane domain is encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGATCTGC TGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAACGAGCGGCT GAGAAGAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- the cell-membrane tethering domain of the membrane-cleavable chimeric protein includes a transmembrane domain derived from a B7-1 polypeptide.
- the B7-1 transmembrane domain of the membrane- cleavable chimeric protein includes the sequence LLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 204).
- the B7-1 transmembrane domain of the membrane-cleavable chimeric protein (e.g., IL-15) is encoded by a polynucleotide sequence having the sequence TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGATCTGC TGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAACGAGCGGCT GAGAAGAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- the B7-1 transmembrane domain of the membrane-cleavable chimeric protein (e.g., IL-15) is encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGATCTGC TGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAACGAGCGGCT GAGAAGAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- the cell-membrane tethering domain comprises a transmembrane domain derived from a CD8 polypeptide.
- a CD8 polypeptide Any suitable CD8 polypeptide may be used.
- Exemplary CD8 polypeptides include, without limitation, NCBI Reference Nos. NP_001139345 and AAA92533.1.
- Examples of CD8 transmembrane domains include IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 205), IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206), and IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 207).
- the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 205). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 207). In some embodiments, the cell- membrane tethering domain comprises a hinge and transmembrane domain derived from CD8.In some embodiments, the CD8 hinge comprises the sequence TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 271).
- the CD8 hinge comprises the sequence AAAFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYI WAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 209).
- the cell membrane tethering domain is either: (1) C-terminal of the protease cleavage site and N- terminal of any intracellular domain, if present (in other words, the cell membrane tethering domain is in between the protease cleavage site and, if present, an intracellular domain); or (2) N-terminal of the protease cleavage site and C-terminal of any intracellular domain, if present (also between the protease cleavage site and, if present, an intracellular domain with domain orientation inverted).
- the degron domain is the terminal cytoplasmic-oriented domain, specifically relative to the cell membrane tethering (in other words, the cell membrane tethering domain is in between the protease cleavage site and the degron).
- the cell membrane tethering domain can be connected to the protease cleavage site by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of cell membrane tethering domain or protease cleavage site.
- the cell membrane tethering domain can be connected to an intracellular domain, if present, by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of the cell membrane tethering domain or the intracellular domain.
- the cell membrane tethering domain can be connected to the degron, if present, by a polypeptide linker, i. ., a polypeptide sequence not generally considered to be part of the cell membrane tethering domain or degron.
- a polypeptide linker can be any amino acid sequence that connects a first polypeptide sequence and a second polypeptide sequence.
- a polypeptide linker can be a flexible linker (e.g., a Gly- Ser-Gly sequence).
- polypeptide linkers include, but are not limited to, GSG linkers (e.g., [GS]4GG [SEQ ID NO: 182]), A(EAAAK)3A (SEQ ID NO: 183), and Whitlow linkers (e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK linker such as the amino acid sequence EGKSSGSGSESKST (SEQ ID NO: 185), and linkers described in more detail in Issued U.S. Pat. No. 5,990,275 herein incorporated by reference).
- GSG linkers e.g., [GS]4GG [SEQ ID NO: 182]
- A(EAAAK)3A SEQ ID NO: 183
- Whitlow linkers e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK link
- Additional polypeptide linkers include SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 196, and SEQ ID NO: 197.
- Other polypeptide linkers may be selected based on desired properties (e.g., length, flexibility, amino acid composition etc.) and are known to those skilled in the art.
- the cell-membrane tethering domain is oriented such that the secreted effector molecule and the protease cleavage site are extracellularly exposed following insertion into, or association with, the cell membrane, such that the protease cleavage site is capable of being cleaved by its respective protease and releasing (“secreting”) the effector molecule into the extracellular space.
- any of the proteins described herein can include a degron domain including, but not limited to, a protease, a transcription factor, a promoter or constituent of a promoter system (e.g., an ACP), and/or any of the membrane-cleavable chimeric protein described herein.
- the degron domain can be any amino acid sequence motif capable of directing regulated degradation, such as regulated degradation through a ubiquitin-mediated pathway. In the presence of an immunomodulatory drug (IMiD), the degron domain directs ubiquitin-mediated degradation of a degron-fusion protein.
- IMD immunomodulatory drug
- the degron domain can be a cereblon (CRBN) polypeptide substrate domain capable of binding CRBN in response to an immunomodulatory drug (IMiD) including, but not limited to, IKZF1, IKZF3, CKla, ZFP91, GSPT1, MEIS2, GSS E4F1, ZN276, ZN517, ZN582, ZN653, ZN654, ZN692, ZN787, and ZN827, or a fragment thereof that is capable of drug-inducible binding of CRBN.
- IMD immunomodulatory drug
- the CRBN polypeptide substrate domain can be a chimeric fusion product of native CRBN polypeptide sequences, such as a IKZF3/ZFP91/IKZF3 chimeric fusion product having the amino acid sequence of FNVLMVHKRSHTGERPLQCEICGFTCRQKGNLLRHIKLHTGEKPFKCHLCNYACQRRD AL (SEQ ID NO: 175).
- Degron domains, and in particular CRBN degron systems, are described in more detail in International Application Pub. No. WO2019/089592Al, herein incorporated by reference for all purposes.
- degron domains include, but are not limited to HCV NS4 degron, PEST (two copies of residues 277-307 of human I ⁇ B ⁇ ; SEQ ID NO: 161), GRR (residues 352-408 of human p105; SEQ ID NO: 162), DRR (residues 210-295 of yeast Cdc34; SEQ ID NO: 163), SNS (tandem repeat of SP2 and NB (SP2-NB-SP2 of influenza A or influenza B; e.g., SEQ ID NO: 164), RPB (four copies of residues 1688-1702 of yeast RPB; SEQ ID NO: 165), SPmix (tandem repeat of SP1 and SP2 (SP2-SP1-SP2-SP1-SP2 of influenza A virus M2 protein; SEQ ID NO: 166), NS2 (three copies of residues 79-93 of influenza A virus NS protein; SEQ ID NO: 167), ODC (residues 106-142
- Regulated degradation can be drug-inducible.
- Drugs capable of mediating/regulating degradation can be small-molecule compounds.
- Drugs capable of mediating/regulating degradation can include an “immunomodulatory drug” (IMiD).
- IMDs refer to a class of small-molecule immunomodulatory drugs containing an imide group.
- Cereblon (CRBN) is known target of IMiDs and binding of an IMiD to CRBN or a CRBN polypeptide substrate domain alters the substrate specificity of the CRBN E3 ubiquitin ligase complex leading to degradation of proteins having a CRBN polypeptide substrate domain (e.g., any of secretable effector molecules or other proteins of interest described herein).
- examples of imide-containing IMiDs include, but are not limited to, a thalidomide, a lenalidomide, or a pomalidomide.
- the IMiD can be an FDA-approved drug.
- Chimeric proteins described herein can contain a degron domain (e.g., referred to as “D” in the formula S – C – MT – D or D – MT – C – S for membrane-cleavable chimeric proteins described herein). In the absence of an IMiD, degron/ubiquitin-mediated degradation of the chimeric protein does not occur.
- the protease cleavage site directs cleavage of the chimeric protein such that the effector molecule is released (“secreted”) into the extracellular space.
- the degron domain directs ubiquitin-mediated degradation of the chimeric protein such that secretion of the effector molecule is reduced or eliminated.
- the degron domain is the terminal cytoplasmic-oriented domain, specifically relative to the cell membrane tethering domain, e.g., the most C-terminal domain in the formula S – C – MT – D or the most N-terminal domain in the formula D – MT – C – S.
- the degron domain can be connected to the cell membrane tethering domain by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of the cell membrane tethering domain or the degron domain.
- a polypeptide linker can be any amino acid sequence that connects a first polypeptide sequence and a second polypeptide sequence.
- a polypeptide linker can be a flexible linker (e.g., a Gly- Ser-Gly sequence).
- Examples of polypeptide linkers include, but are not limited to, GSG linkers (e.g., [GS]4GG [SEQ ID NO: 182]), A(EAAAK)3A (SEQ ID NO: 183), and Whitlow linkers (e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK linker such as the amino acid sequence EGKSSGSGSESKST (SEQ ID NO: 185), and linkers described in more detail in Issued U.S.
- GSG linkers e.g., [GS]4GG [SEQ ID NO: 182]
- A(EAAAK)3A SEQ ID NO: 183
- Additional polypeptide linkers include SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 196, and SEQ ID NO: 197.
- Other polypeptide linkers may be selected based on desired properties (e.g., length, flexibility, amino acid composition etc.) and are known to those skilled in the art.
- the degron is oriented in relation to the cell membrane tethering domain such that the degron is exposed to the cytosol following localization to the cell membrane such that the degron domain is capable of mediating degradation (e.g., exposure to the cytosol and cytosol ) and is capable of mediating ubiquitin-mediated degradation.
- the degron domain can be N-terminal or C-terminal of the protein of interest, e.g., the effector molecule.
- the degron domain can be connected to the protein of interest by a polypeptide linker, i.e., a polypeptide sequence not generally considered to be part of the protein of interest or the degron domain.
- a polypeptide linker can be any amino acid sequence that connects a first polypeptide sequence and a second polypeptide sequence.
- a polypeptide linker can be a flexible linker (e.g., a Gly-Ser-Gly sequence).
- polypeptide linkers include, but are not limited to, GSG linkers (e.g., [GS]4GG [SEQ ID NO: 182]), A(EAAAK) 3 A (SEQ ID NO: 183), and Whitlow linkers (e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK linker such as the amino acid sequence EGKSSGSGSESKST (SEQ ID NO: 185), and linkers described in more detail in Issued U.S. Pat. No. 5,990,275 herein incorporated by reference).
- GSG linkers e.g., [GS]4GG [SEQ ID NO: 182]
- A(EAAAK) 3 A SEQ ID NO: 183
- Whitlow linkers e.g., a “KEGS” linker such as the amino acid sequence KESGSVSSEQLAQFRSLD (SEQ ID NO: 184), an eGK link
- Additional polypeptide linkers include SEQ ID NO: 194, SEQ ID NO: 195, SEQ ID NO: 196, and SEQ ID NO: 197.
- Other polypeptide linkers may be selected based on desired properties (e.g., length, flexibility, amino acid composition etc.) and are known to those skilled in the art.
- a polypeptide linker can be cleavable, e.g., any of the protease cleavage sites described herein.
- a “tumor microenvironment” is the cellular environment in which a tumor exists, including surrounding blood vessels, immune cells, fibroblasts, bone marrow-derived inflammatory cells, lymphocytes, signaling molecules and the extracellular matrix (ECM) (see, e.g., Pattabiraman, D.R. & Weinberg, R.A. Nature Reviews Drug Discovery 13, 497–512 (2014); Balkwill, F.R. et al. J Cell Sci 125, 5591-5596, 2012; and Li, H. et al. J Cell Biochem 101(4), 805-15, 2007).
- engineered nucleic acids are configured to produce at least one homing molecule.
- the secreted effector molecule can be a homing molecule.
- “Homing,” refers to active navigation (migration) of a cell to a target site (e.g., a cell, tissue (e.g., tumor), or organ).
- a “homing molecule” refers to a molecule that directs cells to a target site.
- a homing molecule functions to recognize and/or initiate interaction of an engineered cell to a target site.
- Non-limiting examples of homing molecules include CXCR1, CCR9, CXCR2, CXCR3, CXCR4, CCR2, CCR4, FPR2, VEGFR, IL6R, CXCR1, CSCR7, and PDGFR.
- a homing molecule is a chemokine receptor (cell surface molecule that binds to a chemokine).
- Chemokines are small cytokines or signaling proteins secreted by cells that can induce directed chemotaxis in cells. Chemokines can be classified into four main subfamilies: CXC, CC, CX3C and XC, all of which exert biological effects by binding selectively to chemokine receptors located on the surface of target cells.
- engineered nucleic acids are configured to produce CXCR4, a chemokine receptor which allows engineered cells to home along a chemokine gradient towards a stromal cell-derived factor 1 (also known as SDF1, C-X-C motif chemokine 12, and CXCL12 )- expressing cell, tissue, or tumor.
- stromal cell-derived factor 1 also known as SDF1, C-X-C motif chemokine 12, and CXCL12
- Non-limiting examples of chemokine receptors that may be encoded by the engineered nucleic acids of the present disclosure include: CXC chemokine receptors (e.g., CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, and CXCR7), CC chemokine receptors (CCR1, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, and CCR11), CX3C chemokine receptors (e.g., CX3CR1, which binds to CX3CL1), and XC chemokine receptors (e.g., XCR1).
- CXC chemokine receptors e.g., CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, and CXCR7
- CXC chemokine receptors e.g., CX3CR1, which binds to CX3CL1
- a chemokine receptor is a G protein-linked transmembrane receptor, or a member of the tumor necrosis factor (TNF) receptor superfamily (including but not limited to TNFRSF1A, TNFRSF1B).
- engineered nucleic acids are configured to produce CXCL8, CXCL9, and/or CXCL10 (promote T-cell recruitment), CCL3 and/or CXCL5, CCL21 (Th1 recruitment and polarization).
- engineered nucleic acids are configured to produce G-protein coupled receptors (GPCRs) that detect N-formylated-containing oligopeptides (including but not limited to FPR2 and FPRL1).
- GPCRs G-protein coupled receptors
- engineered nucleic acids are configured to produce receptors that detect interleukins (including but not limited to IL6R). In some embodiments, engineered nucleic acids are configured to produce receptors that detect growth factors secreted from other cells, tissues, or tumors (including but not limited to FGFR, PDGFR, EGFR, and receptors of the VEGF family, including but not limited to VEGF-C and VEGF-D).
- a homing molecule is an integrin. Integrins are transmembrane receptors that facilitate cell-extracellular matrix (ECM) adhesion. Integrins are obligate heterodimers having two subunits: ⁇ (alpha) and ⁇ (beta).
- the ⁇ subunit of an integrin may be, without limitation: ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, IGTA7, ITGA8, ITGA9, IGTA10, IGTA11, ITGAD, ITGAE, ITGAL, ITGAM, ITGAV, ITGA2B, ITGAX.
- the ⁇ subunit of an integrin may be, without limitation: ITGB1, ITGB2, ITGB3, ITGB4, ITGB5, ITGB6, ITGB7, and ITGB8.
- Engineered nucleic acids can be configured to produce any combination of the integrin ⁇ and ⁇ subunits.
- a homing molecule is a matrix metalloproteinase (MMP).
- MMPs are enzymes that cleave components of the basement membrane underlying the endothelial cell wall.
- MMPs include MMP-2, MMP-9, and MMP.
- engineered nucleic acids are configured to produce an inhibitor of a molecule (e.g., protein) that inhibits MMPs.
- engineered nucleic acids can be configured to express an inhibitor (e.g., an RNAi molecule) of membrane type 1 MMP (MT1-MMP) or TIMP metallopeptidase inhibitor 1 (TIMP-1).
- a homing molecule is a ligand that binds to selectin (e.g., hematopoietic cell E-/L-selectin ligand (HCELL), Dykstran et al., Stem Cells. 2016 Oct;34(10):2501-2511) on the endothelium of a target tissue, for example.
- selectin e.g., hematopoietic cell E-/L-selectin ligand (HCELL), Dykstran et al., Stem Cells. 2016 Oct;34(10):2501-2511
- the term “homing molecule” also encompasses transcription factors that regulate the production of molecules that improve/enhance homing of cells.
- a homing molecule includes an antibody, such as anti-integrin alpha4,beta7 or anti-MAdCAM.
- CARs Chimeric Antigen Receptors
- Certain aspects of the present disclosure relate to chimeric receptors that have any one of the antigen-specific binding domains described herein (e.g., EMCN-specific, FLT3-specific, and/or CD33-specific) and are capable of specifically binding to a protein, an antigen-derived antigen, or an antigen-derived epitope.
- the chimeric receptor is a chimeric antigen receptor (CAR).
- CARs are chimeric proteins that include an antigen-binding domain and polypeptide molecules that are heterologous to the antigen-binding domain, such as peptides heterologous to an antibody that an antigen-binding domain may be derived from.
- Polypeptide molecules that are heterologous to the antigen-binding domain can include, but are not limited to, a transmembrane domain, one or more intracellular signaling domains, a hinge domain, a spacer region, one or more peptide linkers, or combinations thereof.
- CARs are engineered receptors that graft or confer a specificity of interest (e.g., EMCN, FLT3, or CD33) onto an immune effector cell.
- CARs can be used to graft the specificity of an antibody onto an immunoresponsive cell, such as a T cell.
- CARs of the present disclosure comprise an extracellular antigen-binding domain (e.g., an scFv) fused to a transmembrane domain, fused to one or more intracellular signaling domains.
- the chimeric antigen receptor is an activating chimeric antigen receptor (aCAR and also generally referred to as CAR unless otherwise specified).
- binding of the chimeric antigen receptor to its cognate ligand is sufficient to induce activation of the immunoresponsive cell.
- binding of the chimeric antigen receptor to its cognate ligand is sufficient to induce stimulation of the immunoresponsive cell.
- activation of an immunoresponsive cell results in killing of target cells.
- activation of an immunoresponsive cell results in cytokine or chemokine expression and/or secretion by the immunoresponsive cell.
- stimulation of an immunoresponsive cell results in cytokine or chemokine expression and/or secretion by the immunoresponsive cell.
- stimulation of an immunoresponsive cell induces differentiation of the immunoresponsive cell.
- stimulation of an immunoresponsive cell induces proliferation of the immunoresponsive cell.
- activation and/or stimulation of the immunoresponsive cell can be combinations of the above responses.
- the number of ABDs in a binding molecule such as the chimeric proteins described herein, defines the “valency” of the binding molecule.
- a binding molecule having a single ABD is “monovalent”.
- a binding molecule having a plurality of ABDs is said to be “multivalent”.
- a multivalent binding molecule having two ABDs is “bivalent.”
- a multivalent binding molecule having three ABDs is “trivalent.”
- a multivalent binding molecule having four ABDs is “tetravalent.”
- all of the plurality of ABDs have the same recognition specificity and can be referred to as a “monospecific multivalent” binding molecule.
- at least two of the plurality of ABDs have different recognition specificities.
- binding molecules are multivalent and “multispecific.” In multivalent embodiments in which the ABDs collectively have two recognition specificities, the binding molecule is “bispecific.” In multivalent embodiments in which the ABDs collectively have three recognition specificities, the binding molecule is “trispecific.” In multivalent embodiments in which the ABDs collectively have a plurality of recognition specificities for different epitopes present on the same antigen, the binding molecule is “multiparatopic.” Multivalent embodiments in which the ABDs collectively recognize two epitopes on the same antigen are “biparatopic.” In various multivalent embodiments, multivalency of the binding molecule improves the avidity of the binding molecule for a specific target.
- “avidity” refers to the overall strength of interaction between two or more molecules, e.g. a multivalent binding molecule for a specific target, wherein the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs. Avidity can be measured by the same methods as those used to determine affinity, as described above. In certain embodiments, the avidity of a binding molecule for a specific target is such that the interaction is a specific binding interaction, wherein the avidity between two molecules has a KD value below 10 ⁇ 6 M, 10 ⁇ 7 M, 10 ⁇ 8 M, 10 ⁇ 9 M, or 10 ⁇ 10 M.
- the avidity of a binding molecule for a specific target has a KD value such that the interaction is a specific binding interaction, wherein the one or more affinities of individual ABDs do not have has a KD value that qualifies as specifically binding their respective antigens or epitopes on their own.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs for separate antigens on a shared specific target or complex, such as separate antigens found on an individual cell.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABDs for separate epitopes on a shared individual antigen.
- an aCAR can be a bivalent-bispecific CAR.
- an aCAR can be a bivalent-bispecific CAR expressed on a cell of the present disclosure (e.g., an immunoresponsive cell) as OR-logic gates to increase the potential targets of an activating chimeric receptor (e.g., an OR-logic gate targeting multiple tumor targets).
- a bivalent-bispecific aCAR can include an antigen-binding domain specific for FLT3 and an antigen-binding domain specific for CD33.
- a bivalent-bispecific aCAR can include i) an antigen-binding domain specific for FLT3; (ii) an antigen-binding domain specific for CD33; (iii) one or more intracellular signaling domains that stimulate an immune response, and (iv) one or more polypeptides including, but not limited to, a signal peptide, a transmembrane domain, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof.
- a CAR of the present disclosure may be a first, second, or third generation CAR. "First generation" CARs comprise a single intracellular signaling domain, generally derived from a T cell receptor chain.
- First generation CARs generally have the intracellular signaling domain from the CD3-zeta (CD3 ⁇ ) chain, which is the primary transmitter of signals from endogenous TCRs.
- “First generation” CARs can provide de novo antigen recognition and cause activation of both CD4 + and CD8 + T cells through their CD3 ⁇ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.
- “Second generation” CARs add a second intracellular signaling domain from one of various co-stimulatory molecules (e.g., CD28, 4-1BB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.
- co-stimulatory molecules e.g., CD28, 4-1BB, ICOS, OX40
- “Second generation” CARs provide both co-stimulation (e.g., CD28 or 4- 1BB) and activation (CD3 ⁇ ). Preclinical studies have indicated that “Second Generation” CARs can improve the anti-tumor activity of immunoresponsive cell, such as a T cell. "Third generation” CARs have multiple intracellular co-stimulation signaling domains (e.g., CD28 and 4-1BB) and an intracellular activation signaling domain (CD3 ⁇ ).
- the chimeric antigen receptor is a chimeric inhibitory receptor (iCAR).
- the one or more chimeric inhibitory receptors bind antigens that are expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, bone, bone marrow, immune system, endothelial tissue, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
- a chimeric inhibitory receptor e.g., an EMCN-specific chimeric inhibitory receptor
- one or more activating chimeric receptors e.g., activating chimeric TCRs or CARs, such as FLT3 and/or CD33 aCARs
- a cell of the present disclosure e.g., an immunoresponsive cell
- an immunoresponsive cell expressing the tumor antigen may bind to the healthy cell.
- the inhibitory chimeric antigen will also bind its cognate ligand on the healthy cell and the inhibitory function of the chimeric inhibitory receptor will reduce, decrease, prevent, or inhibit the activation of the immunoresponsive cell via the tumor-targeting chimeric receptor (“NOT- logic gating”).
- a chimeric inhibitory receptor of the present disclosure may inhibit one or more activities of a cell of the present disclosure (e.g., an immunoresponsive cell).
- an immunoresponsive cell may comprise one or more tumor- targeting chimeric receptors and one or more chimeric inhibitory receptors that targets an antigen that is not expressed, or generally considered to be expressed, on the tumor (e.g., EMCN). Combinations of tumor-targeting chimeric receptors and chimeric inhibitory receptors in the same immunoresponsive cell may be used to reduce on-target off-tumor toxicity.
- the extracellular antigen-binding domain of a CAR of the present disclosure binds to one or more antigens (e.g., EMCN, FLT3, or CD33) with a dissociation constant (Kd) of about 2 x 10 -7 M or less, about 1 x 10 -7 M or less, about 9 x 10 -8 M or less, about 1 x 10 -8 M or less, about 9 x 10 -9 M or less, about 5 x 10 -9 M or less, about 4 x 10 -9 M or less, about 3 x 10 -9 M or less, about 2 x 10 -9 M or less, or about 1 x 10 -9 M or less.
- Kd dissociation constant
- the Kd ranges from about is about 2 x 10 -7 M to about 1 x 10 -9 M.
- Binding of the extracellular antigen-binding domain of a CAR of the present disclosure can be determined by, for example, an enzyme-linked immunosorbent assay (ELISA), a radioimmunoassay (RIA), FACS analysis, a bioassay (e.g., growth inhibition), bio-layer interferometry (e.g., Octet/FORTEBIO®), surface plasmon resonance (SPR) technology (e.g., Biacore®), or a Western Blot assay.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS analysis e.g., FACS analysis
- a bioassay e.g., growth inhibition
- bio-layer interferometry e.g., Octet/FORTEBIO®
- SPR surface plasmon resonance
- Biacore® Biacore
- Each of these assays generally detect the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody or scFv) specific for the complex of interest.
- a labeled reagent e.g., an antibody or scFv
- the scFv can be radioactively labeled and used in an RIA assay.
- the radioactive isotope can be detected by such means as the use of a ⁇ counter or a scintillation counter or by autoradiography.
- the extracellular antigen-binding domain of the CAR is labeled with a fluorescent marker.
- fluorescent markers include green fluorescent protein (GFP), blue fluorescent protein (e.g., EBFP, EBFP2, Azurite, and mKalamal), cyan fluorescent protein (e.g., ECFP, Cerulean, and CyPet), and yellow fluorescent protein (e.g., YFP, Citrine, Venus, and YPet).
- GFP green fluorescent protein
- blue fluorescent protein e.g., EBFP, EBFP2, Azurite, and mKalamal
- cyan fluorescent protein e.g., ECFP, Cerulean, and CyPet
- yellow fluorescent protein e.g., YFP, Citrine, Venus, and YPet
- the extracellular antigen-binding domain of the CAR is labeled with a secondary antibody specific for the extracellular antigen-binding domain and wherein the secondary antibody is labeled (e.g., radioactively or with a fluorescent marker).
- CARs of the present disclosure comprise an extracellular antigen- binding domain that binds to EMCN, FLT3, or CD33. In some embodiments, CARs of the present disclosure comprise an extracellular antigen-binding domain that binds to an EMCN protein, an EMCN-derived antigen, or an EMCN-derived epitope. In some embodiments, CARs of the present disclosure comprise an extracellular antigen-binding domain that binds to a FLT3 protein, a FLT3-derived antigen, or a FLT3-derived epitope. In some embodiments.
- CARs of the present disclosure comprise an extracellular antigen-binding domain that binds to an CD33 protein, a CD33-derived antigen, or a CD33-derived epitope.
- CARs of the present disclosure comprise an extracellular antigen-binding domain, a transmembrane domain, and one or more intracellular signaling domains.
- the extracellular antigen-binding domain comprises an scFv.
- the extracellular antigen- binding domain comprises a Fab fragment, which may be crosslinked.
- the extracellular binding domain is a F(ab)2 fragment.
- Extracellular Antigen-binding Domain can include any domain that binds to the antigen including, without limitation, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a bispecific antibody, a conjugated antibody, a human antibody, a humanized antibody, and a functional fragment thereof, including but not limited to a single- domain antibody (sdAb) such as a heavy chain variable domain (VH), a light chain variable domain (VL) and a variable domain (VHH) of camelid derived nanobody, and to an alternative scaffold known in the art to function as antigen-binding domain, such as a recombinant fibronectin domain, a T cell receptor (TCR), a recombinant TCR with enhanced affinity, or a fragment thereof, e.g., single chain TCR, and the like.
- sdAb single- domain antibody
- VH heavy chain variable domain
- VL light chain variable domain
- VHH variable domain
- the extracellular antigen-binding domain comprises an antibody.
- the antibody is a human antibody.
- the antibody is a chimeric antibody.
- the extracellular antigen-binding domain comprises an antigen-binding fragment of an antibody.
- the extracellular antigen-binding domain comprises a F(ab) fragment.
- the extracellular antigen-binding domain comprises a F(ab') fragment.
- the extracellular antigen-binding domain comprises an scFv.
- the extracellular antigen-binding domain comprises two single chain variable fragments (scFvs). In some embodiments, each of the two scFvs binds to a distinct epitope on the same antigen. In some embodiments, the extracellular antigen-binding domain comprises a first scFv and a second scFv. In some embodiments, the first scFv and the second scFv bind distinct epitopes on the same antigen. In certain embodiments, the scFv is a mammalian scFv. In certain embodiments, the scFv is a chimeric scFv.
- the scFv comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
- VH and VL are separated by a peptide linker.
- the peptide linker comprises any of the amino acid sequences shown in Table 6.
- the scFv comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- each of the one or more scFvs comprises the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- each scFv can be linked to the next scFv with a peptide linked.
- each of the one or more scFvs is separated by a peptide linker.
- a peptide linker includes the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 244).
- a peptide linker between antigen binding domains of an iCAR comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 244).
- a peptide linker is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCT (SEQ ID NO: 253).
- a nucleic acid encoding peptide linker includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCT (SEQ ID NO: 253).
- a peptide linker includes the amino acid sequence GGGGS (SEQ ID NO: 242).
- a peptide linker between antigen binding domains of an aCAR comprises the amino acid sequence GGGGS (SEQ ID NO: 242).
- a peptide linker is encoded by a polynucleotide sequence comprising the sequence GGCGGCGGTGGCTCT (SEQ ID NO: 254) or GGTGGCGGCGGATCC (SEQ ID NO: 255).
- a nucleic acid encoding peptide linker includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GGCGGCGGTGGCTCT (SEQ ID NO: 254) or GGTGGCGGCGGATCC (SEQ ID NO: 255).
- a peptide linker includes the amino acid sequence GGGGSGGGGS (SEQ ID NO: 243). In some embodiments, a peptide linker between antigen binding domains of an aCAR comprises the amino acid sequence GGGGSGGGGS (SEQ ID NO: 243). In some embodiments, a peptide linker is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGTGGTGGATCT (SEQ ID NO: 256), GGTGGCGGAGGAAGTGGCGGCGGAGGCTCT (SEQ ID NO: 257), or GGCGGTGGCGGATCTGGCGGAGGTGGCAGT (SEQ ID NO: 258).
- a nucleic acid encoding peptide linker includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GGAGGCGGAGGATCTGGTGGTGGTGGATCT (SEQ ID NO: 256), GGTGGCGGAGGAAGTGGCGGCGGAGGCTCT (SEQ ID NO: 257), or GGCGGTGGCGGATCTGGCGGAGGTGGCAGT (SEQ ID NO: 258).
- a peptide linker includes the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 247).
- a peptide linker between antigen binding domains of an aCAR comprises the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 247).
- a peptide linker is encoded by a polynucleotide sequence comprising the sequence GGCTCTACATCTGGCTCTGGCAAACCTGGAAGCGGCGAGGGATCTACCAAGGGC (SEQ ID NO: 249).
- a nucleic acid encoding peptide linker includes a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GGCTCTACATCTGGCTCTGGCAAACCTGGAAGCGGCGAGGGATCTACCAAGGGC (SEQ ID NO: 249).
- Table 6 Peptide Linkers
- the immune effector cell comprises a first chimeric receptor and a second chimeric receptor.
- the antigen-binding domain of the first chimeric receptor and the antigen-binding domain of the second chimeric receptor can be an appropriate antigen biding domain described herein or known in the art.
- the first or second antigen-binding domain can be one or more antibodies, antigen-binding fragments of an antibody, F(ab) fragments, F(ab') fragments, single chain variable fragments (scFvs), or single-domain antibodies (sdAbs).
- the antigen-binding domain of the first chimeric receptor and/or the second chimeric receptor comprises two single chain variable fragments (scFvs).
- each of the two scFvs binds to a distinct epitope on the same antigen.
- the antigen-binding domain of the first chimeric receptor can be specific for EMCN and the chimeric receptor can be specific for a second distinct antigen, such as a cancer antigen (e.g., an antigen expressed on a myeloid cell, such as an AML cell).
- the extracellular antigen-binding domain comprises a single- domain antibody (sdAb).
- the sdAb is a humanized sdAb.
- the sdAb is a chimeric sdAb.
- a CAR of the present disclosure may comprise two or more antigen-binding domains, three or more antigen-binding domains, four or more antigen-binding domains, five or more antigen-binding domains, six or more antigen-binding domains, seven or more antigen-binding domains, eight or more antigen-binding domains, nine or more antigen- binding domains, or ten or more antigen-binding domains.
- each of the two or more antigen-binding domains binds the same antigen.
- each of the two or more antigen-binding domains binds a different epitope of the same antigen.
- each of the two or more antigen-binding domains binds a different antigen.
- the CAR comprises two antigen-binding domains.
- the two antigen-binding domains are attached to one another via a flexible linker.
- each of the two-antigen-binding domains may be independently selected from an antibody, an antigen-binding fragment of an antibody, an scFv, a sdAb, a recombinant fibronectin domain, a T cell receptor (TCR), a recombinant TCR with enhanced affinity, and a single chain TCR.
- the CAR comprising two antigen-binding domains is a bispecific CAR or a tandem CAR (tanCAR).
- the bispecific CAR or tanCAR comprises an antigen-binding domain comprising a bispecific antibody or antibody fragment (e.g., scFv).
- a bispecific antibody or antibody fragment e.g., scFv.
- the VH can be upstream or downstream of the VL.
- the upstream antibody or antibody fragment (e.g., scFv) is arranged with its VH (VH 1 ) upstream of its VL (VL 1 ) and the downstream antibody or antibody fragment (e.g., scFv) is arranged with its VL (VL 2 ) upstream of its VH (VH 2 ), such that the overall bispecific antibody molecule has the arrangement VH 1 -VL 1 -VL 2 -VH 2 .
- the upstream antibody or antibody fragment (e.g., scFv) is arranged with its VL (VL 1 ) upstream of its VH (VH 1 ) and the downstream antibody or antibody fragment (e.g., scFv) is arranged with its VH (VH 2 ) upstream of its VL (VL 2 ), such that the overall bispecific antibody molecule has the arrangement VL 1 VH 1 -VH 2 -VL 2 .
- a linker is disposed between the two antibodies or antibody fragments (e.g., scFvs), for example, between VL 1 and VL 2 if the construct is arranged as VH 1 -VL 1 -VL 2 -VH 2 , or between VH 1 and VH 2 if the construct is arranged as VL 1 -VH 1 -VH 2 - VL 2 .
- the linker may be a linker as described herein, e.g., a (Gly 4 -Ser)n linker, wherein n is 1 , 2, 3, 4, 5, or 6.
- the linker between the two scFvs should be long enough to avoid mispairing between the domains of the two scFvs.
- a linker is disposed between the VL and VH of the first scFv.
- a linker is disposed between the VL and VH of the second scFv.
- any two or more of the linkers may be the same or different.
- a bispecific CAR or tanCAR comprises VLs, VHs, and may further comprise one or more linkers in an arrangement as described herein.
- a CD33/FLT3 bispecific bivalent aCAR can have antigen binding domains encoded in the following order: (FLT3-VH) – L1 – (CD33-VH) – L2 – (CD33-VL) – L3 – (FLT3-VL), wherein L1, L2, and L3 are a first, a second, and a third peptide linker, respectively.
- L1, L2, and L3 can be the same peptide linker.
- L1, L2, and L3 can be the same peptide linker encoded by the same polynucleotide sequence.
- L1, L2, and L3 can be the same peptide linker encoded by different polynucleotide sequences.
- L1 and L3 can be the same peptide linker and L2 a different peptide linker.
- L1 and L3 can be the same peptide linker encoded by the same polynucleotide sequence.
- L1 and L3 can be the same peptide linker encoded by different polynucleotide sequences.
- L1, L2, and L3 can each be different peptide linkers.
- the transmembrane domain of a CAR of the present disclosure comprises a hydrophobic alpha helix that spans at least a portion of a cell membrane. It has been shown that different transmembrane domains can result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell.
- the transmembrane domain of a CAR of the present disclosure can comprise the transmembrane domain of a CD8 polypeptide, a CD28 polypeptide, a CD3-zeta polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a LIR-1 (LILRB1) polypeptide, or can be a synthetic peptide, or any combination thereof.
- the transmembrane domain is derived from a CD8 polypeptide.
- any suitable CD8 polypeptide may be used.
- Exemplary CD8 polypeptides include, without limitation, NCBI Reference Nos. NP_001139345 and AAA92533.1.
- the transmembrane domain is derived from a CD28 polypeptide. Any suitable CD28 polypeptide may be used.
- Exemplary CD28 polypeptides include, without limitation, NCBI Reference Nos. NP_006130.1 and NP_031668.3.
- the transmembrane domain is derived from a CD3-zeta polypeptide. Any suitable CD3-zeta polypeptide may be used.
- Exemplary CD3-zeta polypeptides include, without limitation, NCBI Reference Nos.
- the transmembrane domain is derived from a CD4 polypeptide. Any suitable CD4 polypeptide may be used. Exemplary CD4 polypeptides include, without limitation, NCBI Reference Nos. NP_000607.1 and NP_038516.1. In some embodiments, the transmembrane domain is derived from a 4-1BB polypeptide. Any suitable 4- 1BB polypeptide may be used. Exemplary 4-1BB polypeptides include, without limitation, NCBI Reference Nos. NP_001552.2 and NP_001070977.1. In some embodiments, the transmembrane domain is derived from an OX40 polypeptide.
- any suitable OX40 polypeptide may be used.
- Exemplary OX40 polypeptides include, without limitation, NCBI Reference Nos. NP_003318.1 and NP_035789.1.
- the transmembrane domain is derived from an ICOS polypeptide. Any suitable ICOS polypeptide may be used.
- Exemplary ICOS polypeptides include, without limitation, NCBI Reference Nos. NP_036224 and NP_059508.
- the transmembrane domain is derived from a CTLA-4 polypeptide. Any suitable CTLA-4 polypeptide may be used.
- Exemplary CTLA-4 polypeptides include, without limitation, NCBI Reference Nos. NP_005205.2 and NP_033973.2.
- the transmembrane domain is derived from a PD-1 polypeptide. Any suitable PD-1 polypeptide may be used. Exemplary PD-1 polypeptides include, without limitation, NCBI Reference Nos. NP_005009 and NP_032824. In some embodiments, the transmembrane domain is derived from a LAG-3 polypeptide. Any suitable LAG-3 polypeptide may be used. Exemplary LAG-3 polypeptides include, without limitation, NCBI Reference Nos. NP_002277.4 and NP_032505.1. In some embodiments, the transmembrane domain is derived from a 2B4 polypeptide. Any suitable 2B4 polypeptide may be used.
- Exemplary 2B4 polypeptides include, without limitation, NCBI Reference Nos. NP_057466.1 and NP_061199.2.
- the transmembrane domain is derived from a BTLA polypeptide. Any suitable BTLA polypeptide may be used. Exemplary BTLA polypeptides include, without limitation, NCBI Reference Nos. NP_861445.4 and NP_001032808.2. Any suitable LIR-1 (LILRB1) polypeptide may be used. Exemplary LIR-1 (LILRB1) polypeptides include, without limitation, NCBI Reference Nos. NP_001075106.2 and NP_001075107.2.
- the transmembrane domain comprises a polypeptide comprising an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the sequence of NCBI Reference No.
- the homology may be determined using standard software such as BLAST or FASTA.
- the polypeptide may comprise one conservative amino acid substitution, up to two conservative amino acid substitutions, or up to three conservative amino acid substitutions.
- the polypeptide can have an amino acid sequence that is a consecutive portion of NCBI Reference No.
- transmembrane domains include, without limitation, the transmembrane region(s) of the alpha, beta or zeta chain of the T-cell receptor, CD27, CD3 epsilon, CD45, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, CD2, CD27, LFA-1 (CD11a, CD18), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD160, CD19, IL2R beta, IL2R gamma, IL7R ⁇ , ITGA1, VLA1 , CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD
- the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 205). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206). In some embodiments, the transmembrane domain comprises the sequence IYIWAPLAGTCGVLLLSLVITLYCNHRN (SEQ ID NO: 207). In some embodiments, an iCAR transmembrane domain includes a LIR1 transmembrane domain.
- an iCAR transmembrane domain includes a LIR1 transmembrane domain having the sequence VIGILVAVILLLLLLLLLFLI (SEQ ID NO: 259). In some embodiments, an iCAR transmembrane domain includes a LIR1 transmembrane domain encoded by a polynucleotide sequence having the sequence GTGATCGGCATTCTGGTCGCCGTGATCCTGCTCCTGTTGCTCCTGCTGCTTCTGTTCC TGATC (SEQ ID NO: 260).
- an iCAR transmembrane domain includes a LIR1 transmembrane domain encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GTGATCGGCATTCTGGTCGCCGTGATCCTGCTCCTGTTGCTCCTGCTGCTTCTGTTCC TGATC (SEQ ID NO: 260).
- an aCAR transmembrane domain includes a CD8 transmembrane domain.
- an aCAR transmembrane domain includes a CD8 transmembrane domain having the sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206). In some embodiments, an aCAR transmembrane domain includes a CD8 transmembrane domain encoded by a polynucleotide sequence having the sequence ATCTATATCTGGGCCCCTCTGGCTGGCACATGCGGAGTTCTGCTGCTCAGCCTGGTC ATCACCCTGTACTGCAACCACAGA (SEQ ID NO: 261).
- an aCAR transmembrane domain includes a CD8 transmembrane domain encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to ATCTATATCTGGGCCCCTCTGGCTGGCACATGCGGAGTTCTGCTGCTCAGCCTGGTC ATCACCCTGTACTGCAACCACAGA (SEQ ID NO: 261).
- a CAR of the present disclosure can also comprise a spacer region that links the extracellular antigen-binding domain to the transmembrane domain.
- the spacer region may be flexible enough to allow the antigen-binding domain to orient in different directions to facilitate antigen recognition.
- the spacer region may be a hinge from a human protein.
- the hinge may be a human Ig (immunoglobulin) hinge, including without limitation an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge.
- the spacer region may comprise an IgG4 hinge, an IgG2 hinge, an IgD hinge, a CD28 hinge, a KIR2DS2 hinge, an LNGFR hinge, or a PDGFR-beta extracellular linker.
- the spacer region is localized between the antigen-binding domain and the transmembrane domain.
- a spacer region may comprise any of the amino acid sequences listed in Table 7, or an amino acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any of the amino acid sequences listed in Table 7.
- nucleic acids encoding any of the spacer regions of the present disclosure may comprise any of the nucleic acid sequences listed in Table 8, or a nucleic acid sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to any of the nucleic acid sequences listed in Table 8.
- an aCAR hinge domain includes a CD8 hinge.
- an aCAR hinge domain includes a CD8 hinge having the amino acid sequence ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGL DFACD (SEQ ID NO: 272).
- an aCAR hinge domain includes a CD8 hinge encoded by a polynucleotide sequence having the sequence GCCCTGAGCAACAGCATCATGTACTTCAGCCACTTCGTGCCCGTGTTTCTGCCCGCC AAGCCTACAACAACCCCTGCTCCTAGACCACCTACACCAGCTCCTACAATCGCCAG CCAGCCTCTGTCTCTGAGGCCCGAAGCTTGTAGACCAGCTGCTGGCGGAGCCGTGC ATACAAGAGGACTGGATTTTGCCTGCGAC (SEQ ID NO: 284).
- an aCAR hinge domain includes a CD8 hinge encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GCCCTGAGCAACAGCATCATGTACTTCAGCCACTTCGTGCCCGTGTTTCTGCCCGCC AAGCCTACAACAACCCCTGCTCCTAGACCACCTACACCAGCTCCTACAATCGCCAG CCAGCCTCTGTCTCTGAGGCCCGAAGCTTGTAGACCAGCTGCTGGCGGAGCCGTGC ATACAAGAGGACTGGATTTTGCCTGCGAC (SEQ ID NO: 284).
- an iCAR hinge domain includes a CD8 hinge. In some embodiments, an iCAR hinge domain includes a CD8 hinge having the amino acid sequence TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 271). In some embodiments, an iCAR hinge domain includes a CD8 hinge encoded by a polynucleotide sequence having the sequence ACAACAACACCCGCACCTCGGCCTCCAACTCCAGCTCCAACAATTGCACTGCAACC CCTGAGTCTGAGGCCCGAGGCCTGTAGGCCAGCAGCTGGCGGAGCTGTTCACACTA GAGGCCTGGACTTTGCCTGTGAC (SEQ ID NO: 283).
- an iCAR hinge domain includes a CD8 hinge encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to ACAACAACACCCGCACCTCGGCCTCCAACTCCAGCTCCAACAATTGCACTGCAACC CCTGAGTCTGAGGCCCGAGGCCTGTAGGCCAGCAGCTGGCGGAGCTGTTCACACTA GAGGCCTGGACTTTGCCTGTGAC (SEQ ID NO: 283).
- an iCAR hinge domain includes a LIR1 hinge.
- an iCAR hinge domain includes a LIR1 hinge having the amino acid sequence HPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 417).
- an iCAR hinge domain includes a LIR1 hinge encoded by a polynucleotide sequence having the sequence CACCCATCCGATCCTCTCGAGCTGGTGGTTTCTGGACCTTCTGGCGGCCCTAGCAGC CCTACAACAGGACCTACAAGCACAAGCGGCCCTGAGGACCAACCTCTGACACCAAC AGGCAGCGATCCTCAGTCTGGACTGGGGAGACATCTGGGCGTT (SEQ ID NO: 418).
- an iCAR hinge domain includes a LIR1 hinge encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to CACCCATCCGATCCTCTCGAGCTGGTGGTTTCTGGACCTTCTGGCGGCCCTAGCAGC CCTACAACAGGACCTACAAGCACAAGCGGCCCTGAGGACCAACCTCTGACACCAAC AGGCAGCGATCCTCAGTCTGGACTGGGGAGACATCTGGGCGTT (SEQ ID NO: 418).
- Table 7 Spacer Amino Acid Sequences Table 8. Spacer Nucleic Acid Sequences
- a CAR of the present disclosure may further include a short oligopeptide or polypeptide linker that is between 2 amino acid residues and 10 amino acid residues in length, and that may form the linkage between the transmembrane domain and the cytoplasmic region of the CAR.
- a suitable linker is a glycine-serine doublet.
- the linker comprises the ammo acid sequence of GGCKJSGGCKJS (SEQ ID NO: 208).
- the transmembrane domain further comprises at least a portion of an extracellular domain of the same protein.
- a CAR of the present disclosure comprises one or more cytoplasmic domains or regions.
- the cytoplasmic domain or region of the CAR may include an intracellular signaling domain.
- suitable intracellular signaling domains include, without limitation, cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to modulate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
- T cell activation may be mediated by two distinct classes of cytoplasmic signaling sequences, those that initiate antigen-dependent primary activation through the TCR (primary intracellular signaling domains) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic domain, e.g., a co-stimulatory domain).
- T cell signaling and function can be negatively regulated by inhibitory receptors present in a T cell through intracellular inhibitory co-signaling domains.
- the intracellular signaling domain of a CAR of the present disclosure can include an inhibitory intracellular signaling domains.
- inhibitory intracellular domains examples include PD-1, CTLA4, TIGIT, BTLA, and LIR-1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRP ⁇ , HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- Table 10 and Table 11 provide the amino acid and nucleotide sequneces, respectively, of the exemplary inhibitory intracellular signaling domains.
- the inhibitory intracellular signaling domain includes one or more intracellular inhibitory co-signaling domains (e.g., see Table 10 and Table 11.
- the one or more intracellular inhibitory co-signaling domains are linked to other domains (e.g., a transmembrane domain) through a peptide linker (e.g., see Table 6) or a spacer or hinge sequence (e.g., see Tables 7 and 8).
- the two or more intracellular inhibitory co-signaling domains can be linked through a peptide linker (e.g., see Table 6) or a spacer or hinge sequence (e.g., see Tables 7 and 8).
- the intracellular inhibitory co-signaling domain is an inhibitory domain.
- the one or more intracellular inhibitory co-signaling domains of a chimeric protein comprises one or more ITIM-containing protein, or fragment(s) thereof. ITIMs are conserved amino acid sequences found in cytoplasmic tails of many inhibitory immune receptors.
- ITIM-containing proteins include, but are not limited to, PD-1, TIGIT, BTLA, and LIR-1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, LAIR1, SIRP ⁇ , KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- LILRB1 LIR-1
- an iCAR includes a LIR1 intracellular inhibitory domain. In some embodiments, an iCAR includes a LIR1 intracellular inhibitory domain having the amino acid sequence LRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKH TQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEED RQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH (SEQ ID NO: 285).
- an iCAR includes a LIR1 intracellular inhibitory domain encoded by a polynucleotide sequence comprising the sequence CTGCGGCACAGAAGGCAGGGCAAGCACTGGACAAGCACCCAGAGAAAGGCCGACT TTCAGCATCCTGCTGGCGCCGTTGGACCTGAGCCTACAGATAGAGGACTGCAGTGG CGGTCTAGCCCTGCCGCTGATGCCCAAGAGGAAAATCTTTACGCCGCCGTGAAGCA CACCCAGCCTGAGGATGGCGTGGAAATGGACACCAGATCTCCCCACGATGAGGACC CTCAGGCCGTGACATACGCAGAAGTGAAGCACTCCAGACCTCGGAGAGAGATGGC AAGCCCTCCATCTCCTCTGAGCGGCGAGTTCCTGGACACCAAAGACAGACAGGCCG AAGAGGACAGACAGATGGATACCGAAGCCGCCGCTTCTGAAGCCACAGGATGT GACATATGCCCAGCTGCATAGCCTGACACTGCGGAGAGAAGCCACA
- an iCAR includes a LIR1 intracellular inhibitory domain encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to CTGCGGCACAGAAGGCAGGGCAAGCACTGGACAAGCACCCAGAGAAAGGCCGACT TTCAGCATCCTGCTGGCGCCGTTGGACCTGAGCCTACAGATAGAGGACTGCAGTGG CGGTCTAGCCCTGCCGCTGATGCCCAAGAGGAAAATCTTTACGCCGCCGTGAAGCA CACCCAGCCTGAGGATGGCGTGGAAATGGACACCAGATCTCCCCACGATGAGGACC CTCAGGCCGTGACATACGCAGAAGTGAAGCACTCCAGACCTCGGAGAGAGATGGC AAGCCCTCCATCTCCTCTGAGCGGCGAGTTCCTGGACACCAAAGACAGACAGGCCG
- the one or more intracellular inhibitory co-signaling domains comprise one or more non-ITIM scaffold proteins, or a fragment(s) thereof.
- the one or more non-ITIM scaffold proteins, or fragments thereof are selected from GRB-2, Dok-1, Dok-2, SLAP, LAG3, HAVR, GITR, and PD-L1.
- the inhibitory intracellular signaling domain can further include an enzymatic inhibitory domain.
- the enzymatic inhibitory domain comprises an enzyme catalytic domain.
- the enzyme catalytic domain is derived from an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c- CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
- an enzyme selected from the group consisting of: CSK, SHP-1, PTEN, CD45, CD148, PTP-MEG1, PTP-PEST, c- CBL, CBL-b, PTPN22, LAR, PTPH1, SHIP-1, and RasGAP.
- Examples of enzymatic regulation of signaling is described in more detail in Pavel Otáhal et al. (Biochim Biophys Acta. 2011 Feb;1813(2):367-76), Kosugi A., et al.
- the intracellular signaling domain of a CAR of the present disclosure can comprise a primary signaling domain regulates primary activation of the TCR complex either in a stimulatory way or in an inhibitory way.
- Primary intracellular signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs (ITAMs).
- ITAMs immunoreceptor tyrosine-based activation motifs
- suitable ITAM- containing primary intracellular signaling domains include, without limitation, those of CD3-zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278 (also known as "ICOS"), Fc ⁇ RI, DAP10, DAP12, and CD66d.
- a CAR of the present disclosure comprises an intracellular signaling domain, e.g., a primary signaling domain of CD3-zeta polypeptide.
- a CD3-zeta polypeptide of the present disclosure may have an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% homologous to the sequence of NCBI Reference No. NP_932170 or NP_001106864.2, or fragments thereof.
- the CD3-zeta polypeptide may comprise one conservative amino acid substitution, up to two conservative amino acid substitutions, or up to three conservative amino acid substitutions.
- the polypeptide can have an amino acid sequence that is a consecutive portion of NCBI Reference No. NP_932170 or NP_001106864.2 that is at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, or at least 160, at least 170, or at least 180 amino acids in length.
- a primary signaling domain comprises a modified ITAM domain, e.g., a mutated ITAM domain which has altered (e.g., increased or decreased) activity as compared to the native ITAM domain.
- a primary signaling domain comprises a modified ITAM-containing primary intracellular signaling domain, e.g., an optimized and/or truncated ITAM-containing primary intracellular signaling domain.
- a primary signaling domain comprises one, two, three, four or more ITAM motifs.
- the intracellular signaling domain of a CAR of the present disclosure can comprise the CD3-zeta signaling domain by itself or it can be combined with any other desired intracellular signaling domain(s) useful in the context of a CAR of the present disclosure.
- the intracellular signaling domain of the CAR can comprise a CD3-zeta chain portion and a costimulatory signaling domain.
- the costimulatory signaling domain may refer to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule of the present disclosure is a cell surface molecule other than an antigen receptor or its ligands that may be required for an efficient response of lymphocytes to an antigen.
- Suitable costimulatory molecules include, without limitation, CD97, CD2, ICOS, CD27, CD154, CD8, OX40, 4-1BB, CD28, ZAP40, CD30, GITR, HVEM, DAP10, DAP12, MyD88, 2B4, CD40, PD-1, lymphocyte function-associated antigen-1 (LFA-1), CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, an MHC class I molecule, a TNF receptor protein, an Immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocytic activation molecule (SLAM protein), an activating NK cell receptor, BTLA, a Toll ligand receptor, CDS, ICAM-1, (CD11a/CD18), BAFFR, KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19,
- aCAR intracellular signaling domains include a CD28 co- stimulatory domain. In some embodiments, aCAR intracellular signaling domains include a CD28 co-stimulatory domain having the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 287).
- aCAR intracellular signaling domains include a CD28 co-stimulatory domain encoded by a polynucleotide sequence comprising the sequence AGAAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCTAGAC GGCCCGGACCTACCAGAAAGCACTACCAGCCTTACGCTCCTCCTAGAGATTTCGCC GCCTACCGGTCC (SEQ ID NO: 288).
- aCAR intracellular signaling domains include a CD28 co-stimulatory domain encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to AGAAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCTAGAC GGCCCGGACCTACCAGAAAGCACTACCAGCCTTACGCTCCTCCTAGAGATTTCGCC GCCTACCGGTCC (SEQ ID NO: 288).
- aCAR intracellular signaling domains include a CD3 ⁇ signaling domain.
- aCAR intracellular signaling domains include a CD3 ⁇ signaling domain having the amino acid sequence RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 289).
- aCAR intracellular signaling domains include a CD3 ⁇ signaling domain encoded by a polynucleotide sequence having the sequence AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACC AGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAG AGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGG AAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGAT TGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGT CTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCCC TCGC (SEQ ID NO: 290).
- aCAR intracellular signaling domains include a CD3 ⁇ signaling domain encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACC AGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAG AGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGG AAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGAT TGGGATGAAAGGCGAGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGT CTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCCC TC
- aCAR intracellular signaling domains include a CD28 co- stimulatory domain and a CD3 ⁇ signaling domain.
- aCAR intracellular signaling domains include a CD28 co-stimulatory domain having the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 287) and a CD3 ⁇ signaling domain having the amino acid sequence RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 289).
- the intracellular signaling sequences within the cytoplasmic portion of a CAR of the present disclosure may be linked to each other in a random or specified order.
- a short oligopeptide or polypeptide linker for example, between 2 amino acids and 10 amino acids (e.g., 2 amino acids, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, 8 amino acids, 9 amino acids, or 10 amino acids) in length may form the linkage between intracellular signaling sequences.
- a glycine- serine doublet can be used as a suitable linker.
- the intracellular signaling domain comprises two or more costimulatory signaling domains, e.g., two costimulatory signaling domains, three costimulatory signaling domains, four costimulatory signaling domains, five costimulatory signaling domains, six costimulatory signaling domains, seven costimulatory signaling domains, eight costimulatory signaling domains, nine costimulatory signaling domains, 10 costimulatory signaling domains, or more costimulatory signaling domains.
- costimulatory signaling domains e.g., two costimulatory signaling domains, three costimulatory signaling domains, four costimulatory signaling domains, five costimulatory signaling domains, six costimulatory signaling domains, seven costimulatory signaling domains, eight costimulatory signaling domains, nine costimulatory signaling domains, 10 costimulatory signaling domains, or more costimulatory signaling domains.
- the intracellular signaling domain comprises two costimulatory signaling domains.
- the two or more costimulatory signaling domains are separated by a linker of the present disclosure (e.g., any of the linkers described in Table 6).
- the linker is a glycine residue.
- the linker is an alanine residue.
- a cell of the present disclosure expresses a CAR that includes an antigen-binding domain, a transmembrane domain, a primary signaling domain, and one or more costimulatory signaling domains.
- the transmembrane domain is derived from the same protein as one of the one or more intracellular signaling domains.
- the CAR is an inhibitory CAR and includes a transmembrane domain and at least one intracellular inhibitory co-signaling domain each derived from a protein selected from PD-1, CTLA4, TIGIT, BTLA, and LIR1 (LILRB1), TIM3, KIR3DL1, NKG2A, LAG3, SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRP ⁇ , HAVR, GITR, PD-L1, KIR2DL1, KIR2DL2, KIR2DL3, KIR3DL2, CD94, KLRG-1, CEACAM1, LIR2, LIR3, LIR5, SIGLEC-2, and SIGLEC-10.
- LILRB1 LIR1
- TIM3DL1 TIM3, KIR3DL1, NKG2A, LAG3, SLAP1, SLAP2, Dok-1, Dok-2, LAIR1, GRB-2, CD200R, SIRP ⁇ , HAVR, GITR, PD-L
- the transmembrane domain is derived from a first protein and the one or more intracellular signaling domains are derived from a second protein that are distinct from the first protein.
- Natural Killer Cell Receptor (NKR) CARs In some embodiments, a CAR of the present disclosure comprises one or more components of a natural killer cell receptor (NKR), thereby forming an NKR-CAR.
- the NKR component may be a transmembrane domain, a hinge domain, or a cytoplasmic domain from any suitable natural killer cell receptor, including without limitation, a killer cell immunoglobulin-like receptor (KIR),such as KIR2DL1, KIR2DL2/L3, KIR2DL4, KIR2DL5A, KIR2DL5B, KIR2DS1, KIR2DS2, KIR2DS3, KIR2DS4, DIR2DS5, KIR3DL1/S1, KIR3DL2, KIR3DL3, KIR2DP1, and KIRS DPI; a natural cytotoxicity receptor (NCR), such as NKp30, NKp44, NKp46; a signaling lymphocyte activation molecule (SLAM) family of immune cell receptor, such as CD48, CD229, 2B4, CD84, NTB-A, CRACC, BLAME, and CD2F-10; an Fc receptor (FcR), such as CD16, and CD64; and an Ly49 receptor, such as LY49
- the NKR-CAR may interact with an adaptor molecule or intracellular signaling domain, such as DAP12.
- an adaptor molecule or intracellular signaling domain such as DAP12.
- exemplary configurations and sequences of CARs comprising NKR components are described in International Patent Publication WO2014/145252, published September 18, 2014.
- Immunoresponsive cells Certain aspects of the present disclosure relate to a cell, such as an immunoresponsive cell, that has been genetically engineered to comprise one or more chimeric receptors of the present disclosure or one or more nucleic acids encoding such chimeric receptors, and to methods of using such cells for treating myeloid malignancies (e.g., AML).
- the cell is a mammalian cell.
- the mammalian cell is a primary cell.
- the mammalian cell is a cell line.
- the mammalian cell a bone marrow cell, a blood cell, a skin cell, bone cell, a muscle cell, a neuronal cell, a fat cell, a liver cell, or a heart cell.
- the cell is a stem cell.
- Exemplary stem cells include, without limitation embryonic stem cells (ESCs), induced pluripotent stem cells (iPSCs), adult stem cells, and tissue-specific stem cells, such as hematopoietic stem cells (blood stem cells), mesenchymal stem cells (MSC), neural stem cells, epithelial stem cells, or skin stem cells.
- the cell is a cell that is derived or differentiated from a stem cell of the present disclosure.
- the cell is an immune cell.
- Immune cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- Exemplary immune cells include, without limitation, T cells (e.g., helper T cells, cytotoxic T cells, memory T cells, regulatory T cells, natural killer T cells, alpha beta T cells, and gamma delta T cells), B cells, natural killer (NK) cells, dendritic cells, myeloid cells, macrophages, and monocytes.
- the cell is a neuronal cell.
- Neuronal cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- exemplary neuronal cells include, without limitation, neural progenitor cells, neurons (e.g., sensory neurons, motor neurons, cholinergic neurons, GABAergic neurons, glutamatergic neurons, dopaminergic neurons, or serotonergic neurons), astrocytes, oligodendrocytes, and microglia.
- the cell is an immunoresponsive cell.
- Immunoresponsive cells of the present disclosure may be isolated or differentiated from a stem cell of the present disclosure (e.g., from an ESC or iPSC).
- Exemplary immunoresponsive cells of the present disclosure include, without limitation, cells of the lymphoid lineage.
- the lymphoid lineage comprising B cells, T cells, and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the like.
- immunoresponsive cells of the lymphoid lineage include, without limitation, T cells, Natural Killer (NK) cells, embryonic stem cells, pluripotent stem cells, and induced pluripotent stem cells (e.g., those from which lymphoid cells may be derived or differentiated).
- T cells can be lymphocytes that mature in the thymus and are chiefly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system.
- T cells of the present disclosure can be any type of T cells, including, without limitation, T helper cells, cytotoxic T cells, memory T cells (including central memory T cells, stem-cell-like memory T cells (or stem-like memory T cells), and two types of effector memory T cells: e.g., TEM cells and TEMRA cells, regulatory T cells (also known as suppressor T cells), natural killer T cells, mucosal associated invariant T cells, and ⁇ T cells.
- Cytotoxic T cells CTL or killer T cells
- TTL or killer T cells are a subset of T lymphocytes capable of inducing the death of infected somatic or tumor cells.
- a patient's own T cells may be genetically modified to target specific antigens through the introduction of one or more chimeric receptors, such as a chimeric TCRs or CARs.
- Natural killer (NK) cells can be lymphocytes that are part of cell-mediated immunity and act during the innate immune response. NK cells do not require prior activation in order to perform their cytotoxic effect on target cells.
- an immunoresponsive cell of the present disclosure is a T cell.
- T cells of the present disclosure may be autologous, allogeneic, or derived in vitro from engineered progenitor or stem cells.
- an immunoresponsive cell of the present disclosure is a universal T cell with deficient TCR- ⁇ .
- an immunoresponsive cell of the present disclosure is an isolated immunoresponsive cell comprising one or more chimeric receptors of the present disclosure.
- the immunoresponsive cell comprises one or more, two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, or ten or more chimeric receptors of the present disclosure.
- an immunoresponsive cell is a T cell.
- an immunoresponsive cell is a Natural Killer (NK) cell.
- an immunoresponsive cell expresses or is capable of expressing an immune receptor.
- Immune receptors generally are capable of inducing signal transduction or changes in protein expression in the immune receptor-expressing cell that results in the modulation of an immune response upon binding to a cognate ligand (e.g., regulate, activate, initiate, stimulate, increase, prevent, attenuate, inhibit, reduce, decrease, inhibit, or suppress an immune response).
- a cognate ligand e.g., regulate, activate, initiate, stimulate, increase, prevent, attenuate, inhibit, reduce, decrease, inhibit, or suppress an immune response.
- ITAMs immunoreceptor tyrosine-based activation motifs
- an endogenous TCR, exogenous TCR, chimeric TCR, or a CAR specifically an activating CAR
- a formation of an immunological synapse occurs that includes clustering of many molecules near the bound receptor (e.g., CD4 or CD8, CD3 ⁇ / ⁇ / ⁇ / ⁇ , etc.).
- This clustering of membrane bound signaling molecules allows for ITAM motifs contained within the CD3 chains to become phosphorylated that in turn can initiate a T cell activation pathway and ultimately activates transcription factors, such as NF- ⁇ and AP-1.
- a cell of the present disclosure comprises two or more chimeric receptors of the present disclosure.
- the cell comprises two or more chimeric receptors, wherein one of the two or more chimeric receptors is a chimeric inhibitory receptor.
- the cell comprises three or more chimeric receptors, wherein at least one of the three or more chimeric receptors is a chimeric inhibitory receptor.
- the cell comprises four or more chimeric receptors, wherein at least one of the four or more chimeric receptors is a chimeric inhibitory receptor. In some embodiments, the cell comprises five or more chimeric receptors, wherein at least one of the five or more chimeric receptors is a chimeric inhibitory receptor. In some embodiments, each of the two or more chimeric receptors comprise a different antigen-binding domain, e.g., that binds to the same antigen or to a different antigen. In some embodiments each antigen bound by the two or more chimeric receptors are expressed on the same cell, such as a myeloid cell type (e.g., same AML cell type).
- a myeloid cell type e.g., same AML cell type
- each antigen bound by the two or more chimeric receptors is an AML-associated antigen (e.g., FLT3, CD33, CD123, CLEC12A, CXCR4, EphA3, etc.).
- AML-associated antigen e.g., FLT3, CD33, CD123, CLEC12A, CXCR4, EphA3, etc.
- the antigen-binding domain of each of the different chimeric receptors may be designed such that the antigen-binding domains do not interact with one another.
- a cell of the present disclosure expressing a first chimeric receptor (e.g., an EMCN-specific chimeric receptor) and a second chimeric receptor may comprise a first chimeric receptor that comprises an antigen-binding domain that does not form an association with the antigen-binding domain of the second chimeric receptor.
- the antigen-binding domain of the first chimeric receptor may comprise an antibody fragment, such as an scFv, while the antigen-binding domain of the second chimeric receptor may comprise a VHH.
- chimeric membrane embedded receptors that each comprise an antigen-binding domain
- interactions between the antigen-binding domains of each of the receptors can be undesirable, because such interactions may inhibit the ability of one or more of the antigen-binding domains to bind their cognate antigens.
- cells of the present disclosure e.g., immunoresponsive cells
- the chimeric receptors comprise antigen-binding domains that minimize such inhibitory interactions.
- the antigen-binding domain of one chimeric receptor comprises an scFv and the antigen-binding domain of the second chimeric receptor comprises a single VH domain, e.g., a camelid, shark, or lamprey single VH domain, or a single VH domain derived from a human or mouse sequence.
- binding of the antigen- binding domain of the first chimeric receptor to its cognate antigen is not substantially reduced by the presence of the second chimeric receptor.
- binding of the antigen- binding domain of the first chimeric receptor to its cognate antigen in the presence of the second chimeric receptor is 85%, 90%, 95%, 96%, 97%, 98%, or 99% of binding of the antigen-binding domain of the first chimeric receptor to its cognate antigen in the absence of the second chimeric receptor.
- the antigen-binding domains of the first chimeric receptor and the second chimeric receptor associate with one another less than if both were scFv antigen-binding domains.
- a cell of the present disclosure (e.g., an immunoresponsive cell) comprises one or more chimeric inhibitory receptors of the present disclosure.
- each of the one or more chimeric inhibitory receptors comprises an antigen- binding domain that binds an antigen generally expressed on normal cells (e.g., cells generally considered to be healthy) but not on tumor cells, such as AML cells.
- a chimeric inhibitory receptor includes an antigen-binding domain that binds EMCN (e.g., an EMCN-specific antigen-binding domain having one or more of the amino acid sequences listed in Table 1).
- the one or more chimeric inhibitory receptors bind antigens that are expressed on a non-tumor cell derived from a tissue selected from the group consisting of brain, neuronal tissue, endocrine, bone, bone marrow, immune system, endothelial tissue, muscle, lung, liver, gallbladder, pancreas, gastrointestinal tract, kidney, urinary bladder, male reproductive organs, female reproductive organs, adipose, soft tissue, and skin.
- a chimeric inhibitory receptor (e.g., an EMCN-specific chimeric inhibitory receptor) may be used, for example, with one or more activating chimeric receptors (e.g., activating chimeric TCRs or CARs) expressed on a cell of the present disclosure (e.g., an immunoresponsive cell) as NOT-logic gates to control, modulate, or otherwise inhibit one or more activities of the one or more activating chimeric receptors.
- a chimeric inhibitory receptor of the present disclosure may inhibit one or more activities of a cell of the present disclosure (e.g., an immunoresponsive cell).
- a cell of the present disclosure comprises one or more chimeric inhibitory receptors of the present disclosure and further comprises a tumor-targeting chimeric receptor that binds to one or more tumor-associated antigens.
- the one or more tumor-associated antigens include an AML-associated antigen.
- the one or more tumor-associated antigens include CD33.
- the one or more tumor-associated antigens include FLT3.
- the one or more tumor- associated antigens include CD33 and FLT3.
- a cell of the present disclosure can further include one or more recombinant or exogenous co-stimulatory ligands.
- the cell can be further transduced with one or more co-stimulatory ligands, such that the cell co- expresses or is induced to co-express one or more chimeric receptors of the present disclosure (e.g., the EMCN-specific, FLT3-specific, and/or CD33-specific CARs described herein) and one or more co-stimulatory ligands.
- TNF tumor necrosis factor
- Ig immunoglobulin
- TNF superfamily members are synthesized as type II transmembrane proteins (extracellular C-terminus) containing a short cytoplasmic segment and a relatively long extracellular region.
- suitable TNF superfamily members include, without limitation, nerve growth factor (NGF), CD40L (CD40L)/CD 154, CD137L/4-1BBL, TNF-a, CD134L/OX40L/CD252, CD27L/CD70, Fas ligand (FasL), CD30L/CD153, tumor necrosis factor beta (TNFP)/lymphotoxin- alpha (LTa), lymphotoxin-beta (LTP), CD257/B cell- activating factor (B AFF)/Bly s/THANK/Tall- 1, glucocorticoid-induced TNF Receptor ligand (GITRL), and TNF-related apoptosis-inducing ligand (TRAIL), LIGHT (TNFSF 14).
- NGF nerve growth factor
- immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. These proteins share structural features with immunoglobulins and possess an immunoglobulin domain (fold).
- suitable immunoglobulin superfamily ligands include, without limitation, CD80 and CD86, both ligands for CD28, PD-L1/(B7-H1) that ligands for PD-1.
- the one or more co-stimulatory ligands are selected from 4-1BBL, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, PD-L1, and combinations thereof.
- a cell of the present disclosure comprises one or more chimeric receptors (e.g., the EMCN-specific, FLT3-specific, and/or CD33-specific CARs described herein) and may further include one or more chemokine receptors.
- chemokine receptor CCR2b or CXCR2 in cells such as T cells
- enhances trafficking to CCL2-secreting or CXCL1-secreting solid tumors Craddock et al, J Immunother. 2010 Oct; 33(8):780-8 and Kershaw et al. Hum Gene Ther. 2002 Nov 1; 13(16): 1971 -80).
- chemokine receptors expressed on chimeric receptor-expressing cells of the present disclosure may recognize chemokines secreted by tumors and improve targeting of the cell to the tumor, which may facilitate the infiltration of the cell to the tumor and enhance the antitumor efficacy of the cell.
- Chemokine receptors of the present disclosure may include a naturally occurring chemokine receptor, a recombinant chemokine receptor, or a chemokine-binding fragment thereof.
- a CXC chemokine receptor such as CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, or CXCR7
- a CC chemokine receptor such as CCR1 , CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9,
- the chemokine receptor to be expressed on the cell is chosen based on the chemokines secreted by the tumor.
- Chimeric Receptor Regulation Some embodiments of the present disclosure relate to regulating one or more chimeric receptor activities of chimeric receptor-expressing cells of the present disclosure (e.g., the EMCN-specific CARs described herein). There are several ways chimeric receptor activities can be regulated. In some embodiments, a regulatable chimeric receptor, wherein one or more chimeric receptor activities can be controlled, may be desirable to optimize the safety and/or efficacy of the chimeric receptor therapy.
- inducing apoptosis using a caspase fused to a dimerization domain can be used as a safety switch in the chimeric receptor therapy.
- a chimeric receptor-expressing cell of the present disclosure can also express an inducible Caspase-9 (iCaspase-9) that, upon administration of a dimerizer drug, such as rimiducid (IUPAC name: [(1R)-3-(3,4-dimethoxyphenyl)-1-[3-[2-[2-[[2-[3-[(1R)-3-(3,4-dimethoxyphenyl)-1-[(2S)- 1-[(2S)-2-(3,4,5-trimethoxyphenyl)butanoyl]piperidine-2- carbonyl]oxypropyl]phenoxy]acetyl]amino]ethylamino]-2-oxoethoxy]phenyl]propyl] (2S)-1- [(2S)-2-(3,4,5-trimethoxyphenyl)butanoyl]piperidine-2-carboxylate), induces activation of the Caspase-9 and results in a dimerizer
- the iCaspase-9 contains a binding domain that comprises a chemical inducer of dimerization (CID) that mediates dimerization in the presence of the CID, which results in inducible and selective depletion of the chimeric receptor-expressing cells.
- CID chemical inducer of dimerization
- a chimeric receptor of the present disclosure may be regulated by utilizing a small molecule or an antibody that deactivates or otherwise inhibits chimeric receptor activity.
- an antibody may delete the chimeric receptor- expressing cells by inducing antibody dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody dependent cell-mediated cytotoxicity
- a chimeric receptor-expressing cell of the present disclosure may further express an antigen that is recognized by a molecule that is capable of inducing cell death by ADCC or complement-induced cell death.
- a chimeric receptor-expressing cell of the present disclosure may further express a receptor capable of being targeted by an antibody or antibody fragment.
- Suitable receptors include, without limitation, EpCAM, VEGFR, integrins (e.g., ⁇ 3, ⁇ 4, ⁇ 3 ⁇ 4 ⁇ 3, ⁇ 4 ⁇ 7, ⁇ 5 ⁇ 1, ⁇ 3, ⁇ ), members of the TNF receptor superfamily (e.g., TRAIL-R1 and TRAIL-R2), PDGF receptor, interferon receptor, folate receptor, GPNMB, ICAM-1 , HLA-DR, CEA, CA- 125, MUC1, TAG-72, IL-6 receptor, 5T4, GD2, GD3, CD2, CD3, CD4, CD5, CD11, CD11a/LFA-1, CD15, CD18/ITGB2, CD19, CD20, CD22, CD23/IgE Receptor, CD25, CD28, CD30, CD33, CD38, CD40, CD41 , CD44, CD51, CD52, CD62L, CD74, CD80, CD125, CD147/basigin, CD152/CT
- TNF receptor superfamily e.
- a chimeric receptor-expressing cell of the present disclosure may also express a truncated epidermal growth factor receptor (EGFR) that lacks signaling capacity but retains an epitope that is recognized by molecules capable of inducing ADCC (e.g., WO2011/056894).
- EGFR epidermal growth factor receptor
- a chimeric receptor-expressing cell of the present disclosure further includes a highly expressing compact marker/suicide gene that combines target epitopes from both CD32 and CD20 antigens in the chimeric receptor-expressing cell, which binds an anti-CD20 antibody (e.g., rituximab) resulting in selective depletion of the chimeric receptor- expressing cell by ADCC.
- chimeric receptor-expressing cells can include, without limitation, administration of a monoclonal anti-CD52 antibody that selectively binds and targets the chimeric receptor-expressing cell for destruction by inducing ADCC.
- the chimeric receptor-expressing cell can be selectively targeted using a chimeric receptor ligand, such as an anti-idiotypic antibody.
- the anti-idiotypic antibody can cause effector cell activity, such as ADCC or ADC activity.
- the chimeric receptor ligand can be further coupled to an agent that induces cell killing, such as a toxin.
- a chimeric receptor-expressing cell of the present disclosure may further express a target protein recognized by a cell depleting agent of the present disclosure.
- the target protein is CD20 and the cell depleting agent is an anti-CD20 antibody.
- the cell depleting agent is administered once it is desirable to reduce or eliminate the chimeric receptor-expressing cell.
- the cell depleting agent is an anti-CD52 antibody.
- a regulated chimeric receptor comprises a set of polypeptides, in which the components of a chimeric receptor of the present disclosure are partitioned on separate polypeptides or members.
- the set of polypeptides may include a dimerization switch that, when in the presence of a dimerization molecule, can couple the polypeptides to one another to form a functional chimeric receptor.
- Endomucin-Specific Antigen-binding Domains The present disclosure provides antigen-binding domains (e.g., single-chain variable fragments) that bind to endomucin (EMCN), chimeric proteins including antigen-binding domains that bind to EMCN (e.g., any of the iCARs described herein), and nucleic acids encoding such antigen-binding domains and chimeric proteins.
- EMCN is a sialoglycoprotein that interferes with assembly of focal adhesion complexes and inhibits interaction between cells and extracellular matrix.
- EMCN-specific antigen-binding domains bind to human EMCN (e.g., Uniprot Q9ULC0, herein incorporated by reference for all purposes) or an epitope fragment thereof.
- EMCN can be expressed on cells generally considered to be healthy, such as healthy hematopoietic stem cells (HSCs), HSPCs, healthy multipotent progenitors (MPPs), healthy lympho-myeloid primed progenitor (LMPPs), and healthy hematopoietic progenitor cells (HPCs).
- HSCs healthy hematopoietic stem cells
- MPPs healthy multipotent progenitors
- LMPPs healthy lympho-myeloid primed progenitor
- HPCs healthy hematopoietic progenitor cells
- EMCN can be expressed on hematopoietic stem and progenitor cells (HSPCs). EMCN can be expressed on HSCs. EMCN can be expressed on MPPs. EMCN can be expressed on LMPPs. EMCN can be expressed on HPCs. EMCN- specific antibodies have been previously described, including CBFYE-0213, V.7.C7.1, L4B1, L5F12, L10B5, L3F12, L6H3, , L9H8, and L10F12, as described in Samulowitz U. et al., Am. J. Path., 2002 May, 160(5):1669-1681, herein incorporated by reference for all purposes. The present disclosure provides an EMCN-specific antigen-binding domain including one or more of the amino acid sequences listed in Table 1. Table 1.
- the antigen-binding domain specific for EMCN includes a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: the EMCN-VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 291), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 296), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 298), and the EMCN-VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 299), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of QVSKLDS (SEQ ID NO: 300), and a light chain complementarity
- the antigen-binding domain specific for EMCN includes a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: the EMCN-VH includes the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLEWVSVIWGNGNT HYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSS (SEQ ID NO: 302); and the EMCN-VL includes the amino acid sequence DVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLNWFQQRPGQSPRRLIYQVSKL DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGIHLPWTFGQGTKLEIK (SEQ ID NO: 310).
- VH heavy chain variable
- VL light chain variable
- the antigen-binding domain specific for EMCN includes the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLEWVSVIWGNGNT HYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSSGGG GSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLNWFQQRPG QSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGIHLPWTFGQ GTKLEIK (SEQ ID NO: 311).
- the antigen-binding domain specific for EMCN is encoded by a polynucleotide sequence comprising the sequence GAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATCTCTGAG ACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCACTGGGTCCG ACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGGGGCAACGGCAACA CACACTACCACAGCCCTGAAGTCCCGGTTCACCATCTCCAGACAACAGCAAG AACACCCTGTACCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGTGTACTA CTGCACCCTGAGAATCAAGGATTGGGGCCAGGGCACCATGGTCACCGTTTCTTCTG GAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCTGACGTGGTCAT GACACAGAGCCCTCTGAGCCTGCCTGACACTGGGACAGCCTGCCAGCAT GACACAGAGCCCTCTGAGCCTG
- the antigen-binding domain specific for EMCN is encoded by a polynucleotide sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to GAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATCTCTGAG ACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCACTGGGTCCG ACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGGGGCAACGGCAACA CACACTACCACAGCGCCCTGAAGTCCCGGTTCACCATCTCCAGAGACAACAGCAAG AACACCCTGTACCTGCAGATGAACAGCCTGAGAGCCGAGGACACCGCCGTGTACTA CTGCACCCTGAGAATCAAGGATTGGGGCCAGGGCACCATGGTCACCGTTTCTTCTG GAGGCGGAGGATCTCTGGGGCT
- FLT3 and CD33-Specific Antigen-binding Domains The present disclosure provides antigen-binding domains (e.g., single-chain variable fragments) that bind to FLT3 and CD33, chimeric proteins including antigen-binding domains that bind to FLT3 and CD33 (e.g., any of the aCARs described herein), and nucleic acids encoding such antigen-binding domains and chimeric proteins.
- chimeric receptors comprise one or more of the amino acid sequences listed in Table A1 or Table A2.
- activating chimeric receptors (aCARS) comprise one or more of the amino acid sequences listed in Table A1 or Table A2.
- bispecific-bivalent aCARS comprise one or more of the amino acid sequences listed in Table A1 or Table A2.
- Table A1 provides the variable domains of an antibody heavy chain or light chain. The CDRs were determined using the Kabat method and are in bold italic in Table A1 for each variable heavy chain or variable light chain and shown in Table A2.
- nucleic acids encoding any of the chimeric receptors of the present disclosure comprise one or more of the nucleic acid sequences listed in Table B.
- an antigen-binding domain specific for CD33 includes a heavy chain variable (VH) region and a light chain variable (VL) region
- the CD33-VH includes: a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of DYNMH (SEQ ID NO: 402), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of YIYPYNGGTGYNQKFKSKA (SEQ ID NO: 403), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of GRPAMDYWGQ (SEQ ID NO: 404), and the CD33-VL includes: a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASESVDNYGISFMN (SEQ ID NO: 405), a light chain complementarity determining region 2 (CDR-L2) having the amino acid sequence of AASNQGS (SEQ ID
- an antigen-binding domain specific for CD33 includes a CD33- VH having the amino acid sequence QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGG TGYNQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTV SS (SEQ ID NO: 329), and a CD33-VL having the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQG SGVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQSKEVPWTFGQGTKVEIK (SEQ ID NO: 330).
- an antigen-binding domain specific for FLT3 includes a heavy chain variable (VH) region and a light chain variable (VL) region
- the FLT3-VH includes a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GGTFSSYAIS (SEQ ID NO: 360), a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of GIIPIFGTANYAQKFQG (SEQ ID NO: 361), and a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of FALFGFREQAFDI (SEQ ID NO: 362)
- the FLT3-VL includes a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASQSISSYLN (SEQ ID NO: 363), a light chain complementarity determining region 2 (CDR- L2) having the amino acid sequence of AASSLQS (SEQ ID NO:
- an antigen-binding domain specific for FLT3 includes a FLT3- VH having the amino acid sequence EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTAN YAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCATFALFGFREQAFDIWGQGTTV TVSS (SEQ ID NO: 315), and a FLT3-VL having the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDLATYYCQQSYSTPFTFGPGTKVDIK (SEQ ID NO: 316).
- a bivalent-bispecific aCAR includes an antigen-binding domain specific for FLT3 and an antigen-binding domain specific for CD33.
- a bivalent-bispecific aCAR specific for FLT3 and CD33 includes the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCA TFALFGFREQAFDIWGQGTTVTVSSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGYT FTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYNQKFKSKATITADESTNTAYMELSSL RSEDTAVYYCARGRPAMDYWGQGTLVTVSSGSTSGSGKPGSGEGSTKGDIQMTQSPSS LSASVGDR
- a bivalent-bispecific aCAR specific for FLT3 and CD33 includes the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVR QAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCA TFALFGFREQAFDIWGQGTTVTVSSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCK ASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYNQKFKSKATITADESTNTAY MELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSSGGGGSGGSDIQMTQSPSSLS ASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGSGVPSRFSGSGS GTDFTLTISSLQPDDFATYYCQS
- multicistronic expression systems that include engineered nucleic acids encoding (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR.
- the multicistronic expression systems included engineered nucleic acids that encode an expression cassette containing a promoter and an exogenous polynucleotide sequence encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR.
- the promoter is operably linked to expression cassette of the multicistronic system such that the exogenous polynucleotide sequence encoding each of the membrane-cleavable chimeric protein, the bivalent aCAR, and the iCAR is configured to be expressed as a single polypeptide.
- An “engineered nucleic acid” is a nucleic acid that does not occur in nature. It should be understood, however, that while an engineered nucleic acid as a whole is not naturally- occurring, it may include nucleotide sequences that occur in nature. In some embodiments, an engineered nucleic acid comprises nucleotide sequences from different organisms (e.g., from different species).
- an engineered nucleic acid includes a murine nucleotide sequence, a bacterial nucleotide sequence, a human nucleotide sequence, and/or a viral nucleotide sequence.
- engineered nucleic acids includes recombinant nucleic acids and synthetic nucleic acids.
- a “recombinant nucleic acid” refers to a molecule that is constructed by joining nucleic acid molecules and, in some embodiments, can replicate in a live cell.
- a “synthetic nucleic acid” refers to a molecule that is amplified or chemically, or by other means, synthesized.
- Synthetic nucleic acids include those that are chemically modified, or otherwise modified, but can base pair with naturally- occurring nucleic acid molecules. Modifications include, but are not limited to, one or more modified internucleotide linkages and non-natural nucleic acids. Modifications are described in further detail in U.S. Pat. No. 6,673,611 and U.S. Application Publication 2004/0019001 and, each of which is incorporated by reference in their entirety. Modified internucleotide linkages can be a phosphorodithioate or phosphorothioate linkage.
- Non-natural nucleic acids can be a locked nucleic acid (LNA), a peptide nucleic acid (PNA), glycol nucleic acid (GNA), a phosphorodiamidate morpholino oligomer (PMO or “morpholino”), and threose nucleic acid (TNA).
- LNA locked nucleic acid
- PNA peptide nucleic acid
- GNA glycol nucleic acid
- PMO or “morpholino” a phosphorodiamidate morpholino oligomer
- TMA threose nucleic acid
- Recombinant nucleic acids and synthetic nucleic acids also include those molecules that result from the replication of either of the foregoing.
- Engineered nucleic acid of the present disclosure may be encoded by a single molecule (e.g., included in the same plasmid or other vector) or by multiple different molecules (e.g., multiple different independently-replicating molecules).
- Engineered nucleic acids can be an isolated nucleic acid.
- Isolated nucleic acids include, but are not limited to a cDNA polynucleotide, an RNA polynucleotide, an RNAi oligonucleotide (e.g., siRNAs, miRNAs, antisense oligonucleotides, shRNAs, etc.), an mRNA polynucleotide, a circular plasmid, a linear DNA fragment, a vector, a minicircle, a ssDNA, a bacterial artificial chromosome (BAC), and yeast artificial chromosome (YAC), and an oligonucleotide.
- a cDNA polynucleotide an RNA polynucleotide
- an RNAi oligonucleotide e.g., siRNAs, miRNAs, antisense oligonucleotides, shRNAs, etc.
- an mRNA polynucleotide e.g., a circular plasm
- Engineered nucleic acid of the present disclosure may be produced using standard molecular biology methods (see, e.g., Green and Sambrook, Molecular Cloning, A Laboratory Manual, 2012, Cold Spring Harbor Press).
- engineered nucleic acid constructs are produced using GIBSON ASSEMBLY® Cloning (see, e.g., Gibson, D.G. et al. Nature Methods, 343-345, 2009; and Gibson, D.G. et al. Nature Methods, 901-903, 2010, each of which is incorporated by reference herein).
- GIBSON ASSEMBLY® typically uses three enzymatic activities in a single-tube reaction: 5' exonuclease, the ⁇ extension activity of a DNA polymerase and DNA ligase activity.
- the 5 ' exonuclease activity chews back the 5 ' end sequences and exposes the complementary sequence for annealing.
- the polymerase activity then fills in the gaps on the annealed regions.
- a DNA ligase then seals the nick and covalently links the DNA fragments together.
- the overlapping sequence of adjoining fragments is much longer than those used in Golden Gate Assembly, and therefore results in a higher percentage of correct assemblies.
- engineered nucleic acid constructs are produced using IN- FUSION® cloning (Clontech). Promoters
- the engineered nucleic acids encoding the membrane-cleavable chimeric protein, the bivalent aCAR, and the iCAR encode an expression cassette containing a promoter.
- an engineered nucleic acid e.g., an engineered nucleic acid comprising an expression cassette
- the engineered nucleic acid may comprise a promoter operably linked to a nucleotide sequence encoding at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 8, at least 9, or at least 10 distinct proteins.
- an engineered nucleic acid comprises a promoter operably linked to a nucleotide sequence encoding 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more distinct proteins.
- an engineered nucleic acid (e.g., an engineered nucleic acid comprising an expression cassette) comprises a promoter operably linked to a nucleotide sequence (e.g., an exogenous polynucleotide sequence) encoding at least 2 membrane-cleavable chimeric proteins.
- the engineered nucleic acid may comprise a promoter operably linked to a nucleotide sequence encoding at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 8, at least 9, or at least 10 membrane-cleavable chimeric proteins.
- an engineered nucleic acid comprises a promoter operably linked to a nucleotide sequence encoding 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more membrane-cleavable chimeric proteins.
- a “promoter” refers to a control region of a nucleic acid sequence at which initiation and rate of transcription of the remainder of a nucleic acid sequence are controlled.
- a promoter may also contain sub-regions at which regulatory proteins and molecules may bind, such as RNA polymerase and other transcription factors. Promoters may be constitutive, inducible, repressible, tissue-specific or any combination thereof.
- a promoter drives expression or drives transcription of the nucleic acid sequence that it regulates.
- a promoter is considered to be “operably linked” when it is in a correct functional location and orientation in relation to a nucleic acid sequence it regulates to control (“drive”) transcriptional initiation and/or expression of that sequence.
- a promoter may be one naturally associated with a gene or sequence, as may be obtained by isolating the 5' non-coding sequences located upstream of the coding segment of a given gene or sequence. Such a promoter can be referred to as “endogenous.”
- a coding nucleic acid sequence may be positioned under the control of a recombinant or heterologous promoter, which refers to a promoter that is not normally associated with the encoded sequence in its natural environment.
- promoters may include promoters of other genes; promoters isolated from any other cell; and synthetic promoters or enhancers that are not "naturally occurring" such as, for example, those that contain different elements of different transcriptional regulatory regions and/or mutations that alter expression through methods of genetic engineering that are known in the art.
- sequences may be produced using recombinant cloning and/or nucleic acid amplification technology, including polymerase chain reaction (PCR) (see, e.g., U.S. Pat. No. 4,683,202 and U.S. Pat. No. 5,928,906).
- PCR polymerase chain reaction
- Promoters of an engineered nucleic acid may be “inducible promoters,” which refer to promoters that are characterized by regulating (e.g., initiating or activating) transcriptional activity when in the presence of, influenced by or contacted by a signal.
- the signal may be endogenous or a normally exogenous condition (e.g., light), compound (e.g., chemical or non- chemical compound) or protein (e.g., cytokine) that contacts an inducible promoter in such a way as to be active in regulating transcriptional activity from the inducible promoter.
- Activation of transcription may involve directly acting on a promoter to drive transcription or indirectly acting on a promoter by inactivation a repressor that is preventing the promoter from driving transcription.
- deactivation of transcription may involve directly acting on a promoter to prevent transcription or indirectly acting on a promoter by activating a repressor that then acts on the promoter.
- a promoter is “responsive to” or “modulated by” a local tumor state (e.g., inflammation or hypoxia) or signal if in the presence of that state or signal, transcription from the promoter is activated, deactivated, increased, or decreased.
- the promoter comprises a response element.
- a “response element” is a short sequence of DNA within a promoter region that binds specific molecules (e.g., transcription factors) that modulate (regulate) gene expression from the promoter.
- Response elements that may be used in accordance with the present disclosure include, without limitation, a phloretin-adjustable control element (PEACE), a zinc-finger DNA-binding domain (DBD), an interferon-gamma-activated sequence (GAS) (Decker, T. et al. J Interferon Cytokine Res. 1997 Mar;17(3):121-34, incorporated herein by reference), an interferon-stimulated response element (ISRE) (Han, K. J. et al. J Biol Chem. 2004 Apr 9;279(15):15652-61, incorporated herein by reference), a NF-kappaB response element (Wang, V. et al. Cell Reports.
- PEACE phloretin-adjustable control element
- DBD zinc-finger DNA-binding domain
- GAS interferon-gamma-activated sequence
- ISRE interferon-stimulated response element
- STAT3 response element Zhang, D. et al. J of Biol Chem. 1996; 271: 9503-9509, incorporated herein by reference.
- Other response elements are encompassed herein.
- Response elements can also contain tandem repeats (e.g., consecutive repeats of the same nucleotide sequence encoding the response element) to generally increase sensitivity of the response element to its cognate binding molecule. Tandem repeats can be labeled 2X, 3X, 4X, 5X, etc. to denote the number of repeats present.
- Non-limiting examples of responsive promoters (also referred to as “inducible promoters”) (e.g., TGF-beta responsive promoters) are listed in Table 5A, which shows the design of the promoter and transcription factor, as well as the effect of the inducer molecule towards the transcription factor (TF) and transgene transcription (T) is shown (B, binding; D, dissociation; n.d., not determined) (A, activation; DA, deactivation; DR, derepression) (see Horner, M. & Weber, W. FEBS Letters 586 (2012) 20784-2096m, and references cited therein).
- Non-limiting examples of components of inducible promoters include those presented in Table 5B. Table 5A.
- Non-limiting examples of promoters include the cytomegalovirus (CMV) promoter, the elongation factor 1-alpha (EF1a) promoter, the elongation factor (EFS) promoter, the MND promoter (a synthetic promoter that contains the U3 region of a modified MoMuLV LTR with myeloproliferative sarcoma virus enhancer), the phosphoglycerate kinase (PGK) promoter, the spleen focus-forming virus (SFFV) promoter, the simian virus 40 (SV40) promoter, and the ubiquitin C (UbC) promoter (see Table 5C).
- CMV cytomegalovirus
- EF1a elongation factor 1-alpha
- EFS elongation factor
- MND promoter a synthetic promoter that contains the U3 region of a modified MoMuLV LTR with myeloproliferative sarcoma virus enhancer
- PGK phosphoglycerate
- the promoter can be a tissue-specific promoter.
- a tissue-specific promoter directs transcription of a nucleic acid, (e.g., the engineered nucleic acids encoding the chimeric proteins, such as membrane-cleavable chimeric proteins having the formula S – C – MT or MT – C – S) such that expression is limited to a specific cell type, organelle, or tissue.
- Tissue-specific promoters include, but are not limited to, albumin (liver specific, Pinkert et al., (1987)), lymphoid specific promoters (Calame and Eaton, 1988), particular promoters of T-cell receptors (Winoto and Baltimore, (1989)) and immunoglobulins; Banerji et al., (1983); Queen and Baltimore, 1983), neuron specific promoters (e.g. the neurofilament promoter; Byrne and Ruddle, 1989), pancreas specific promoters (Edlund et al., (1985)) or mammary gland specific promoters (milk whey promoter, U.S. Pat. No. 4,873,316 and European Application Publication No.
- promoter as well as developmentally regulated promoters such as the murine hox promoters (Kessel and Gruss, Science 249:374-379 (1990)) or the ⁇ -fetoprotein promoter (Campes and Tilghman, Genes Dev. 3:537-546 (1989)), the contents of each of which are fully incorporated by reference herein.
- the promoter can be constitutive in the respective specific cell type, organelle, or tissue.
- Tissue-specific promoters and/or regulatory elements can also include promoters from the liver fatty acid binding (FAB) protein gene, specific for colon epithelial cells; the insulin gene, specific for pancreatic cells; the transphyretin, .alpha.1- antitrypsin, plasminogen activator inhibitor type 1 (PAI-I), apolipoprotein AI and LDL receptor genes, specific for liver cells; the myelin basic protein (MBP) gene, specific for oligodendrocytes; the glial fibrillary acidic protein (GFAP) gene, specific for glial cells; OPSIN, specific for targeting to the eye; and the neural-specific enolase (NSE) promoter that is specific for nerve cells.
- FAB liver fatty acid binding
- tissue-specific promoters include, but are not limited to, the promoter for creatine kinase, which has been used to direct expression in muscle and cardiac tissue and immunoglobulin heavy or light chain promoters for expression in B cells.
- Other tissue specific promoters include the human smooth muscle alpha-actin promoter.
- tissue-specific expression elements for the liver include but are not limited to HMG-COA reductase promoter, sterol regulatory element 1, phosphoenol pyruvate carboxy kinase (PEPCK) promoter, human C- reactive protein (CRP) promoter, human glucokinase promoter, cholesterol L 7-alpha hydroylase (CYP-7) promoter, beta- galactosidase alpha-2,6 sialylkansferase promoter, insulin-like growth factor binding protein (IGFBP-I) promoter, aldolase B promoter, human transferrin promoter, and collagen type I promoter.
- HMG-COA reductase promoter sterol regulatory element 1
- PEPCK phosphoenol pyruvate carboxy kinase
- CRP C- reactive protein
- glucokinase promoter human glucokinase promoter
- cholesterol L 7-alpha hydroylase (CYP-7) promoter beta
- Exemplary tissue-specific expression elements for the prostate include but are not limited to the prostatic acid phosphatase (PAP) promoter, prostatic secretory protein of 94 (PSP 94) promoter, prostate specific antigen complex promoter, and human glandular kallikrein gene promoter (hgt-1).
- Exemplary tissue-specific expression elements for gastric tissue include but are not limited to the human H+/K+-ATPase alpha subunit promoter.
- Exemplary tissue-specific expression elements for the pancreas include but are not limited to pancreatitis associated protein promoter (PAP), elastase 1 transcriptional enhancer, pancreas specific amylase and elastase enhancer promoter, and pancreatic cholesterol esterase gene promoter.
- Exemplary tissue-specific expression elements for the endometrium include, but are not limited to, the uteroglobin promoter.
- Exemplary tissue-specific expression elements for adrenal cells include, but are not limited to, cholesterol side-chain cleavage (SCC) promoter.
- Exemplary tissue-specific expression elements for the general nervous system include, but are not limited to, gamma-gamman enolase (neuron- specific enolase, NSE) promoter.
- Exemplary tissue-specific expression elements for the brain include, but are not limited to, the neurofilament heavy chain (NF-H) promoter.
- NF-H neurofilament heavy chain
- tissue-specific expression elements for lymphocytes include, but are not limited to, the human CGL-1/granzyme B promoter, the terminal deoxy transferase (TdT), lambda 5, VpreB, and lck (lymphocyte specific tyrosine protein kinase p561ck) promoter, the humans CD2 promoter and its 3 ' transcriptional enhancer, and the human NK and T cell specific activation (NKG5) promoter.
- tissue-specific expression elements for the colon include, but are not limited to, pp60c-src tyrosine kinase promoter, organ-specific neoantigens (OSNs) promoter, and colon specific antigen-P promoter.
- Tissue-specific expression elements for breast cells are for example, but are not limited to, the human alpha-lactalbumin promoter.
- tissue-specific expression elements for the lung include, but are not limited to, the cystic fibrosis transmembrane conductance regulator (CFTR) gene promoter.
- CFTR cystic fibrosis transmembrane conductance regulator
- a promoter of the present disclosure is modulated by signals within a tumor microenvironment.
- a tumor microenvironment is considered to modulate a promoter if, in the presence of the tumor microenvironment, the activity of the promoter is increased or decreased by at least 10%, relative to activity of the promoter in the absence of the tumor microenvironment.
- the activity of the promoter is increased or decreased by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, relative to activity of the promoter in the absence of the tumor microenvironment.
- the activity of the promoter is increased or decreased by 10-20%, 10-30%, 10-40%, 10-50%, 10-60%, 10-70%, 10-80%, 10-90%, 10-100%, 10-200%, 20-30%, 20-40%, 20-50%, 20-60%, 20-70%, 20-80%, 20-90%, 20-100%, 20-200%, 50-60%, 50-70%, 50-80%, 50-90%, 50-100%, or 50-200%, relative to activity of the promoter in the absence of the tumor microenvironment.
- the activity of the promoter is increased or decreased by at least 2 fold (e.g., 2, 3, 4, 5, 10, 25, 20, 25, 50, or 100 fold), relative to activity of the promoter in the absence of the tumor microenvironment.
- the activity of the promoter is increased or decreased by at least 3 fold, at least 5 fold, at least 10 fold, at least 20 fold, at least 50 fold, or at least 100 fold, relative to activity of the promoter in the absence of the tumor microenvironment.
- the activity of the promoter is increased or decreased by 2-10, 2-20, 2-30, 2-40, 2-50, 2-60, 2-70, 2-80, 2-90, or 2-100 fold, relative to activity of the promoter in the absence of the tumor microenvironment.
- a promoter of the present disclosure is activated under a hypoxic condition.
- a “hypoxic condition” is a condition where the body or a region of the body is deprived of adequate oxygen supply at the tissue level.
- Hypoxic conditions can cause inflammation (e.g., the level of inflammatory cytokines increase under hypoxic conditions).
- the promoter that is activated under hypoxic condition is operably linked to a nucleotide encoding a chimeric proteins that decreases the expression of activity of inflammatory cytokines, thus reducing the inflammation caused by the hypoxic condition.
- the promoter that is activated under hypoxic conditions comprises a hypoxia responsive element (HRE).
- a “hypoxia responsive element (HRE)” is a response element that responds to hypoxia-inducible factor (HIF).
- HRE in some embodiments, comprises a consensus motif NCGTG (where N is either A or G).
- a synthetic promoter is a promoter system including an activation-conditional control polypeptide- (ACP-) binding domain sequence and a promoter sequence.
- ACP- activation-conditional control polypeptide-
- ACP-responsive promoter Such a system is also referred to herein as an “ACP-responsive promoter.”
- an ACP promoter system includes a first expression cassette encoding an activation-conditional control polypeptide (ACP) and a second expression cassette encoding an ACP-responsive promoter operably linked to an exogenous polynucleotide sequence, such as the exogenous polynucleotide sequence encoding the membrane-cleavable chimeric proteins described herein or any other protein of interest (e.g., a protease).
- the first expression cassette and second expression cassette are each encoded by a separate engineered nucleic acid. In other embodiments, the first expression cassette and the second expression cassette are encoded by the same engineered nucleic acid.
- the ACP-responsive promoter can be operably linked to a nucleotide sequence encoding a single protein of interest or multiple proteins of interest.
- the promoters of the ACP promoter system e.g., either a promoter driving expression of the ACP or the promoter sequence of the ACP-responsive promoter, can include any of the promoter sequences described herein (see “Promoters” above).
- the ACP-responsive promoter can be derived from minP, NFkB response element, CREB response element, NFAT response element, SRF response element 1, SRF response element 2, AP1 response element, TCF-LEF response element promoter fusion, Hypoxia responsive element, SMAD binding element, STAT3 binding site, minCMV, YB_TATA, minTK, inducer molecule responsive promoters, and tandem repeats thereof.
- the ACP-responsive promoter includes a minimal promoter.
- the ACP-binding domain includes one or more zinc finger binding sites.
- the ACP-responsive promoter includes a minimal promoter and the ACP-binding domain includes one or more zinc finger binding sites.
- the ACP-binding domain can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more zinc finger binding sites.
- the transcription factor is a zinc-finger-containing transcription factor.
- the zinc-finger-containing transcription factor is a synthetic transcription factor.
- the ACP-binding domain includes one or more zinc finger binding sites and the ACP has a DNA-binding zinc finger protein domain (ZF protein domain).
- the ACP has a DNA-binding zinc finger protein domain (ZF protein domain) and an effector domain.
- the ACP-binding domain includes one or more zinc finger binding sites and the ACP has a DNA-binding zinc finger protein domain (ZF protein domain) and an effector domain.
- the ZF protein domain is modular in design and is composed of zinc finger arrays (ZFA).
- ZFA zinc finger arrays
- a zinc finger array comprises multiple zinc finger protein motifs that are linked together. Each zinc finger motif binds to a different nucleic acid motif. This results in a ZFA with specificity to any desired nucleic acid sequence, e.g., a ZFA with desired specificity to an ACP-binding domain having a specific zinc finger binding site composition and/or configuration.
- the ZF motifs can be directly adjacent to each other, or separated by a flexible linker sequence.
- a ZFA is an array, string, or chain of ZF motifs arranged in tandem.
- a ZFA can have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,13, 14, or 15 zinc finger motifs.
- the ZFA can have from 1-10, 1-15, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 2-3, 2-4, 2-5, 2-6, 2-7, 2-8, 2-9, 2-10, 3-4, 3-53-6, 3-7, 3-8, 3-9, 3-10, 4-5, 4-6, 4-7, 4-8, 4- 9, 4-10, 5-6, 5-7, 5-8, 5-9, 5-10, or 5-15 zinc finger motifs.
- the ZF protein domain can have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more ZFAs.
- the ZF domain can have from 1-10, 1- 15, 1-2, 1-3, 1-4, 1-5, 1-6, 1-7, 1-8, 1-9, 2-3, 2-4, 2-5, 2-6, 2-7, 2-8, 2-9, 2-10, 3-4, 3-53-6, 3-7, 3-8, 3-9, 3-10, 4-5, 4-6, 4-7, 4-8, 4-9, 4-10, 5-6, 5-7, 5-8, 5-9, 5-10, or 5-15 ZFAs.
- the ZF protein domain comprises one to ten ZFA(s).
- the ZF protein domain comprises at least one ZFA.
- the ZF protein domain comprises at least two ZFAs.
- the ZF protein domain comprises at least three ZFAs.
- the ZF protein domain comprises at least four ZFAs. In some embodiments, the ZF protein domain comprises at least five ZFAs. In some embodiments, the ZF protein domain comprises at least ten ZFAs.
- the ACP is a transcriptional modulator. In some embodiments, the ACP is a transcriptional repressor. In some embodiments, the ACP is a transcriptional activator. In some embodiments, the ACP is a transcription factor. In some embodiments, the ACP comprises a DNA-binding domain and a transcriptional effector domain. In some embodiments, the DNA-binding domain comprises a tetracycline (or derivative thereof) repressor (TetR) domain.
- the ACP is an antigen recognizing receptor of the present disclosure.
- the ACP can also further include an effector domain, such as a transcriptional effector domain.
- a transcriptional effector domain can be the effector or activator domain of a transcription factor.
- Transcription factor activation domains are also known as transactivation domains, and act as scaffold domains for proteins such as transcription coregulators that act to activate or repress transcription of genes.
- Any suitable transcriptional effector domains can be used in the ACP including, but not limited to, a Herpes Simplex Virus Protein 16 (VP16) activation domain; an activation domain consisting of four tandem copies of VP16, a VP64 activation domain; a p65 activation domain of NF ⁇ B; an Epstein-Barr virus R transactivator (Rta) activation domain; a tripartite activator comprising the VP64, the p65, and the Rta activation domains, the tripartite activator is known as a VPR activation domain; a histone acetyltransferase (HAT) core domain of the human E1A-associated protein p300, known as a p300 HAT core activation domain; a Krüppel associated box (KRAB) repression domain; a Repressor Element Silencing Transcription Factor (REST) repression domain; a WRPW motif of the hairy-related basic helix-l
- the effector domain is s transcription effector domain selected from: a Herpes Simplex Virus Protein 16 (VP16) activation domain; an activation domain consisting of four tandem copies of VP16, a VP64 activation domain; a p65 activation domain of NF ⁇ B; an Epstein-Barr virus R transactivator (Rta) activation domain; a tripartite activator comprising the VP64, the p65, and the Rta activation domains, the tripartite activator is known as a VPR activation domain; a histone acetyltransferase (HAT) core domain of the human E1A- associated protein p300, known as a p300 HAT core activation domain; a Krüppel associated box (KRAB) repression domain; a Repressor Element Silencing Transcription Factor (REST) repression domain; a WRPW motif of the hairy-related basic helix-loop-helix
- the ACP is a small molecule (e.g., drug) inducible polypeptide.
- the ACP may be induced by tetracycline (or derivative thereof), and comprises a TetR domain and a VP16 effector domain.
- the ACP includes an estrogen receptor variant, such as ERT2, and may be regulated by tamoxifen, or a metabolite thereof (such as 4-hydroxy-tamoxifen [4-OHT], N-desmethyltamoxifen, tamoxifen-N-oxide, or endoxifen), through tamoxifen-controlled nuclear localization.
- the ACP is a small molecule (e.g., drug) inducible polypeptide that includes a repressible protease and one or more cognate cleavage sites of the repressible protease.
- a repressible protease is active (cleaves a cognate cleavage site) in the absence of the specific agent and is inactive (does not cleave a cognate cleavage site) in the presence of the specific agent.
- the specific agent is a protease inhibitor.
- the protease inhibitor specifically inhibits a given repressible protease of the present disclosure.
- the repressible protease can be any of the proteases described herein that is capable of inactivation by the presence or absence of a specific agent (see “Protease Cleavage Site” above for exemplary repressible proteases, cognate cleavage sites, and protease inhibitors).
- the ACP has a degron domain (see “Degron Systems and Domains” above for exemplary degron sequences). The degron domain can be in any order or position relative to the individual domains of the ACP.
- the degron domain can be N-terminal of the repressible protease, C-terminal of the repressible protease, N-terminal of the ZF protein domain, C-terminal of the ZF protein domain, N-terminal of the effector domain, or C-terminal of the effector domain.
- engineered nucleic acids e.g., an engineered nucleic acid comprising an expression cassette
- nucleic acids may be configured to produce 2-20 different chimeric proteins.
- nucleic acids are configured to produce 2-20, 2-19, 2-18, 2-17, 2-16, 2-15, 2-14, 2-13, 2-12, 2-11, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-20, 3-19, 3-18, 3-17, 3-16, 3-15, 3-14, 3-13, 3-12, 3-11, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-20, 4-19, 4-18, 4-17, 4-16, 4-15, 4-14, 4-13, 4-12, 4-11, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-20, 5-19, 5-18, 5-17, 5-16, 5-15, 5-14, 5-13, 5-12, 5- 11, 5-10, 5-9, 5-8, 5-7, 5-6, 6-20, 6-19, 6-18, 6-17, 6-16, 6-15, 6-14, 6-13, 6-12, 6-11, 6-10, 6-9, 6-8, 6-7, 7-20, 7
- nucleic acids are configured to produce 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 chimeric proteins.
- the engineered nucleic acids described herein are multicistronic, i.e., as described above.
- Engineered nucleic acids can also use multiple promoters to express genes from multiple ORFs, i.e., more than one separate mRNA transcripts can be produced from a single engineered nucleic acid.
- a first promoter can be operably linked to a polynucleotide sequence encoding a first chimeric protein
- a second promoter can be operably linked to a polynucleotide sequence encoding a second chimeric protein.
- any number of promoters can be used to express any number of chimeric proteins.
- at least one of the ORFs expressed from the multiple promoters can be multicistronic.
- Linkers can refer to polypeptides that link a first polypeptide sequence and a second polypeptide sequence, the multicistronic linkers described above, or the additional promoters that are operably linked to additional ORFs described above.
- Engineered Cells Provided herein are engineered cells, and methods of producing the engineered cells, that produce each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR..
- engineered cells of the present disclosure may be engineered to express the chimeric proteins provided for herein, such as each of the membrane-cleavable chimeric proteins, the bivalent aCARs, and the iCARsdescribed herein. These cells are referred to herein as “engineered cells.” These cells, which typically contain engineered nucleic acid, do not occur in nature.
- the cells are engineered to include a nucleic acid comprising a promoter operably linked to a nucleotide sequence encoding a chimeric protein, for example, a membrane-cleavable chimeric protein.
- An engineered cell can comprise an engineered nucleic acid integrated into the cell’s genome.
- An engineered cell can comprise an engineered nucleic acid capable of expression without integrating into the cell’s genome, for example, engineered with a transient expression system such as a plasmid or mRNA.
- the present disclosure also encompasses additivity and synergy between a chimeric protein(s) and the engineered cell from which they are produced.
- cells are engineered to produce at least two (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10 or more) chimeric proteins, for example ate least two membrane-cleavable chimeric proteins.
- cells are engineered to produce at least one chimeric proteins having an effector molecule that is not natively produced by the cells.
- Such an effector molecule may, for example, complement the function of effector molecules natively produced by the cells.
- cells are engineered to express membrane-tethered anti-CD3 and/or anti-CD28 agonist extracellular domains.
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce multiple chimeric proteins.
- cells may be engineered to produce 2-20 different chimeric proteins, such as 2-20 different membrane-cleavable chimeric proteins.
- cells are engineered to produce 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 chimeric proteins.
- engineered cells comprise one or more engineered nucleic acids encoding a promoter operably linked to a nucleotide sequence encoding a chimeric protein.
- cells are engineered to include a plurality of engineered nucleic acids, e.g., at least two engineered nucleic acids, each encoding a promoter operably linked to a nucleotide sequence encoding at least one (e.g., 1, 2 or 3) chimeric protein.
- cells may be engineered to comprise at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 8, at least 9, or at least 10, engineered nucleic acids, each encoding a promoter operably linked to a nucleotide sequence encoding at least one (e.g., 1, 2 or 3) chimeric protein.
- the cells are engineered to comprise 2, 3, 4, 5, 6, 7, 8, 9, 10, or more engineered nucleic acids, each encoding a promoter operably linked to a nucleotide sequence encoding at least one (e.g., 1, 2 or 3) chimeric protein.
- Engineered cells can comprise an engineered nucleic acid encoding at least one of the linkers described above, such as polypeptides that link a first polypeptide sequence and a second polypeptide sequence, one or more multicistronic linker described above, one or more additional promoters operably linked to additional ORFs, or a combination thereof.
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to express a protease.
- a cell is engineered to express a protease heterologous to a cell.
- a cell is engineered to express a protease heterologous to a cell expressing a chimeric protein, such as a heterologous protease that cleaves the protease cleavage site of a membrane-cleavable chimeric protein.
- engineered cells comprise one or more engineered nucleic acids encoding a promoter operably linked to a nucleotide sequence encoding a protease, such as a heterologous protease.
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce at least one homing molecule.
- a “homing molecule” refers to a molecule that directs cells to a target site.
- a homing molecule functions to recognize and/or initiate interaction of an engineered cell to a target site.
- Non-limiting examples of homing molecules include CXCR1, CCR9, CXCR2, CXCR3, CXCR4, CCR2, CCR4, FPR2, VEGFR, IL6R, CXCR1, CSCR7, and PDGFR.
- a homing molecule is a chemokine receptor (cell surface molecule that binds to a chemokine).
- Non-limiting examples of chemokine receptors that may be produced by the engineered cells of the present disclosure include: CXC chemokine receptors (e.g., CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, and CXCR7), CC chemokine receptors (CCR1, CCR2, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9, CCR10, and CCR11), CX3C chemokine receptors (e.g., CX3CR1, which binds to CX3CL1), and XC chemokine receptors (e.g., XCR1).
- CXC chemokine receptors e.g., CXCR1, CXCR2, CXCR3, CXCR4, CXCR5, CXCR6, and CXCR7
- CXC chemokine receptors e.g., CX3CR1, which binds to CX3CL1
- a chemokine receptor is a G protein- linked transmembrane receptor, or a member of the tumor necrosis factor (TNF) receptor superfamily (including but not limited to TNFRSF1A, TNFRSF1B).
- TNF tumor necrosis factor
- cells are engineered to produce CXCL8, CXCL9, and/or CXCL10 (promote T-cell recruitment), CCL3 and/or CXCL5, CCL21 (Th1 recruitment and polarization).
- cells are engineered to produce CXCR4.
- a cell e.g., an immune cell or a stem cell
- GPCRs G-protein coupled receptors
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce receptors that detect interleukins (including but not limited to IL6R).
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce receptors that detect growth factors secreted from other cells, tissues, or tumors (including but not limited to FGFR, PDGFR, EGFR, and receptors of the VEGF family, including but not limited to VEGF-C and VEGF-D).
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce one or more integrins. Cells of the present disclosure may be engineered to produce any combination of integrin ⁇ and ⁇ subunits.
- the ⁇ subunit of an integrin may be, without limitation: ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, IGTA7, ITGA8, ITGA9, IGTA10, IGTA11, ITGAD, ITGAE, ITGAL, ITGAM, ITGAV, ITGA2B, ITGAX.
- the ⁇ subunit of an integrin may be, without limitation: ITGB1, ITGB2, ITGB3, ITGB4, ITGB5, ITGB6, ITGB7, and ITGB8.
- a cell e.g., an immune cell or a stem cell
- MMPs include MMP-2, MMP-9, and MMP.
- cells are engineered to produce an inhibitor of a molecule (e.g., protein) that inhibits MMPs.
- a molecule e.g., protein
- cells may be engineered to express an inhibitor (e.g., an RNAi molecule) of membrane type 1 MMP (MT1-MMP) or TIMP metallopeptidase inhibitor 1 (TIMP-1).
- a cell e.g., an immune cell or a stem cell
- a ligand that binds to selectin e.g., hematopoietic cell E-/L-selectin ligand (HCELL), Dykstran et al., Stem Cells.
- homing molecule also encompasses transcription factors that regulate the production of molecules that improve/enhance homing of cells.
- engineered cells that are engineered to produce multiple chimeric proteins, at least two of which include effector molecules that modulate different tumor-mediated immunosuppressive mechanisms.
- at least one (e.g., 1, 2, 3, 4, 5, or more) chimeric protein includes an effector molecule that stimulates at least one immunostimulatory mechanism in the tumor microenvironment, or inhibits at least one immunosuppressive mechanism in the tumor microenvironment.
- At least one (e.g., 1, 2, 3, 4, 5, or more) chimeric protein includes an effector molecule that inhibits at least one immunosuppressive mechanism in the tumor microenvironment, and at least one chimeric protein (e.g., 1, 2, 3, 4, 5, or more) inhibits at least one immunosuppressive mechanism in the tumor microenvironment.
- at least two (e.g., 2, 3, 4, 5, or more) chimeric proteins includes an effector molecule that stimulate at least one immunostimulatory mechanism in the tumor microenvironment.
- at least two (e.g., 1, 2, 3, 4, 5, or more) chimeric proteins includes an effector molecule that inhibit at least one immunosuppressive mechanism in the tumor microenvironment.
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce at least one chimeric protein including an effector molecule that stimulates T cell signaling, activity and/or recruitment.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates antigen presentation and/or processing.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates natural killer cell-mediated cytotoxic signaling, activity and/or recruitment.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates dendritic cell differentiation and/or maturation.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates immune cell recruitment.
- a cell is engineered to produce at least one chimeric protein includes an effector molecule that that stimulates M1 macrophage signaling, activity and/or recruitment.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates Th1 polarization.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates stroma degradation.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates immunostimulatory metabolite production.
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that stimulates Type I interferon signaling. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits negative costimulatory signaling. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits pro-apoptotic signaling (e.g., via TRAIL) of anti-tumor immune cells. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits T regulatory (Treg) cell signaling, activity and/or recruitment.
- T regulatory T regulatory
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits tumor checkpoint molecules. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that activates stimulator of interferon genes (STING) signaling. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits myeloid-derived suppressor cell signaling, activity and/or recruitment. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that degrades immunosuppressive factors/metabolites.
- STING stimulator of interferon genes
- a cell is engineered to produce at least one chimeric protein that includes an effector molecule that inhibits vascular endothelial growth factor signaling. In some embodiments, a cell is engineered to produce at least one chimeric protein that includes an effector molecule that directly kills tumor cells (e.g., granzyme, perforin, oncolytic viruses, cytolytic peptides and enzymes, anti-tumor antibodies, e.g., that trigger ADCC).
- tumor cells e.g., granzyme, perforin, oncolytic viruses, cytolytic peptides and enzymes, anti-tumor antibodies, e.g., that trigger ADCC.
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce at least one chimeric protein including an effector molecule selected from IL-12, IFN- ⁇ , IFN- ⁇ , IL-2, IL-15, IL-7, IL-36 ⁇ , IL-18, IL-1 ⁇ , OX40-ligand, and CD40L; and/or at least a checkpoint inhibitor.
- Illustrative immune checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, 4-1BB (CD137), 4-1BBL (CD137L), PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, ⁇ ⁇ ⁇ ⁇ , and memory CD8+ ( ⁇ ⁇ ) T cells), CD160 (also referred to as BY55), and CGEN-15049.
- CTLA-4 CTLA-4
- 4-1BB CD137
- 4-1BBL CD137L
- Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4, CD160, and CGEN-15049.
- checkpoint inhibitors include, but are not limited to, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-PD-L2 antibodies, anti-CTLA-4 antibodies, anti-LAG-3 antibodies, anti-TIM-3 antibodies, anti-TIGIT antibodies, anti-VISTA antibodies, anti-KIR antibodies, anti-B7-H3 antibodies, anti-B7-H4 antibodies, anti-HVEM antibodies, anti-BTLA antibodies, anti-GAL9 antibodies, anti-A2AR antibodies, anti- phosphatidylserine antibodies, anti-CD27 antibodies, anti-TNFa antibodies, anti-TREMl antibodies, and anti-TREM2 antibodies.
- Illustrative immune checkpoint inhibitors include pembrolizumab (anti-PD-1; MK-3475/Keytruda® - Merck), nivolumamb (anti-PD-1; Opdivo® - BMS), pidilizumab (anti-PD-1 antibody; CT-011 – Teva/CureTech), AMP224 (anti-PD-1; NCI), avelumab (anti-PD-L1; Bavencio® - Pfizer), durvalumab (anti-PD-L1; MEDI4736/Imfinzi® - Medimmune/AstraZeneca), atezolizumab (anti-PD-L1; Tecentriq® - Roche/Genentech), BMS- 936559 (anti-PD-L1 - BMS), tremelimumab (anti-CTLA-4; Medimmune/AstraZeneca), ipilimumab (anti-CTLA-4; Yervoy ®
- a cell e.g., an immune cell or a stem cell
- a cell e.g., an immune cell or a stem cell
- a cell is engineered to produce IFN- ⁇ and at least one cytokine or receptor/ligand (e.g., IL-12, IFN- ⁇ , IL-2, IL-15, IL-7, IL-36 ⁇ , IL-18, IL-1 ⁇ , OX40- ligand, and/or CD40L).
- cytokine or receptor/ligand e.g., IL-12, IFN- ⁇ , IL-2, IL-15, IL-7, IL-36 ⁇ , IL-18, IL-1 ⁇ , OX40- ligand, and/or CD40L
- a cell e.g., an immune cell or a stem cell
- the secretable effector molecule e.g., “S” in the formula S – C – MT or MT – C – S
- the secretable effector molecule is a cytokine, a chemokine, a homing molecule, a growth factor, a co-activation molecule, a tumor microenvironment modifier, a ligand, an antibody, a peptide, or an enzyme.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a cytokine.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a chemokine. In some embodiments, a cell is engineered to produce at least one membrane- cleavable chimeric protein where the secretable effector molecule is a homing molecule. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a growth factor. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a co-activation molecule.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a tumor microenvironment modifier. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a ligand. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is an antibody. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a peptide.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is an enzyme. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule (e.g., “S” in the formula S – C – MT or MT – C – S) is IL-1-beta, IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, an IL-12p70 fusion protein, IL- 15, IL17A, IL18, IL21, IL22, Type I interferons, Interferon-gamma, or TNF-alpha.
- secretable effector molecule e.g., “S” in the formula S – C – MT or MT – C – S
- the secretable effector molecule e.g., “S” in the formula S – C – MT or MT –
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is CCL21a, CXCL10, CXCL11, CXCL13, a CXCL10- CXCL11 fusion protein, CCL19, CXCL9, or XCL1.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is anti-integrin alpha4,beta7, anti-MAdCAM, SDF1, or MMP-2.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is 4-1BBL or CD40L.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is adenosine deaminase, a TGFbeta inhibitor, an immune checkpoint inhibitor, a VEGF inhibitor, or HPGE2.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is an anti-TGFbeta peptide, an anti-TGFbeta antibody, a TGFb-TRAP, or combinations thereof.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is an anti-VEGF antibody, an anti-VEGF peptide, or a combination thereof.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is an anti-PD-1 antibody, an anti-PD-L1 antibody, an anti-PD-L2 antibody, an anti-CTLA-4 antibody, an anti- LAG-3 antibody, an anti-TIM-3 antibody, an anti-TIGIT antibody, an anti-VISTA antibody, an anti-KIR antibody, an anti-B7-H3 antibody, an anti-B7-H4 antibody, an anti-HVEM antibody, an anti-BTLA antibody, an anti-GAL9 antibody, an anti-A2AR antibody, an anti- phosphatidylserine antibody, an anti-CD27 antibody, an anti-TNFa antibody, an anti-TREMl antibody, or an anti-TRE
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule (e.g., “S” in the formula S – C – MT or MT – C – S) comprises IL-15.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is a fusion of IL-15 and the sushi domain of IL-15R ⁇ .
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector consists of IL- 15.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce one or more additional effector molecules. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce one or more additional secretable effector molecules.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce a cytokine, a chemokine, a homing molecule, a growth factor, a co-activation molecule, a tumor microenvironment modifier, a ligand, an antibody, a polynucleotide, a peptide, or an enzyme.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL- 15 and the cell is further engineered to produce IL-12, IFN- ⁇ , IL-2, IL-7, IL-36 ⁇ , IL-18, IL-1 ⁇ , OX40-ligand, or CD40L.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL-12.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IFN- ⁇ . In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL-2. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL- 7.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL-36 ⁇ . In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL-18. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce IL-1 ⁇ .
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce OX40-ligand. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered to produce CD40L. In some embodiments, a cell is engineered to produce at least one membrane-cleavable chimeric protein and the cell is further engineered to produce one or more additional membrane- cleavable chimeric proteins.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule (e.g., “S” in the formula S – C – MT or MT – C – S) is IL-15 and the cell is further engineered to produce one or more additional membrane-cleavable chimeric proteins.
- the secretable effector molecule e.g., “S” in the formula S – C – MT or MT – C – S
- the cell is further engineered to produce one or more additional membrane-cleavable chimeric proteins.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is produce a cytokine, a chemokine, a homing molecule, a growth factor, a co-activation molecule, a tumor microenvironment modifier, a ligand, an antibody, a polynucleotide, a peptide, or an enzyme.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-12, IFN- ⁇ , IL-2, IL-7, IL-36 ⁇ , IL- 18, IL-1 ⁇ , OX40-ligand, or CD40L.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-12.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IFN- ⁇ .
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-2.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-7.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-36 ⁇ .
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-18.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is IL-1 ⁇ .
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is OX40-ligand.
- a cell is engineered to produce at least one membrane-cleavable chimeric protein where the secretable effector molecule is IL-15 and the cell is further engineered an additional membrane-cleavable chimeric protein where the additional secretable effector molecule is CD40L.
- a cell can also be further engineered to express additional proteins in addition to the chimeric proteins (e.g., the membrane-cleavable chimeric proteins having the formula S – C – MT or MT – C – S described herein), proteins of interest, or effector molecules described herein.
- a cell can be further engineered to express one or more antigen recognizing receptors.
- An antigen recognizing receptor can include an antigen-binding domain, such as an antibody, an antigen-binding fragment of an antibody, a F(ab) fragment, a F(ab') fragment, a single chain variable fragment (scFv), or a single-domain antibody (sdAb).
- An antigen recognizing receptors can include an scFv.
- An scFv can include a heavy chain variable domain (VH) and a light chain variable domain (VL), which can be separated by a peptide linker.
- VH heavy chain variable domain
- VL light chain variable domain
- an scFv can include the structure VH-L-VL or VL-L-VH, wherein VH is the heavy chain variable domain, L is the peptide linker, and VL is the light chain variable domain.
- An antigen recognizing receptor can be a chimeric antigen receptor (CAR).
- a CAR can have one or more intracellular signaling domains, such as a CD3zeta-chain intracellular signaling domain, a CD97 intracellular signaling domain, a CD11a-CD18 intracellular signaling domain, a CD2 intracellular signaling domain, an ICOS intracellular signaling domain, a CD27 intracellular signaling domain, a CD154 intracellular signaling domain, a CD8 intracellular signaling domain, an OX40 intracellular signaling domain, a 4-1BB intracellular signaling domain, a CD28 intracellular signaling domain, a ZAP40 intracellular signaling domain, a CD30 intracellular signaling domain, a GITR intracellular signaling domain, an HVEM intracellular signaling domain, a DAP10 intracellular signaling domain, a DAP12 intracellular signaling domain, a MyD88 intracellular signaling domain, fragments thereof, combinations thereof, or combinations of fragments thereof.
- a CAR can have a transmembrane domain, such as a CD8 transmembrane domain, a CD28 transmembrane domain a CD3zeta-chain transmembrane domain, a CD4 transmembrane domain, a 4-1BB transmembrane domain, an OX40 transmembrane domain, an ICOS transmembrane domain, a CTLA-4 transmembrane domain, a PD-1 transmembrane domain, a LAG-3 transmembrane domain, a 2B4 transmembrane domain, a BTLA transmembrane domain, fragments thereof, combinations thereof, or combinations of fragments thereof.
- a transmembrane domain such as a CD8 transmembrane domain, a CD28 transmembrane domain a CD3zeta-chain transmembrane domain, a CD4 transmembrane domain, a 4-1BB transmembrane domain, an OX40 transmembrane domain
- a CAR can have a spacer region between the antigen-binding domain and the transmembrane domain.
- An antigen recognizing receptor can be a T cell receptor (TCR).
- Engineered Cell Types Also provided herein are engineered cells. Cells can be engineered to comprise any of the engineered nucleic acids described herein (e.g., any of the multicistronic systems encoding each of the membrane-cleavable chimeric proteins, the bivalent aCARs, and the iCARsdescribed herein). Cells can be engineered to possess any of the features of any of the engineered cells described herein.
- cells engineered to produce two or more chimeric proteins are provided herein.
- the engineered cells can be an immune cell, including but not limited to, a T cell, a CD8+ T cell, a CD4+ T cell, a gamma-delta ( ⁇ ) T cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a viral-specific T cell, a Natural Killer T (NKT) cell, a Natural Killer (NK) cell, a B cell, a tumor-infiltrating lymphocyte (TIL), an innate lymphoid cell, a mast cell, an eosinophil, a basophil, a neutrophil, a myeloid cell, a macrophage, a monocyte, or a dendritic cell.
- the engineered cells can be a T cell.
- the engineered cells can be an NK cell.
- Cells engineered to express a chimeric antigen receptor (CAR) are also referred to as CAR cells.
- CAR-T cells T cells engineered to express a CAR are also referred to as CAR-T cells and likewise NK cells engineered to express a CAR are also referred to as CAR-NK cells.
- the engineered cells can be a stem cell, including but not limited to, a human embryonic stem cell (ESC), an ESC-derived cell, a pluripotent stem cell, a mesenchymal stromal cell (MSC), an induced pluripotent stem cell (iPSC), or an iPSC-derived cell.
- the engineered cells can be tumor-derived cells.
- tumor cells include, but are not limited to, a bladder tumor cell, a brain tumor cell, a breast tumor cell, a cervical tumor cell, a colorectal tumor cell, an esophageal tumor cell, a glioma cell, a kidney tumor cell, a liver tumor cell, a lung tumor cell, a melanoma cell, an ovarian tumor cell, a pancreatic tumor cell, a prostate tumor cell, a skin tumor cell, a thyroid tumor cell, and a uterine tumor cell.
- a cell can be engineered to produce the chimeric proteins using methods known to those skilled in the art. For example, cells can be transduced to engineer the tumor. In an embodiment, the cell is transduced using a virus.
- the cell is transduced using an oncolytic virus.
- oncolytic viruses include, but are not limited to, an oncolytic herpes simplex virus, an oncolytic adenovirus, an oncolytic measles virus, an oncolytic influenza virus, an oncolytic Indiana vesiculovirus, an oncolytic Newcastle disease virus, an oncolytic vaccinia virus, an oncolytic poliovirus, an oncolytic myxoma virus, an oncolytic reovirus, an oncolytic mumps virus, an oncolytic Maraba virus, an oncolytic rabies virus, an oncolytic rotavirus, an oncolytic hepatitis virus, an oncolytic rubella virus, an oncolytic dengue virus, an oncolytic chikungunya virus, an oncolytic respiratory syncytial virus, an oncolytic lymphocytic choriomeningitis virus, an oncolytic morbillivirus, an oncolytic lentivirus,
- the virus can be a recombinant virus that encodes one more transgenes encoding one or more chimeric proteins, such as any of the engineered nucleic acids described herein.
- the virus including any of the oncolytic viruses described herein, can be a recombinant virus that encodes one more transgenes encoding one or more of the two or more chimeric proteins, such as any of the engineered nucleic acids described herein.
- engineered erythrocytes can be engineered to comprise any of the engineered nucleic acids described herein. Erythrocytes can be engineered to possess any of the features of any of the engineered cells described herein.
- erythrocytes engineered to produce one or more of the chimeric proteins described herein In a particular aspect, provided herein are erythrocytes engineered to produce two or more of the chimeric proteins described herein. Also provided herein are engineered platelet cells. Platelet cells can be engineered to comprise any of the engineered nucleic acids described herein. Platelet cells can be engineered to possess any of the features of any of the engineered cells described herein. In a particular aspect, provided herein are platelet cells engineered to produce one or more of the chimeric proteins described herein. In a particular aspect, provided herein are platelet cells engineered to produce two or more of the chimeric proteins described herein.
- Bacterial cells can be engineered to comprise any of the engineered nucleic acids described herein. Bacterial cells can be engineered to possess any of the features of any of the engineered cells described herein. In a particular aspect, provided herein are bacterial cells engineered to produce two or more of the chimeric proteins described herein. Bacterial cells can be engineered to produce one or more mammalian- derived chimeric proteins. Bacterial cells can be engineered to produce two or more mammalian-derived chimeric proteins.
- Examples of bacterial cells include, but are not limited to, Clostridium beijerinckii, Clostridium sporogenes, Clostridium novyi, Escherichia coli, Pseudomonas aeruginosa, Listeria monocytogenes, Salmonella typhimurium, and Salmonella choleraesuis.
- An engineered cell can be a human cell.
- An engineered cell can be a human primary cell.
- An engineered primary cell can be a tumor infiltrating primary cell.
- An engineered primary cell can be a primary T cell.
- An engineered primary cell can be a hematopoietic stem cell (HSC).
- An engineered primary cell can be a natural killer (NK) cell.
- An engineered primary cell can be any somatic cell.
- An engineered primary cell can be a MSC.
- Human cells e.g., immune cells
- Human cells can be engineered to comprise any of the engineered nucleic acids described herein.
- Human cells e.g., immune cells
- Human cells can be engineered to possess any of the features of any of the engineered cells described herein.
- provided herein are human cells (e.g., immune cells) engineered to produce one or more of the chimeric proteins described herein.
- provided herein are human cells (e.g., immune cells) engineered to produce two or more of the chimeric proteins described herein.
- An engineered cell can be isolated from a subject (autologous), such as a subject known or suspected to have cancer.
- Cell isolation methods are known to those skilled in the art and include, but are not limited to, sorting techniques based on cell-surface marker expression, such as FACS sorting, positive isolation techniques, and negative isolation, magnetic isolation, and combinations thereof.
- An engineered cell can be allogenic with reference to the subject being administered a treatment. Allogenic modified cells can be HLA-matched to the subject being administered a treatment.
- An engineered cell can be a cultured cell, such as an ex vivo cultured cell.
- An engineered cell can be an ex vivo cultured cell, such as a primary cell isolated from a subject.
- a cultured cell can be cultured with one or more cytokines. Also provided herein are methods that include culturing the engineered cells of the present disclosure.
- compositions and methods for engineering cells to produce one or more proteins of interest or effector molecules e.g., the multicistronic expression systems that encode each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein).
- cells are engineered to produce proteins of interest or effector molecules through introduction (i.e., delivery) of polynucleotides encoding the one or more proteins of interest or effector molecules, e.g., the chimeric proteins described herein including the protein of interest or effector molecule, into the cell’s cytosol and/or nucleus.
- the polynucleotides encoding the one or more chimeric proteins can be any of the multicistronic expression systems that encode each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- Delivery methods include, but are not limited to, viral-mediated delivery, lipid-mediated transfection, nanoparticle delivery, electroporation, sonication, and cell membrane deformation by physical means.
- delivery method can depend on the specific cell type to be engineered.
- Viral-Mediated Delivery Viral vector-based delivery platforms can be used to engineer cells. In general, a viral vector-based delivery platform engineers a cell through introducing (i.e., delivering) into a host cell.
- a viral vector-based delivery platform can engineer a cell through introducing any of the engineered nucleic acids described herein (e.g., any of the multicistronic systems encoding each of each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein, and/or any of the expression cassettes described herein containing a promoter and an exogenous polynucleotide sequence encoding the chimeric proteins, oriented from N-terminal to C-terminal).
- a viral vector-based delivery platform can be a nucleic acid, and as such, an engineered nucleic acid can also encompass an engineered virally-derived nucleic acid.
- Such engineered virally-derived nucleic acids can also be referred to as recombinant viruses or engineered viruses.
- a viral vector-based delivery platform can encode more than one engineered nucleic acid, gene, or transgene within the same nucleic acid.
- an engineered virally- derived nucleic acid e.g., a recombinant virus or an engineered virus
- can encode one or more transgenes including, but not limited to, any of the engineered nucleic acids described herein that encode one or more of the chimeric proteins described herein.
- the one or more transgenes encoding the one or more chimeric proteins can be configured to express the one or more chimeric proteins and/or other protein of interest.
- a viral vector-based delivery platform can encode one or more genes in addition to the one or more transgenes (e.g., transgenes encoding the one or more chimeric proteins and/or other protein of interest), such as viral genes needed for viral infectivity and/or viral production (e.g., capsid proteins, envelope proteins, viral polymerases, viral transcriptases, etc.), referred to as cis-acting elements or genes.
- a viral vector-based delivery platform can comprise more than one viral vector, such as separate viral vectors encoding the engineered nucleic acids, genes, or transgenes described herein, and referred to as trans-acting elements or genes.
- a helper-dependent viral vector-based delivery platform can provide additional genes needed for viral infectivity and/or viral production on one or more additional separate vectors in addition to the vector encoding the one or more chimeric proteins and/or other protein of interest.
- One viral vector can deliver more than one engineered nucleic acids, such as one vector that delivers engineered nucleic acids that are configured to produce two or more chimeric proteins and/or other protein of interest. More than one viral vector can deliver more than one engineered nucleic acids, such as more than one vector that delivers one or more engineered nucleic acid configured to produce one or more chimeric proteins and/or other protein of interest.
- the number of viral vectors used can depend on the packaging capacity of the above mentioned viral vector-based vaccine platforms, and one skilled in the art can select the appropriate number of viral vectors.
- any of the viral vector-based systems can be used for the in vitro production of molecules, such as the chimeric proteins, effector molecules, and/or other protein of interest described herein, or used in vivo and ex vivo gene therapy procedures, e.g., for in vivo delivery of the engineered nucleic acids encoding one or more chimeric proteins and/or other protein of interest.
- Viral vector-based delivery platforms can be RNA-based viruses or DNA-based viruses.
- Exemplary viral vector-based delivery platforms include, but are not limited to, a herpes simplex virus, a adenovirus, a measles virus, an influenza virus, a Indiana vesiculovirus, a Newcastle disease virus, a vaccinia virus, a poliovirus, a myxoma virus, a reovirus, a mumps virus, a Maraba virus, a rabies virus, a rotavirus, a hepatitis virus, a rubella virus, a dengue virus, a chikungunya virus, a respiratory syncytial virus, a lymphocytic choriomeningitis virus, a morbillivirus, a lentivirus, a replicating retrovirus, a rhabdovirus, a Seneca Valley virus, a Sindbis virus, and any variant or derivative thereof.
- viral vector-based delivery platforms are described in the art, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616—629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev.
- infected cells i.e., an engineered cell
- infected cells can express the chimeric proteins and/or other protein of interest.
- Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
- Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)).
- BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)).
- a wide variety of other vectors useful for the introduction (i.e., delivery) of engineered nucleic acids e.g., Salmonella typhi vectors, and the like will be apparent to those skilled in the art from the description herein.
- the viral vector-based delivery platforms can be a virus that targets a cell, herein referred to as an oncolytic virus.
- oncolytic viruses include, but are not limited to, an oncolytic herpes simplex virus, an oncolytic adenovirus, an oncolytic measles virus, an oncolytic influenza virus, an oncolytic Indiana vesiculovirus, an oncolytic Newcastle disease virus, an oncolytic vaccinia virus, an oncolytic poliovirus, an oncolytic myxoma virus, an oncolytic reovirus, an oncolytic mumps virus, an oncolytic Maraba virus, an oncolytic rabies virus, an oncolytic rotavirus, an oncolytic hepatitis virus, an oncolytic rubella virus, an oncolytic dengue virus, an oncolytic chikungunya virus, an oncolytic respiratory syncytial virus, an oncolytic lymphocytic choriomeningitis virus, an oncolytic morbill
- any of the oncolytic viruses described herein can be a recombinant oncolytic virus comprising one more transgenes (e.g., an engineered nucleic acid) encoding one or more chimeric proteins and/or other protein of interest.
- the transgenes encoding the one or more chimeric proteins and/or other protein of interest can be configured to express the chimeric proteins and/or other protein of interest.
- the viral vector-based delivery platform can be retrovirus-based. In general, retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence.
- Retroviral-based delivery systems include, but are not limited to, those based upon murine leukemia, virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency vims (SIV), human immuno deficiency vims (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol.
- retroviral systems include the Phoenix retrovirus system.
- the viral vector-based delivery platform can be lentivirus-based.
- lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers.
- Lentiviral-based delivery platforms can be HIV-based, such as ViraPower systems (ThermoFisher) or pLenti systems (Cell Biolabs). Lentiviral-based delivery platforms can be SIV, or FIV-based. Other exemplary lentivirus-based delivery platforms are described in more detail in U.S. Pat. Nos. 7,311,907; 7,262,049; 7,250,299; 7,226,780; 7,220,578; 7,211,247; 7,160,721; 7,078,031; 7,070,993; 7,056,699; 6,955,919, each herein incorporated by reference for all purposes.
- the viral vector-based delivery platform can be adenovirus-based.
- adenoviral based vectors are capable of very high transduction efficiency in many cell types, do not require cell division, achieve high titer and levels of expression, and can be produced in large quantities in a relatively simple system.
- adenoviruses can be used for transient expression of a transgene within an infected cell since adenoviruses do not typically integrate into a host’s genome.
- Adenovirus-based delivery platforms are described in more detail in Li et al., Invest Opthalmol Vis Sci 35:25432549, 1994; Borras et al., Gene Ther 6:515524, 1999; Li and Davidson, PNAS 92:77007704, 1995; Sakamoto et al., H Gene Ther 5:10881097, 1999; WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655, each herein incorporated by reference for all purposes.
- Other exemplary adenovirus-based delivery platforms are described in more detail in U.S. Pat. Nos.
- the viral vector-based delivery platform can be adeno-associated virus (AAV)-based.
- Adeno-associated virus (“AAV”) vectors may be used to transduce cells with engineered nucleic acids (e.g., any of the engineered nucleic acids described herein).
- AAV systems can be used for the in vitro production of proteins of interest, such as the chimeric proteins described herein and/or effector molecules, or used in vivo and ex vivo gene therapy procedures, e.g., for in vivo delivery of the engineered nucleic acids encoding one or more chimeric proteins and/or other protein of interest (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. Nos.
- an AAV-based vector comprises a capsid protein having an amino acid sequence corresponding to any one of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV.Rh10, AAV11 and variants thereof.
- an AAV-based vector has a capsid protein having an amino acid sequence corresponding to AAV2.
- an AAV-based vector has a capsid protein having an amino acid sequence corresponding to AAV8.
- AAV vectors can be engineered to have any of the exogenous polynucleotide sequences encoding the membrane-cleavable chimeric proteins described herein having the formula: S – C – MT or MT – C – S.
- the viral vector-based delivery platform can be a virus-like particle (VLP) platform.
- VLPs are constructed by producing viral structural proteins and purifying resulting viral particles. Then, following purification, a cargo/payload (e.g., any of the engineered nucleic acids described herein) is encapsulated within the purified particle ex vivo. Accordingly, production of VLPs maintains separation of the nucleic acids encoding viral structural proteins and the nucleic acids encoding the cargo/payload.
- the viral structural proteins used in VLP production can be produced in a variety of expression systems, including mammalian, yeast, insect, bacterial, or in vivo translation expression systems.
- the purified viral particles can be denatured and reformed in the presence of the desired cargo to produce VLPs using methods known to those skilled in the art. Production of VLPs are described in more detail in Seow et al. (Mol Ther. 2009 May; 17(5): 767–777), herein incorporated by reference for all purposes.
- the viral vector-based delivery platform can be engineered to target (i.e., infect) a range of cells, target a narrow subset of cells, or target a specific cell.
- the envelope protein chosen for the viral vector-based delivery platform will determine the viral tropism.
- the virus used in the viral vector-based delivery platform can be pseudotyped to target a specific cell of interest.
- the viral vector-based delivery platform can be pantropic and infect a range of cells.
- pantropic viral vector-based delivery platforms can include the VSV-G envelope.
- the viral vector-based delivery platform can be amphotropic and infect mammalian cells. Accordingly, one skilled in the art can select the appropriate tropism, pseudotype, and/or envelope protein for targeting a desired cell type.
- Lipid Structure Delivery Systems Engineered nucleic acids (e.g., any of the engineered nucleic acids described herein) can be introduced into a cell using a lipid-mediated delivery system.
- a lipid-mediated delivery system uses a structure composed of an outer lipid membrane enveloping an internal compartment.
- lipid-based structures include, but are not limited to, a lipid-based nanoparticle, a liposome, a micelle, an exosome, a vesicle, an extracellular vesicle, a cell, or a tissue.
- Lipid structure delivery systems can deliver a cargo/payload (e.g., any of the engineered nucleic acids described herein) in vitro, in vivo, or ex vivo.
- a lipid-based nanoparticle can include, but is not limited to, a unilamellar liposome, a multilamellar liposome, and a lipid preparation.
- a “liposome” is a generic term encompassing in vitro preparations of lipid vehicles formed by enclosing a desired cargo, e.g., an engineered nucleic acid, such as any of the engineered nucleic acids described herein, within a lipid shell or a lipid aggregate.
- a desired cargo e.g., an engineered nucleic acid, such as any of the engineered nucleic acids described herein
- Liposomes may be characterized as having vesicular structures with a bilayer membrane, generally comprising a phospholipid, and an inner medium that generally comprises an aqueous composition.
- Liposomes include, but are not limited to, emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like.
- Liposomes can be unilamellar liposomes. Liposomes can be multilamellar liposomes. Liposomes can be multivesicular liposomes. Liposomes can be positively charged, negatively charged, or neutrally charged. In certain embodiments, the liposomes are neutral in charge. Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of a desired purpose, e.g., criteria for in vivo delivery, such as liposome size, acid lability and stability of the liposomes in the blood stream.
- a variety of methods are available for preparing liposomes, as described in, e.g., Szokan et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369, each herein incorporated by reference for all purposes.
- a multilamellar liposome is generated spontaneously when lipids comprising phospholipids are suspended in an excess of aqueous solution such that multiple lipid layers are separated by an aqueous medium. Water and dissolved solutes are entrapped in closed structures between the lipid bilayers following the lipid components undergoing self-rearrangement.
- a desired cargo e.g., a polypeptide, a nucleic acid, a small molecule drug, an engineered nucleic acid, such as any of the engineered nucleic acids described herein, a viral vector, a viral-based delivery system, etc.
- a desired cargo can be encapsulated in the aqueous interior of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the polypeptide/nucleic acid, interspersed within the lipid bilayer of a liposome, entrapped in a liposome, complexed with a liposome, or otherwise associated with the liposome such that it can be delivered to a target entity.
- Lipophilic molecules or molecules with lipophilic regions may also dissolve in or associate with the lipid bilayer.
- a liposome used according to the present embodiments can be made by different methods, as would be known to one of ordinary skill in the art. Preparations of liposomes are described in further detail in WO 2016/201323, International Applications PCT/US85/01161 and PCT/US89/05040, and U.S. Patents 4,728,578, 4,728,575, 4,737,323, 4,533,254, 4,162,282, 4,310,505, and 4,921,706; each herein incorporated by reference for all purposes.
- Liposomes can be cationic liposomes. Examples of cationic liposomes are described in more detail in U.S. Patent No.
- Exosomes are small membrane vesicles of endocytic origin that are released into the extracellular environment following fusion of multivesicular bodies with the plasma membrane.
- the size of exosomes ranges between 30 and 100 nm in diameter.
- Their surface consists of a lipid bilayer from the donor cell's cell membrane, and they contain cytosol from the cell that produced the exosome, and exhibit membrane proteins from the parental cell on the surface.
- Exosomes useful for the delivery of nucleic acids are known to those skilled in the art, e.g., the exosomes described in more detail in U.S. Pat. No.
- extracellular vesicle refers to a cell-derived vesicle comprising a membrane that encloses an internal space.
- extracellular vesicles comprise all membrane-bound vesicles that have a smaller diameter than the cell from which they are derived.
- extracellular vesicles range in diameter from 20 nm to 1000 nm, and can comprise various macromolecular cargo either within the internal space, displayed on the external surface of the extracellular vesicle, and/or spanning the membrane.
- the cargo can comprise nucleic acids (e.g., any of the engineered nucleic acids described herein), proteins, carbohydrates, lipids, small molecules, and/or combinations thereof.
- extracellular vesicles include apoptotic bodies, fragments of cells, vesicles derived from cells by direct or indirect manipulation (e.g., by serial extrusion or treatment with alkaline solutions), vesiculated organelles, and vesicles produced by living cells (e.g., by direct plasma membrane budding or fusion of the late endosome with the plasma membrane).
- Extracellular vesicles can be derived from a living or dead organism, explanted tissues or organs, and/or cultured cells.
- exosome refers to a cell-derived small (between 20-300 nm in diameter, more preferably 40-200 nm in diameter) vesicle comprising a membrane that encloses an internal space, and which is generated from the cell by direct plasma membrane budding or by fusion of the late endosome with the plasma membrane.
- the exosome comprises lipid or fatty acid and polypeptide and optionally comprises a payload (e.g., a therapeutic agent), a receiver (e.g., a targeting moiety), a polynucleotide (e.g., a nucleic acid, RNA, or DNA, such as any of the engineered nucleic acids described herein), a sugar (e.g., a simple sugar, polysaccharide, or glycan) or other molecules.
- the exosome can be derived from a producer cell, and isolated from the producer cell based on its size, density, biochemical parameters, or a combination thereof.
- An exosome is a species of extracellular vesicle.
- nanovesicle also referred to as a “microvesicle” refers to a cell-derived small (between 20-250 nm in diameter, more preferably 30-150 nm in diameter) vesicle comprising a membrane that encloses an internal space, and which is generated from the cell by direct or indirect manipulation such that said nanovesicle would not be produced by said producer cell without said manipulation.
- a nanovesicle is a sub-species of an extracellular vesicle.
- Appropriate manipulations of the producer cell include but are not limited to serial extrusion, treatment with alkaline solutions, sonication, or combinations thereof.
- the production of nanovesicles may, in some instances, result in the destruction of said producer cell.
- populations of nanovesicles are substantially free of vesicles that are derived from producer cells by way of direct budding from the plasma membrane or fusion of the late endosome with the plasma membrane.
- the nanovesicle comprises lipid or fatty acid and polypeptide, and optionally comprises a payload (e.g., a therapeutic agent), a receiver (e.g., a targeting moiety), a polynucleotide (e.g., a nucleic acid, RNA, or DNA, such as any of the engineered nucleic acids described herein), a sugar (e.g., a simple sugar, polysaccharide, or glycan) or other molecules.
- a payload e.g., a therapeutic agent
- a receiver e.g., a targeting moiety
- a polynucleotide e.g., a nucleic acid, RNA, or DNA, such as any of the engineered nucleic acids described herein
- a sugar e.g., a simple sugar, polysaccharide, or glycan
- the nanovesicle once it is derived from a producer cell according to said manipulation, may be isolated
- Lipid nanoparticles in general, are synthetic lipid structures that rely on the amphiphilic nature of lipids to form membranes and vesicle like structures (Riley 2017). In general, these vesicles deliver cargo/payloads, such as any of the engineered nucleic acids or viral systems described herein, by absorbing into the membrane of target cells and releasing the cargo into the cytosol. Lipids used in LNP formation can be cationic, anionic, or neutral. The lipids can be synthetic or naturally derived, and in some instances biodegradable.
- Lipids can include fats, cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, and fat soluble vitamins.
- Lipid compositions generally include defined mixtures of materials, such as the cationic, neutral, anionic, and amphipathic lipids. In some instances, specific lipids are included to prevent LNP aggregation, prevent lipid oxidation, or provide functional chemical groups that facilitate attachment of additional moieties. Lipid composition can influence overall LNP size and stability.
- the lipid composition comprises dilinoleylmethyl- 4- dimethylaminobutyrate (MC3) or MC3-like molecules.
- MC3 and MC3-like lipid compositions can be formulated to include one or more other lipids, such as a PEG or PEG-conjugated lipid, a sterol, or neutral lipids.
- LNPs can be further engineered or functionalized to facilitate targeting of specific cell types. Another consideration in LNP design is the balance between targeting efficiency and cytotoxicity.
- Micelles in general, are spherical synthetic lipid structures that are formed using single- chain lipids, where the single-chain lipid’s hydrophilic head forms an outer layer or membrane and the single-chain lipid’s hydrophobic tails form the micelle center. Micelles typically refer to lipid structures only containing a lipid mono-layer.
- Nucleic-acid vectors such as expression vectors
- exposed directly to serum can have several undesirable consequences, including degradation of the nucleic acid by serum nucleases or off-target stimulation of the immune system by the free nucleic acids.
- viral delivery systems exposed directly to serum can trigger an undesired immune response and/or neutralization of the viral delivery system. Therefore, encapsulation of an engineered nucleic acid and/or viral delivery system can be used to avoid degradation, while also avoiding potential off-target affects.
- an engineered nucleic acid and/or viral delivery system is fully encapsulated within the delivery vehicle, such as within the aqueous interior of an LNP.
- Encapsulation of an engineered nucleic acid and/or viral delivery system within an LNP can be carried out by techniques well-known to those skilled in the art, such as microfluidic mixing and droplet generation carried out on a microfluidic droplet generating device. Such devices include, but are not limited to, standard T-junction devices or flow-focusing devices.
- the desired lipid formulation such as MC3 or MC3-like containing compositions
- the droplet generating device can control the size range and size distribution of the LNPs produced.
- the LNP can have a size ranging from 1 to 1000 nanometers in diameter, e.g., 1, 10, 50, 100, 500, or 1000 nanometers.
- Nanoparticle Delivery Nanomaterials can be used to deliver engineered nucleic acids (e.g., any of the engineered nucleic acids described herein). Nanomaterial vehicles, importantly, can be made of non-immunogenic materials and generally avoid eliciting immunity to the delivery vector itself. These materials can include, but are not limited to, lipids (as previously described), inorganic nanomaterials, and other polymeric materials. Nanomaterial particles are described in more detail in Riley et al. (Recent Advances in Nanomaterials for Gene Delivery—A Review.
- Genomic Editing Systems can be used to engineer a host genome to encode an engineered nucleic acid, such as an engineered nucleic acid encoding one or more of the chimeric proteins (e.g., any of the multicistronic systems encoding each of (i) a membrane- cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein).
- a “genomic editing system” refers to any system for integrating an exogenous gene into a host cell’s genome.
- Genomic editing systems include, but are not limited to, a transposon system, a nuclease genomic editing system, and a viral vector-based delivery platform.
- a transposon system can be used to integrate an engineered nucleic acid, such as an engineered nucleic acid encoding one or more of the chimeric proteins (e.g., any of the multicistronic systems encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCARdescribed herein), into a host genome.
- Transposons generally comprise terminal inverted repeats (TIR) that flank a cargo/payload nucleic acid and a transposase.
- the transposon system can provide the transposon in cis or in trans with the TIR- flanked cargo.
- a transposon system can be a retrotransposon system or a DNA transposon system.
- transposon systems integrate a cargo/payload (e.g., an engineered nucleic acid) randomly into a host genome.
- Examples of transposon systems include systems using a transposon of the Tc1/mariner transposon superfamily, such as a Sleeping Beauty transposon system, described in more detail in Hudecek et al. (Crit Rev Biochem Mol Biol. 2017 Aug;52(4):355-380), and U.S. Patent Nos.
- transposon system includes a PiggyBac transposon system, described in more detail in U.S. Patent Nos. 6,218,185 and 6,962,810, each of which is herein incorporated by reference for all purposes.
- a nuclease genomic editing system can be used to engineer a host genome to encode an engineered nucleic acid, such as an engineered nucleic acid encoding one or more of the chimeric proteins (e.g., any of the multicistronic systems encoding each of (i) a membrane- cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein).
- the nuclease-mediated gene editing systems used to introduce an exogenous gene take advantage of a cell’s natural DNA repair mechanisms, particularly homologous recombination (HR) repair pathways.
- a cell can resolve the insult by using another DNA source that has identical, or substantially identical, sequences at both its 5’ and 3’ ends as a template during DNA synthesis to repair the lesion.
- HDR can use the other chromosome present in a cell as a template.
- exogenous polynucleotides are introduced into the cell to be used as a homologous recombination template (HRT or HR template).
- any additional exogenous sequence not originally found in the chromosome with the lesion that is included between the 5’ and 3’ complimentary ends within the HRT can be incorporated (i.e., “integrated”) into the given genomic locus during templated HDR.
- a typical HR template for a given genomic locus has a nucleotide sequence identical to a first region of an endogenous genomic target locus, a nucleotide sequence identical to a second region of the endogenous genomic target locus, and a nucleotide sequence encoding a cargo/payload nucleic acid (e.g., any of the engineered nucleic acids described herein, such as any of the engineered nucleic acids encoding one or more chimeric proteins (e.g., any of the multicistronic systems encoding each of each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCARdescribed herein)).
- a cargo/payload nucleic acid e.g., any of the engineered nucleic acids described herein, such as any of the engineered nucleic acids encoding one or more chimeric proteins (e.g., any of the multicistro
- a HR template can be linear.
- linear HR templates include, but are not limited to, a linearized plasmid vector, a ssDNA, a synthesized DNA, and a PCR amplified DNA.
- a HR template can be circular, such as a plasmid.
- a circular template can include a supercoiled template.
- the identical, or substantially identical, sequences found at the 5’ and 3’ ends of the HR template, with respect to the exogenous sequence to be introduced, are generally referred to as arms (HR arms).
- HR arms can be identical to regions of the endogenous genomic target locus (i.e., 100% identical).
- HR arms in some examples can be substantially identical to regions of the endogenous genomic target locus.
- HR arms can be identical as the efficiency of the HDR pathway may be impacted by HR arms having less than 100% identity.
- Each HR arm i . ., the 5’ and 3’ HR arms, can be the same size or different sizes.
- Each HR arm can each be greater than or equal to 50, 100, 200, 300, 400, or 500 bases in length.
- HR arms can, in general, be of any length, practical considerations, such as the impact of HR arm length and overall template size on overall editing efficiency, can also be taken into account.
- An HR arms can be identical, or substantially identical to, regions of an endogenous genomic target locus immediately adjacent to a cleavage site.
- Each HR arms can be identical to, or substantially identical to, regions of an endogenous genomic target locus immediately adjacent to a cleavage site.
- Each HR arms can be identical, or substantially identical to, regions of an endogenous genomic target locus within a certain distance of a cleavage site, such as 1 base-pair, less than or equal to 10 base-pairs, less than or equal to 50 base-pairs, or less than or equal to 100 base-pairs of each other.
- a nuclease genomic editing system can use a variety of nucleases to cut a target genomic locus, including, but not limited to, a Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) family nuclease or derivative thereof, a Transcription activator-like effector nuclease (TALEN) or derivative thereof, a zinc-finger nuclease (ZFN) or derivative thereof, and a homing endonuclease (HE) or derivative thereof.
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- TALEN Transcription activator-like effector nuclease
- ZFN zinc-finger nuclease
- HE homing endonuclease
- a CRISPR-mediated gene editing system can be used to engineer a host genome to encode an engineered nucleic acid, such as an engineered nucleic acid encoding one or more of the chimeric proteins (e.g., any of the multicistronic systems encoding each of (i) a membrane- cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein).
- CRISPR systems are described in more detail in M. Adli (“The CRISPR tool kit for genome editing and beyond” Nature Communications; volume 9 (2016), Article number: 1911), herein incorporated by reference for all that it teaches.
- a CRISPR-mediated gene editing system comprises a CRISPR-associated (Cas) nuclease and a RNA(s) that directs cleavage to a particular target sequence.
- An exemplary CRISPR-mediated gene editing system is the CRISPR/Cas9 systems comprised of a Cas9 nuclease and a RNA(s) that has a CRISPR RNA (crRNA) domain and a trans-activating CRISPR (tracrRNA) domain.
- the crRNA typically has two RNA domains: a guide RNA sequence (gRNA) that directs specificity through base-pair hybridization to a target sequence (“a defined nucleotide sequence”), e.g., a genomic sequence; and an RNA domain that hybridizes to a tracrRNA.
- a tracrRNA can interact with and thereby promote recruitment of a nuclease (e.g., Cas9) to a genomic locus.
- the crRNA and tracrRNA polynucleotides can be separate polynucleotides.
- the crRNA and tracrRNA polynucleotides can be a single polynucleotide, also referred to as a single guide RNA (sgRNA).
- Nucleases can include derivatives thereof, such as Cas9 functional mutants, e.g., a Cas9 “nickase” mutant that in general mediates cleavage of only a single strand of a defined nucleotide sequence as opposed to a complete double-stranded break typically produced by Cas9 enzymes.
- Cas9 functional mutants e.g., a Cas9 “nickase” mutant that in general mediates cleavage of only a single strand of a defined nucleotide sequence as opposed to a complete double-stranded break typically produced by Cas9 enzymes.
- the components of a CRISPR system interact with each other to form a Ribonucleoprotein (RNP) complex to mediate sequence specific cleavage.
- RNP Ribonucleoprotein
- each component can be separately produced and used to form the RNP complex.
- each component can be separately produced in vitro and contacted (i.e., “complexed”) with each other in vitro to form the RNP complex.
- the in vitro produced RNP can then be introduced (i.e., “delivered”) into a cell’s cytosol and/or nucleus, e.g., a T cell’s cytosol and/or nucleus.
- the in vitro produced RNP complexes can be delivered to a cell by a variety of means including, but not limited to, electroporation, lipid-mediated transfection, cell membrane deformation by physical means, lipid nanoparticles (LNP), virus like particles (VLP), and sonication.
- in vitro produced RNP complexes can be delivered to a cell using a Nucleofactor/Nucleofection® electroporation-based delivery system (Lonza®).
- Other electroporation systems include, but are not limited to, MaxCyte electroporation systems, Miltenyi CliniMACS electroporation systems, Neon electroporation systems, and BTX electroporation systems.
- CRISPR nucleases e.g., Cas9
- Cas9 can be produced in vitro (i.e., synthesized and purified) using a variety of protein production techniques known to those skilled in the art.
- CRISPR system RNAs e.g., an sgRNA
- an sgRNA can be produced in vitro (i.e., synthesized and purified) using a variety of RNA production techniques known to those skilled in the art, such as in vitro transcription or chemical synthesis.
- An in vitro produced RNP complex can be complexed at different ratios of nuclease to gRNA.
- An in vitro produced RNP complex can be also be used at different amounts in a CRISPR-mediated editing system. For example, depending on the number of cells desired to be edited, the total RNP amount added can be adjusted, such as a reduction in the amount of RNP complex added when editing a large number of cells in a reaction.
- each component e.g., Cas9 and an sgRNA
- each component can be separately encoded by a polynucleotide with each polynucleotide introduced into a cell together or separately.
- each component can be encoded by a single polynucleotide (i.e., a multi-promoter or multicistronic vector, see description of exemplary multicistronic systems below) and introduced into a cell.
- a single polynucleotide i.e., a multi-promoter or multicistronic vector, see description of exemplary multicistronic systems below
- an RNP complex can form within the cell and can then direct site-specific cleavage.
- RNPs can be engineered to have moieties that promote delivery of the RNP into the nucleus.
- a Cas9 nuclease can have a nuclear localization signal (NLS) domain such that if a Cas9 RNP complex is delivered into a cell’s cytosol or following translation of Cas9 and subsequent RNP formation, the NLS can promote further trafficking of a Cas9 RNP into the nucleus.
- the engineered cells described herein can be engineered using non-viral methods, e.g., the nuclease and/or CRISPR mediated gene editing systems described herein can be delivered to a cell using non-viral methods.
- the engineered cells described herein can be engineered using viral methods, e.g., the nuclease and/or CRISPR mediated gene editing systems described herein can be delivered to a cell using viral methods such as adenoviral, retroviral, lentiviral, or any of the other viral-based delivery methods described herein.
- viral methods such as adenoviral, retroviral, lentiviral, or any of the other viral-based delivery methods described herein.
- more than one CRISPR composition can be provided such that each separately target the same gene or general genomic locus at more than target nucleotide sequence.
- two separate CRISPR compositions can be provided to direct cleavage at two different target nucleotide sequences within a certain distance of each other.
- CRISPR compositions can be provided such that each separately target opposite strands of the same gene or general genomic locus.
- two separate CRISPR “nickase” compositions can be provided to direct cleavage at the same gene or general genomic locus at opposite strands.
- TALEN is an engineered site-specific nuclease, which is composed of the DNA- binding domain of TALE (transcription activator-like effectors) and the catalytic domain of restriction endonuclease Fokl.
- TALEN-based systems are described in more detail in U.S. Ser. No. 12/965,590; U.S. Pat. No. 8,450,471; U.S. Pat. No. 8,440,431; U.S. Pat. No. 8,440,432; U.S. Pat. No. 10,172,880; and U.S. Ser. No. 13/738,381, all of which are incorporated by reference herein in their entirety.
- Electroporation can be used to deliver polynucleotides to recipient entities. Electroporation is a method of internalizing a cargo/payload into a target cell or entity’s interior compartment through applying an electrical field to transiently permeabilize the outer membrane or shell of the target cell or entity. In general, the method involves placing cells or target entities between two electrodes in a solution containing a cargo of interest (e.g., any of the engineered nucleic acids described herein).
- a cargo of interest e.g., any of the engineered nucleic acids described herein
- the lipid membrane of the cells is then disrupted, i.e., permeabilized, by applying a transient set voltage that allows the cargo to enter the interior of the entity, such as the cytoplasm of the cell.
- a transient set voltage that allows the cargo to enter the interior of the entity, such as the cytoplasm of the cell.
- the cargo such as the cytoplasm of the cell.
- the cytoplasm of the cell In the example of cells, at least some, if not a majority, of the cells remain viable.
- Cells and other entities can be electroporated in vitro, in vivo, or ex vivo.
- Electroporation conditions e.g., number of cells, concentration of cargo, recovery conditions, voltage, time, capacitance, pulse type, pulse length, volume, cuvette length, electroporation solution composition, etc.
- Electroporation conditions vary depending on several factors including, but not limited to, the type of cell or other recipient entity, the cargo to be delivered, the efficiency of internalization desired, and the viability desired. Optimization of such criteria are within the scope of those skilled in the art.
- a variety devices and protocols can be used for electroporation. Examples include, but are not limited to, Neon ® Transfection System, MaxCyte ® Flow ElectroporationTM, Lonza ® NucleofectorTM systems, and Bio-Rad ® electroporation systems.
- engineered nucleic acids e.g., any of the engineered nucleic acids described herein
- a cell or other target recipient entity include, but are not limited to, sonication, gene gun, hydrodynamic injection, and cell membrane deformation by physical means.
- Compositions and methods for delivering engineered mRNAs in vivo, such as naked plasmids or mRNA, are described in detail in Kowalski et al. (Mol Ther. 2019 Apr 10; 27(4): 710–728) and Kaczmarek et al. (Genome Med. 2017; 9: 60.), each herein incorporated by reference for all purposes.
- compositions for delivering a cargo/payload can comprise nucleic acids (e.g., any of the engineered nucleic acids described herein, such as any of the multicistronic systems encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein), as described above.
- the cargo can comprise proteins, carbohydrates, lipids, small molecules, and/or combinations thereof.
- the cargo can be any of the chimeric proteins provided for herein (e.g., any of the multicistronic systems encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein).
- the cargo can be a combination of the chimeric proteins described herein, e.g., two or more of the chimeric proteins described herein.
- the cargo can be a combination of the chimeric protein described herein and another cargo of interest, such as another protein, carbohydrate, lipid, small molecule, and/or combination thereof.
- the delivery vehicle can comprise any composition suitable for delivering a cargo.
- the delivery vehicle can comprise any composition suitable for delivering a protein (e.g., any of the chimeric proteins described herein).
- the delivery vehicle can be any of the lipid structure delivery systems described herein.
- a delivery vehicle can be a lipid-based structure including, but not limited to, a lipid-based nanoparticle, a liposome, a micelle, an exosome, a vesicle, an extracellular vesicle, a cell, or a tissue.
- the delivery vehicle can be any of the nanoparticles described herein, such as nanoparticles comprising lipids (as previously described), inorganic nanomaterials, and other polymeric materials.
- the delivery vehicle can be capable of delivering the cargo to a cell, such as delivering any of the chimeric proteins described herein to a cell.
- the delivery vehicle can be capable of delivering the cargo to a cell, such as delivering any of the chimeric proteins described herein to a cell.
- the delivery vehicle can be configured to target a specific cell, such as configured with a re-directing antibody to target a specific cell.
- the delivery vehicle can be capable of delivering the cargo to a cell in vivo.
- the delivery vehicle can be capable of delivering the cargo to a tissue or tissue environment (e.g., a tumor microenvironment), such as delivering any of the chimeric proteins described herein to a tissue or tissue environment in vivo.
- Delivering a cargo can include secreting the cargo, such as secreting any of the chimeric proteins described herein. Accordingly, the delivery vehicle can be capable of secreting the cargo, such as secreting any of the chimeric proteins described herein.
- the delivery vehicle can be capable of secreting the cargo to a tissue or tissue environment (e.g., a tumor microenvironment), such as secreting any of the chimeric proteins described herein into a tissue or tissue environment.
- the delivery vehicle can be configured to target a specific tissue or tissue environment (e.g., a tumor microenvironment), such as configured with a re-directing antibody to target a specific tissue or tissue environment.
- Methods of Treatment include delivering, or administering, to a subject (e.g., a human subject) engineered cells as provided herein to produce in vivo at least one protein of interest produced by the engineered cells (e.g., any of the chimeric proteins provided for herein, such as any of the multicistronic systems encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein, or the secreted effector molecules provided for herein following protease cleavage of the chimeric protein).
- a subject e.g., a human subject
- engineered cells as provided herein to produce in vivo at least one protein of interest produced by the engineered cells
- any of the chimeric proteins provided for herein e.g., any of the chimeric proteins provided for herein, such as any of the multicistronic systems encoding each of (i) a membrane-clea
- methods that include delivering, or administering, to a subject (e.g., a human subject) engineered cells as provided herein to produce in vivo at least two proteins of interest, e.g., at least two of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein, produced by the engineered cells.
- a subject e.g., a human subject
- engineered cells as provided herein to produce in vivo at least two proteins of interest, e.g., at least two of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein, produced by the engineered cells.
- methods that include delivering, or administering, to a subject (e.g., a human subject) any of the delivery vehicles described herein, such as any of the delivery vehicles described herein comprising any of the proteins of interest described herein, e.g., any of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- a subject e.g., a human subject
- any of the delivery vehicles described herein such as any of the delivery vehicles described herein comprising any of the proteins of interest described herein, e.g., any of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- methods that include delivering, or administering, to a subject (e.g., a human subject) any of the delivery vehicles described herein, such as any of the delivery vehicles described herein comprising two or more proteins of, e.g., at least two of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- a subject e.g., a human subject
- any of the delivery vehicles described herein comprising two or more proteins of, e.g., at least two of the chimeric proteins provided for herein, such as each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- the engineered cells or delivery vehicles are administered via intravenous, intraperitoneal, intratracheal, subcutaneous, intratumoral, oral, anal, intranasal (e.g., packed in a delivery particle), or arterial (e.g., internal carotid artery) routes.
- the engineered cells or delivery vehicles may be administered systemically or locally (e.g., to a TME or via intratumoral administration).
- An engineered cell can be isolated from a subject, such as a subject known or suspected to have cancer.
- An engineered cell can be allogenic with reference to the subject being administered a treatment. Allogenic modified cells can be HLA- matched to the subject being administered a treatment.
- Delivery vehicles can be any of the lipid structure delivery systems described herein.
- Delivery vehicles can be any of the nanoparticles described herein.
- Engineered cells or delivery vehicles can be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
- engineered cells or delivery vehicles can be administered in combination with one or more IMiDs described herein.
- FDA-approved IMiDs can be administered in their approved fashion.
- engineered cells or delivery vehicles can be administered in combination with a checkpoint inhibitor therapy.
- checkpoint inhibitors include, but are not limited to, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-PD-L2 antibodies, anti- CTLA-4 antibodies, anti-LAG-3 antibodies, anti-TIM-3 antibodies, anti-TIGIT antibodies, anti- VISTA antibodies, anti-KIR antibodies, anti-B7-H3 antibodies, anti-B7-H4 antibodies, anti- HVEM antibodies, anti-BTLA antibodies, anti-GAL9 antibodies, anti-A2AR antibodies, anti- phosphatidylserine antibodies, anti-CD27 antibodies, anti-TNFa antibodies, anti-TREMl antibodies, and anti-TREM2 antibodies.
- Illustrative immune checkpoint inhibitors include pembrolizumab (anti-PD-1; MK-3475/Keytruda® - Merck), nivolumamb (anti-PD-1; Opdivo® - BMS), pidilizumab (anti-PD-1 antibody; CT-011 – Teva/CureTech), AMP224 (anti-PD-1; NCI), avelumab (anti-PD-L1; Bavencio® - Pfizer), durvalumab (anti-PD-L1; MEDI4736/Imfinzi® - Medimmune/AstraZeneca), atezolizumab (anti-PD-L1; Tecentriq® - Roche/Genentech), BMS- 936559 (anti-PD-L1 - BMS), tremelimumab (anti-CTLA-4; Medimmune/AstraZeneca), ipilimumab (anti-CTLA-4; Yervoy ®
- engineered cells or delivery vehicles can be administered in combination with TGFbeta inhibitors, VEGF inhibitors, or HPGE2.
- engineered cells or delivery vehicles can be administered in combination with an anti-CD40 antibody.
- Some methods comprise selecting a subject (or patient population) having a tumor (or cancer) and treating that subject with engineered cells or delivery vehicles that modulate tumor- mediated immunosuppressive mechanisms.
- the engineered cells or delivery vehicles of the present disclosure may be used, in some instances, to treat cancer, such as ovarian cancer. Other cancers are described herein.
- the engineered cells may be used to treat bladder tumors, brain tumors, breast tumors, cervical tumors, colorectal tumors, esophageal tumors, gliomas, kidney tumors, liver tumors, lung tumors, melanomas, ovarian tumors, pancreatic tumors, prostate tumors, skin tumors, thyroid tumors, and/or uterine tumors.
- the engineered cells or delivery vehicles of the present disclosure can be used to treat cancers with tumors located in the peritoneal space of a subject.
- the methods provided herein also include delivering a preparation of engineered cells or delivery vehicles.
- a preparation in some embodiments, is a substantially pure preparation, containing, for example, less than 5% (e.g., less than 4%, 3%, 2%, or 1%) of cells other than engineered cells.
- a preparation may comprise 1x10 5 cells/kg to 1x10 7 cells/kg cells.
- Preparation of engineered cells or delivery vehicles can include pharmaceutical compositions having one or more pharmaceutically acceptable carriers.
- preparations of engineered cells or delivery vehicles can include any of the engineered viruses, such as an engineered AAV virus, or any of the engineered viral vectors, such as AAV vector, described herein.
- the methods provided herein also include delivering a composition in vivo capable of producing the engineered cells described herein, e.g., capable of delivering any of the engineered nucleic acids described herein to a cell in vivo.
- compositions include any of the viral-mediated delivery platforms, any of the lipid structure delivery systems, any of the nanoparticle delivery systems, any of the genomic editing systems, or any of the other engineering delivery systems described herein capable of engineering a cell in vivo.
- the methods provided herein also include delivering a composition in vivo capable of producing any of the proteins of interest described herein, e.g., any of the multicistronic systems encoding each of (i) a membrane-cleavable chimeric protein; (ii) a bivalent aCAR; and (iii) an iCAR described herein.
- the methods provided herein also include delivering a composition in vivo capable of producing two or more of the proteins of interest described herein.
- Compositions capable of in vivo production of proteins of interest include, but are not limited to, any of the engineered nucleic acids described herein.
- Compositions capable of in vivo production proteins of interest can be a naked mRNA or a naked plasmid.
- Embodiment 1 A multicistronic expression system comprising an engineered nucleic acid comprising: (A) an exogenous polynucleotide encoding a membrane-cleavable chimeric protein, oriented from N-terminal to C-terminal, having the formula: 1. S – C – MT or MT – C – S ii. wherein iii. S comprises a secretable effector molecule, wherein the secretable effector molecule comprises IL-15, iv. C comprises a protease cleavage site, and v. MT comprises a cell membrane tethering domain, vi.
- an exogenous polynucleotide encoding an inhibitory chimeric antigen receptor comprising: (i) an antigen-binding domain specific for endomucin (EMCN); (ii) one or more intracellular inhibitory domains that inhibit an immune response; and (iii) one or more polypeptides selected from the group consisting of: a signal peptide, a transmembrane domain, a hinge domain, a spacer region, one or more peptide linkers, and combinations thereof; and (C) an exogenous polynucleotide encoding a bivalent activating chimeric antigen receptor (aCAR) comprising: (i) an antigen-binding domain specific for FLT3; (ii) an antigen-binding domain specific for CD33; (iii) one or more intracellular signaling domains that stimulate an immune
- aCAR bivalent activating chimeric antigen receptor
- Embodiment 2 The multicistronic expression system of embodiment 1, wherein the exogenous polynucleotides encoding each of the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR are linked together by a polynucleotide linker encoding a 2A ribosome skipping element.
- Embodiment 3 The multicistronic expression system of embodiment 2, wherein the 2A ribosome skipping element is selected from the group consisting of: a T2A ribosome skipping element, a E2A ribosome skipping element, a P2A ribosome skipping element, a F2A ribosome skipping element, ribosome skipping element fusions thereof, and combinations thereof.
- Embodiment 4 The multicistronic expression system of embodiment 3, wherein the ribosome skipping element fusion comprises an E2A/T2A ribosome skipping element.
- Embodiment 5 The multicistronic expression system of embodiment 4, wherein the E2A/T2A ribosome skipping element comprises the amino acid sequence QCTNYALLKLAGDVESNPGPGSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 221).
- Embodiment 6 The multicistronic expression system of embodiment 5, wherein the E2A/T2A ribosome skipping element is encoded by a polynucleotide sequence comprising the sequence CAGTGTACCAACTACGCCCTGCTGAAACTGGCCGGCGACGTGGAATCTAATC CTGGACCTGGATCTGGCGAGGGACGCGGGAGTCTACTGACGTGTGGAGACG TGGAGGAAAACCCTGGACCT (SEQ ID NO: 222) or the sequence CAGTGCACAAATTATGCACTGCTGAAGCTCGCCGGGGATGTCGAGTAACC CAGGACCTGGAAGCGGAGAAGGTCGTGGTAGTCTACTAACGTGTGGTGATGT AGAAGAAAATCCTGGACCT (SEQ ID NO: 223).
- Embodiment 7 The multicistronic expression system of any one of embodiments 1-7, wherein the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR are encoded in order from 5’ to 3’: (i) membrane-cleavable chimeric protein; (ii) bivalent aCAR; and (iii) iCAR.
- Embodiment 8 The multicistronic expression system of any one of embodiments 1-7, wherein the membrane-cleavable chimeric protein, the iCAR, and the bivalent aCAR are encoded in order from 5’ to 3’: (i) membrane-cleavable chimeric protein; (ii) iCAR; and (iii) bivalent aCAR.
- Embodiment 9 The multicistronic expression system of any one of embodiments 1-8, wherein the secretable effector molecule comprises a signal peptide or a signal-anchor sequence.
- Embodiment 10 The multicistronic expression system of embodiment 9, wherein the signal peptide comprises a native signal peptide native to the secretable effector molecule.
- Embodiment 11 The multicistronic expression system of embodiment 9, wherein the signal peptide comprises a non-native signal peptide or the signal-anchor sequence comprises a non-native signal-anchor sequence non-native to the secretable effector molecule.
- Embodiment 12 The multicistronic expression system of embodiment 11, wherein the non- native signal peptide or the non-native signal-anchor sequence is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV-G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL-8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TNFR2, GMCSF, and GM- CSFRa.
- the non- native signal peptide or the non-native signal-anchor sequence is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferas
- Embodiment 13 The multicistronic expression system of embodiment 11, wherein the non- native signal peptide comprises an IgE signal peptide.
- Embodiment 14 The multicistronic expression system of embodiment 13, wherein the IgE signal peptide comprises the amino acid sequence MDWTWILFLVAAATRVHS (SEQ ID NO: 228).
- Embodiment 15 The multicistronic expression system of embodiment 14, wherein the IgE signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACT CT (SEQ ID NO: 229).
- Embodiment 16 The multicistronic expression system of any one of embodiments 1-15, wherein the IL-15 comprises the amino acid sequence NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESG DASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN TS (SEQ ID NO: 224).
- Embodiment 17 The multicistronic expression system of embodiment 16, wherein the IL- 15 is encoded by a polynucleotide sequence comprising the sequence AATTGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCAG AGCATGCACATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGCT GCAAAGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCCT GGAAAGCGGCGACGCCAGCATCCACGATACCGTGGAAAATCTGATCATCCT GGCCAACAACAGCCTGTCCAGCAACGGCAATGTGACCGAGAGCGGCTGCAA AGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTT CGTCCACATCGTGCAGATGTTCATCAACACCTCA (SEQ ID NO: 225).
- Embodiment 18 The multicistronic expression system of any one of embodiments 1-17, wherein the protease cleavage site further comprises the N-terminal peptide linker, optionally selected from the group consisting of: SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS GGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGGSGGGGS; GGGGGSGGGGS; GGGGGGGSGGGGGGGS; GGGGSGGGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGSGGGGGGGGGGGSGGGGGGGS; GSTSGSGKPGSGEGSTKG; and EAAAKEAAAKEAAAK.
- the protease cleavage site further comprises the N-terminal peptide linker, optionally selected from the group consisting of: SGGGGS
- Embodiment 19 The multicistronic expression system of any one of embodiments 1-17, wherein the protease cleavage site further comprises the N-terminal peptide linker SGGGGSGGGGSG (SEQ ID NO: 230).
- Embodiment 20 The multicistronic expression system of any one of embodiments 1-19, wherein the protease cleavage site further comprises a C-terminal peptide linker, optionally selected from the group consisting of: SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS GGGSGGGSGGGS; GGGGS; GGGSGGGSGGGSGGGSGGGS; GGGGS; GGGGGSGGGSGGGSGGGSGGGS; GGGGS; GGGGGSGGGSGGGSGGGSGGGS; GGGGS; GGGGGSGGGSGGGSGGGS; GGGGS; GGGGGSGG
- Embodiment 21 The multicistronic expression system of any one of embodiments 1-19, wherein the protease cleavage site further comprises the C-terminal linker GGGSGGGGSGGGSLQ (SEQ ID NO: 231).
- Embodiment 22 The multicistronic expression system of any one of embodiments 1-21, wherein the protease cleavage site comprises a Tumor Necrosis Factor- ⁇ Converting Enzyme (TACE)-specific cleavage site.
- TACE Tumor Necrosis Factor- ⁇ Converting Enzyme
- Embodiment 23 The multicistronic expression system of embodiment 22, wherein the TACE-specific cleavage site comprises the amino acid sequence VTPEPIFSLI (SEQ ID NO: 191).
- Embodiment 24 The multicistronic expression system of embodiment 22, wherein the TACE-specific cleavage site comprises the amino acid sequence SGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGGSLQ (SEQ ID NO: 250).
- Embodiment 25 The multicistronic expression system of embodiment 24, wherein the TACE-specific cleavage site is encoded by a polynucleotide sequence comprising the sequence TCAGGCGGCGGTGGTAGTGGAGGCGGAGGCTCAGGCGTGACCCCTGAGCCT ATCTTCAGCCTGATCGGCGGAGGTTCCGGAGGTGGCGGTTCCGGCGGAGGAT CTCTTCAA (SEQ ID NO: 251).
- Embodiment 26 The multicistronic expression system of any one of embodiments 1-25, wherein the cell membrane tethering domain comprises a transmembrane domain selected from the group consisting of: PDGFR-beta, CD8, CD28, CD3zeta-chain, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, LNGFR, NKG2D, EpoR, TNFR2, LIR1, B7-1, and BTLA.
- Embodiment 27 The multicistronic expression system of any one of embodiments 1-25, wherein the cell membrane tethering domain comprises a B7-1 transmembrane domain.
- Embodiment 28 The multicistronic expression system of embodiment 27, wherein the B7- 1 transmembrane domain comprises the amino acid sequence LLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 204).
- Embodiment 29 The multicistronic expression system of embodiment 28, wherein the B7- 1 transmembrane domain is encoded by a polynucleotide sequence comprising the sequence TTGCTGCCTAGCTGGGCCATCACACTGATCTCCGTGAACGGCATCTTCGTGAT CTGCTGCCTGACCTACTGCTTCGCCCCTAGATGCAGAGAGCGGAGAAGAAAC GAGCGGCTGAGAAGAGAAAGCGTGCGGCCTGTG (SEQ ID NO: 252).
- Embodiment 30 The multicistronic expression system of any one of embodiments 1-29, wherein the membrane-cleavable chimeric protein, oriented from N-terminal to C- terminal, has the formula S – C – MT.
- Embodiment 31 The multicistronic expression system of embodiment 30, wherein the membrane-cleavable chimeric protein comprises the amino acid sequence MDWTWILFLVAAATRVHSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCK VTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE EKNIKEFLQSFVHIVQMFINTSSGGGGSGGGGSGVTPEPIFSLIGGGSGGGGSGGG SLQLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV (SEQ ID NO: 226).
- Embodiment 32 The multicistronic expression system of embodiment 31, wherein the membrane-cleavable chimeric protein is encoded by a polynucleotide sequence comprising the sequence ATGGACTGGACTTGGATACTCTTTCTGGTCGCTGCCGCCACACGGGTGCACT CTAATTGGGTCAACGTGATCAGCGACCTGAAGAAGATCGAGGACCTGATCCA GAGCATGCACATCGACGCCACACTGTACACCGAGTCCGATGTGCACCCTAGC TGCAAAGTGACCGCCATGAAGTGCTTTCTGCTGGAACTGCAAGTGATCAGCC TGGAAAGCGGCGACGCCAGCATCCACGATACCGTGGAAAATCTGATCATCCT GGCCAACAACAGCCTGTCCAGCAACGGCAATGTGACCGAGAGCGGCTGCAA AGAGTGCGAGGAACTGGAAGAGAAGAACATCAAAGAGTTTCTGCAGAGCTT CGTCCACATCGTGCAGAGCTT CGTCCACATCGGTGGGGTAGT GGAGGCGGAGGCGGGCT
- Embodiment 33 The multicistronic expression system of any one of embodiments 1-32, wherein the antigen-binding domain specific for EMCN comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: (A) the EMCN-VH comprises: (B) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of RYDMH (SEQ ID NO: 291), (C) a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of VIWGNGNTHYHSALKS (SEQ ID NO: 296), and (D) a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of RIKD (SEQ ID NO: 298), and (E) the EMCN-VL comprises: (F) a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of KSSQSLVASDENTYLN (SEQ ID NO: 299), (
- Embodiment 34 The multicistronic expression system of embodiment 33, wherein: (A) the EMCN-VH comprises the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLE WVSVIWGNGNTHYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAV YYCTLRIKDWGQGTMVTVSS (SEQ ID NO: 302); and (B) the EMCN-VL comprises the amino acid sequence DVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLNWFQQRPGQS PRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQG IHLPWTFGQGTKLEIK (SEQ ID NO: 310).
- Embodiment 35 The multicistronic expression system of embodiment 33 or 34, wherein the EMCN-VH and the EMCN-VL are separated by a peptide linker.
- Embodiment 36 The multicistronic expression system of embodiment 35, wherein the antigen-binding domain specific for EMCN comprises the structure VH-L-VL or VL-L- VH, wherein L is the peptide linker.
- Embodiment 37 The multicistronic expression system of embodiment 36, wherein the peptide linker comprises the amino acid sequence SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS; GGSGGSGGSGGS; GGSGGSGGSGGSGGS; GGGS GGGSGGGSGGGS; GGGGS; GGGGSGGGGS; GGGGSGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGGSGGGGSGGGGGGGS; GGGGSGGGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GGGGSGGGGGGSGGGGS; GSTSGSGKPGSGEGSTKG; or EAAAKEAAAKEAAAK.
- the peptide linker comprises the amino acid sequence SGGGGSGGGGSG; GGGSGGGGSGGGSLQ; GGS; GGSGGS; GGSGGSGGS
- Embodiment 38 The multicistronic expression system of embodiment 36, wherein the peptide linker comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 244).
- Embodiment 39 The multicistronic expression system of embodiment 38, wherein the peptide linker is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGCGGAGGAAGTGGCGGAGGCGGTTCT (SEQ ID NO: 253).
- Embodiment 40 The multicistronic expression system of any one of embodiments 1-39, wherein the antigen-binding domain specific for EMCN comprises the structure VH-L- VL and comprises the amino acid sequence EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYDMHWVRQAPGKGLEWVSVIW GNGNTHYHSALKSRFTISRDNSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQG TMVTVSSGGGGSGGGGSGGGGSDVVMTQSPLSLPVTLGQPASISCKSSQSLVAS DENTYLNWFQQRPGQSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCLQGIHLPWTFGQGTKLEIK (SEQ ID NO: 311).
- Embodiment 41 The multicistronic expression system of embodiment 40, wherein the antigen-binding domain specific for EMCN is encoded by a polynucleotide sequence comprising the sequence GAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCTGGCGGATCTC TGAGACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGATACGATATGCA CTGGGTCCGACAGGCCCCTGGCAAAGGACTTGAATGGGTGTCCGTGATCTGG GGCAACGGCAACACACACTACCACAGCGCCCTGAAGTCCCGGTTCACCATCT CCAGAGACAGCAAGAACACCCTGTACCTGCAGATGAACAGCCTGAGAG CCGAGGACACCGCCGTGTACTACTGCACCCTGAGAATCAAGGATTGGGGCCA GGGCACCATGGTCACCGTTTCTTCTGGAGGCGGAGGATCTGGTGGCGGAGGA AGTGGCGGAGGCGGTTCTGGCGTGGTCATGACACAGAGCCCTCTGAGCCTGC CT
- Embodiment 42 The multicistronic expression system of any one of embodiments 1-41, wherein the intracellular inhibitory domain comprises a LIR1 intracellular inhibitory domain.
- Embodiment 43 The multicistronic expression system of embodiment 42, wherein the LIR1 intracellular inhibitory domain comprises the amino acid sequence LRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYA AVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDT KDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSI YATLAIH (SEQ ID NO: 285).
- Embodiment 44 The multicistronic expression system of embodiment 43, wherein the LIR1 intracellular inhibitory domain is encoded by a polynucleotide sequence comprising the sequence CTGCGGCACAGAAGGCAGGGCAAGCACTGGACAAGCACCCAGAGAAAGGCC GACTTTCAGCATCCTGCTGGCGCCGTTGGACCTGAGCCTACAGATAGAGGAC TGCAGTGGCGGTCTAGCCCTGCCGCTGATGCCCAAGAGGAAAATCTTTACGC CGCCGTGAAGCACACCCAGCCTGAGGATGGCGTGGAAATGGACACCAGATC TCCCCACGATGAGGACCCTCAGGCCGTGACATACGCAGAAGTGAAGCACTCC AGACCTCGGAGAGAGATGGCAAGCCCTCCATCTCCTCTGAGCGGCGAGTTCC TGGACACCAAAGACAGACAGGCCGAAGAGGACAGACAGATGGATACCGAA GCCGCCGCTTCTGAAGCCACAGGATGTGACATATGCCCAGCTGCATAGCC TG
- Embodiment 45 The multicistronic expression system of any one of embodiments 1-44, wherein the signal peptide is present in the iCAR.
- Embodiment 46 The multicistronic expression system of embodiment 45, wherein the signal peptide of the iCAR comprises a native signal peptide native or a non-native signal peptide, optionally wherein the non-native signal peptide or the non-native signal- anchor sequence is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL- 2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV-G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL- 8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TN
- Embodiment 47 The multicistronic expression system of embodiment 45, wherein the signal peptide of the iCAR comprises a CD8 signal peptide.
- Embodiment 48 The multicistronic expression system of embodiment 47, wherein the CD8 signal peptide comprises the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO: 137).
- Embodiment 49 The multicistronic expression system of embodiment 48, wherein the CD8 signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGC TGCTAGACCA (SEQ ID NO: 416).
- Embodiment 50 The multicistronic expression system of any one of embodiments 1-49, wherein the hinge domain is present in the iCAR comprises.
- Embodiment 51 The multicistronic expression system of embodiment 50, wherein the hinge domain of the iCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- Embodiment 52 The multicistronic expression system of embodiment 50, wherein the hinge domain of the iCAR comprises a LIR1 hinge.
- Embodiment 53 The multicistronic expression system of embodiment 52, wherein the LIR1 hinge comprises the amino acid sequence HPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 417).
- Embodiment 54 The multicistronic expression system of embodiment 53, wherein the LIR1 hinge comprises is encoded by a polynucleotide sequence comprising the sequence CACCCATCCGATCCTCTCGAGCTGGTGGTTTCTGGACCTTCTGGCGGCCCTAG CAGCCCTACAACAGGACCTACAAGCACAAGCGGCCCTGAGGACCAACCTCT GACACCAACAGGCAGCGATCCTCAGTCTGGACTGGGGAGACATCTGGGCGTT (SEQ ID NO: 418).
- Embodiment 55 The multicistronic expression system of embodiment 50, wherein the hinge domain of the iCAR comprises a CD8 hinge.
- Embodiment 56 The multicistronic expression system of embodiment 55, wherein the CD8 hinge comprises the amino acid sequence TTTPAPRPPTPAPTIALQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 271).
- Embodiment 57 The multicistronic expression system of embodiment 56, wherein the CD8 hinge comprises is encoded by a polynucleotide sequence comprising the sequence ACAACAACACCCGCACCTCGGCCTCCAACTCCAGCTCCAACAATTGCACTGC AACCCCTGAGTCTGAGGCCCGAGGCCTGTAGGCCAGCAGCTGGCGGAGCTGT TCACACTAGAGGCCTGGACTTTGCCTGTGAC (SEQ ID NO: 283).
- Embodiment 58 The multicistronic expression system of any one of embodiments 1-57, wherein the transmembrane domain of the iCAR is present.
- Embodiment 59 The multicistronic expression system of embodiment 58, wherein the transmembrane domain of the iCAR comprises a transmembrane domain selected from the group consisting of: PDGFR-beta, CD8, CD28, CD3zeta-chain, CD4, 4-1BB, OX40, ICOS, CTLA-4, PD-1, LAG-3, 2B4, LNGFR, NKG2D, EpoR, TNFR2, B7-1, LIR1, and BTLA.
- Embodiment 60 The multicistronic expression system of embodiment 58, wherein the transmembrane domain of the iCAR comprises a LIR1 transmembrane domain.
- Embodiment 61 The multicistronic expression system of embodiment 60, wherein the LIR1 transmembrane domain comprises the amino acid sequence VIGILVAVILLLLLLLLLFLI (SEQ ID NO: 259).
- Embodiment 62 The multicistronic expression system of embodiment 61, wherein the LIR1 transmembrane domain is encoded by a polynucleotide sequence comprising the sequence GTGATCGGCATTCTGGTCGCCGTGATCCTGCTCCTGTTGCTCCTGCTGCTTCT GTTCCTGATC (SEQ ID NO: 260).
- Embodiment 63 The multicistronic expression system of any one of embodiments 1-62, wherein the iCAR comprises the amino acid sequence (A) MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASG FTFSRYDMHWVRQAPGKGLEWVSVIWGNGNTHYHSALKSRFTISRD NSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSSGGGGSG GGGSGGGGSDVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLN WFQQRPGQSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCLQGIHLPWTFGQGTKLEIKHPSDPLELVVSGPSGGPSSPTTG PTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLI LRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQ
- Embodiment 64 The multicistronic expression system of embodiment 63, wherein the iCAR is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGC TGCTAGACCAGAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCT GGCGGATCTCTGAGACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGAT ACGATATGCACTGGGTCCGACAGGCCCCTGGCAAAGGACTTGAATGGGTGTC CGTGATCTGGGGCAACGGCAACACACACTACCACAGCGCCCTGAAGTCCCG GTTCACCATCTCCAGAGACAACAGCAAGAACACCCTGTACCTGCAGATGAAC AGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGCACCCTGAGAATCAAG GATTGGGGCCAGGGCACCATGGTCACCGTTTCTTCTGGAGGCGGAGGATCTG GTGGCGGAGGAAGTGGC
- Embodiment 65 The multicistronic expression system of any one of embodiments 1-62, wherein the iCAR comprises the amino acid sequence (A) MALPVTALLLPLALLLHAARPEVQLVESGGGLVQPGGSLRLSCAASG FTFSRYDMHWVRQAPGKGLEWVSVIWGNGNTHYHSALKSRFTISRD NSKNTLYLQMNSLRAEDTAVYYCTLRIKDWGQGTMVTVSSGGGGSG GGGSGGGGSDVVMTQSPLSLPVTLGQPASISCKSSQSLVASDENTYLN WFQQRPGQSPRRLIYQVSKLDSGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCLQGIHLPWTFGQGTKLEIKTTTPAPRPPTPAPTIALQPLSLRP EACRPAAGGAVHTRGLDFACDVIGILVAVILLLLLLLLLFLILRHRRQG KHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLY
- Embodiment 66 The multicistronic expression system of embodiment 65, wherein the iCAR is encoded by a polynucleotide sequence comprising the sequence ATGGCTCTGCCCGTGACAGCTTTGCTGCTGCCTTTGGCACTGCTGCTGCATGC TGCTAGACCAGAGGTGCAGCTGGTTGAATCTGGCGGAGGACTGGTTCAGCCT GGCGGATCTCTGAGACTGTCTTGTGCCGCCAGCGGCTTCACCTTCAGCAGAT ACGATATGCACTGGGTCCGACAGGCCCCTGGCAAAGGACTTGAATGGGTGTC CGTGATCTGGGGCAACGGCAACACACACTACCACAGCGCCCTGAAGTCCCG GTTCACCATCTCCAGAGACAACAGCAAGAACACCCTGTACCTGCAGATGAAC AGCCTGAGAGCCGAGGACACCGCCGTGTACTACTGCACCCTGAGAATCAAG GATTGGGGCCAGGGCACCATGGTCACCGTTTCTTCTGGAGGCGGAGGATCTG GTGGCGGAGGAAGTGGC
- Embodiment 67 The multicistronic expression system of any one of embodiments 1-66, wherein the antigen-binding domain specific for FLT3 comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: (A) the FLT3-VH comprises: (B) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of GGTFSSYAIS (SEQ ID NO: 360), (C) a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of GIIPIFGTANYAQKFQG (SEQ ID NO: 361), and (D) a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of FALFGFREQAFDI (SEQ ID NO: 362), and (E) the FLT3-VL comprises: (F) a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASQSISSYLN (SEQ
- Embodiment 68 The multicistronic expression system of embodiment 67, wherein: (A) the FLT3-VH comprises the amino acid sequence EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVY YCATFALFGFREQAFDIWGQGTTVTVSS (SEQ ID NO: 315); and (B) the FLT3-VL comprises the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIY AASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDLATYYCQQSYSTPFTF GPGTKVDIK (SEQ ID NO: 316).
- Embodiment 69 The multicistronic expression system of any one of embodiments 1-68, wherein the antigen-binding domain specific for CD33 comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein: (A) the CD33-VH comprises: (B) a heavy chain complementarity determining region 1 (CDR-H1) having the amino acid sequence of DYNMH (SEQ ID NO: 402), (C) a heavy chain complementarity determining region 2 (CDR-H2) having the amino acid sequence of YIYPYNGGTGYNQKFKSKA (SEQ ID NO: 403), and (D) a heavy chain complementarity determining region 3 (CDR-H3) having the amino acid sequence of GRPAMDYWGQ (SEQ ID NO: 404), and (E) the CD33-VL comprises: (F) a light chain complementarity determining region 1 (CDR-L1) having the amino acid sequence of RASESVDNYGISFMN (SEQ
- Embodiment 70 The multicistronic expression system of embodiment 69, wherein: (A) the CD33-VH comprises the amino acid sequence QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGL EWIGYIYPYNGGTGYNQKFKSKATITADESTNTAYMELSSLRSEDTA VYYCARGRPAMDYWGQGTLVTVSS (SEQ ID NO: 329); and (B) the CD33-VL comprises the amino acid sequence DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAP KLLIYAASNQGSGVPSRFSGSGSGTDFTLTISSLQPDDFATYYCQQSKE VPWTFGQGTKVEIK (SEQ ID NO: 330).
- Embodiment 71 The multicistronic expression system of any one of embodiments 67-70, wherein the FLT3-VH, the FLT3-VL, the CD33-VH, and the CD33-VL are separated by peptide linkers.
- Embodiment 72 The multicistronic expression system of embodiment 71, wherein the aCAR antigen binding domains comprises the structure (FLT3-VH) – L1 – (CD33-VH) – L2 – (CD33-VL) – L3 – (FLT3-VL), wherein L1, L2, and L3 are a first, a second, and a third peptide linker, respectively.
- Embodiment 73 The multicistronic expression system of embodiment 72, wherein the L1, L2, and/or L3 are each independently selected from the group consisting of: SEQ ID Nos 230 – 248.
- Embodiment 74 The multicistronic expression system of embodiment 72, wherein the L1 peptide linker is the amino acid sequence GGGGS (SEQ ID NO: 242) or GGGGSGGGGS (SEQ ID NO: 243).
- Embodiment 75 The multicistronic expression system of embodiment 73, wherein the L1 peptide linker GGGGS (SEQ ID NO: 242) is encoded by a polynucleotide sequence comprising the sequence GGCGGCGGTGGCTCT (SEQ ID NO: 254) or the L1 peptide linker GGGGSGGGGS (SEQ ID NO: 243) is encoded by a polynucleotide sequence comprising the sequence GGAGGCGGAGGATCTGGTGGTGGTGGATCT (SEQ ID NO: 256).
- Embodiment 76 The multicistronic expression system of any one of embodiments 72-75, wherein the L2 peptide linker is the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO: 247).
- Embodiment 77 The multicistronic expression system of embodiment 76, wherein the L2 peptide linker is encoded by a polynucleotide sequence comprising the sequence GGCTCTACATCTGGCTCTGGCAAACCTGGAAGCGGCGAGGGATCTACCAAGG GC (SEQ ID NO: 249).
- Embodiment 78 The multicistronic expression system of any one of embodiments 72-75, wherein the L2 peptide linker is the amino acid sequence GGGGSGGGGS (SEQ ID NO: 243).
- Embodiment 79 The multicistronic expression system of embodiment 76, wherein the L2 peptide linker is encoded by a polynucleotide sequence comprising the sequence GGTGGCGGAGGAAGTGGCGGCGGAGGCTCT (SEQ ID NO: 257).
- Embodiment 80 The multicistronic expression system of any one of embodiments 72-79, wherein the L3 peptide linker is the amino acid sequence GGGGS (SEQ ID NO: 242)or GGGGSGGGGS (SEQ ID NO: 243).
- Embodiment 81 The multicistronic expression system of embodiment 80, wherein the L3 peptide linker GGGGS (SEQ ID NO: 242) is encoded by a polynucleotide sequence comprising the sequence GGTGGCGGCGGATCC (SEQ ID NO: 255) or the L3 peptide linker GGGGSGGGGS (SEQ ID NO: 243) is encoded by a polynucleotide sequence comprising the sequence GGCGGTGGCGGATCTGGCGGAGGTGGCAGT (SEQ ID NO: 258).
- Embodiment 82 The multicistronic expression system of any one of embodiments 1-81, wherein the aCAR intracellular signaling domains that stimulate an immune response is selected from the group consisting of: CD3-zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD278, Fc ⁇ RI, DAP10, DAP12, CD66d, CD97, CD2, ICOS, CD27, CD154, CD8, OX40, 4-1BB, CD28, ZAP40, CD30, GITR, HVEM, DAP10, DAP12, MyD88, 2B4, CD40, PD-1, LFA-1, CD7, LIGHT, NKG2C, B7-H3, an MHC class I molecule, a TNF receptor protein, an Immunoglobulin- like protein, a cytokine receptor, an integrin, a SLAM protein, an activ
- Embodiment 83 The multicistronic expression system of any one of embodiments 1-81, wherein the aCAR intracellular signaling domains that stimulate an immune response comprise a CD28 co-stimulatory domain and a CD3 ⁇ signaling domain.
- Embodiment 84 The multicistronic expression system of embodiment 83, wherein the CD28 co-stimulatory domain comprises the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 287).
- Embodiment 85 The multicistronic expression system of embodiment 84, wherein the CD28 co-stimulatory domain is encoded by a polynucleotide sequence comprising the sequence AGAAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCT AGACGGCCCGGACCTACCAGAAAGCACTACCAGCCTTACGCTCCTCCTAGAG ATTTCGCCGCCTACCGGTCC (SEQ ID NO: 288).
- Embodiment 86 The multicistronic expression system of embodiment 83, wherein the CD3 ⁇ signaling domain comprises the amino acid sequence RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR (SEQ ID NO: 289).
- Embodiment 87 The multicistronic expression system of embodiment 86, wherein the CD3 ⁇ signaling domain is encoded by a polynucleotide sequence comprising the sequence AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAG AACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTT TGGACAAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGG AAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCG GAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCCGGAGGGGCAAGGG GCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGAC GCCCTTCACATGCAGGCCCTGCCCCCTCGC (SEQ ID NO: 290).
- Embodiment 88 The multicistronic expression system of any one of embodiments 1-87, wherein the hinge domain of the aCAR is present.
- Embodiment 89 The multicistronic expression system of embodiment 88, wherein the hinge domain of the aCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- Embodiment 90 The multicistronic expression system of embodiment 88, wherein the hinge domain of the aCAR comprises a CD8 hinge.
- Embodiment 91 The multicistronic expression system of embodiment 90, wherein the CD8 hinge comprises the amino acid sequence ALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV HTRGLDFACD (SEQ ID NO: 272).
- Embodiment 92 The multicistronic expression system of embodiment 91, wherein the CD8 hinge comprises is encoded by a polynucleotide sequence comprising the sequence GCCCTGAGCAACAGCATCATGTACTTCAGCCACTTCGTGCCCGTGTTTCTGCC CGCCAAGCCTACAACAACCCCTGCTCCTAGACCACCTACACCAGCTCCTACA ATCGCCAGCCAGCCTCTGTCTCTGAGGCCCGAAGCTTGTAGACCAGCTGCTG GCGGAGCCGTGCATACAAGAGGACTGGATTTTGCCTGCGAC (SEQ ID NO: 284).
- Embodiment 93 The multicistronic expression system of any one of embodiments 1-92, wherein the transmembrane domain of the aCAR is present.
- Embodiment 94 The multicistronic expression system of embodiment 93, wherein the transmembrane domain of the aCAR is selected from the group consisting of a human Ig (immunoglobulin) hinge, an IgG4 hinge, an IgG2 hinge, a CD8a hinge, or an IgD hinge, a KIR2DS2 hinge, an LNGFR hinge, a LIR1 hinge, a PDGFR-beta extracellular linker, and combinations thereof.
- Embodiment 95 The multicistronic expression system of embodiment 93, wherein the transmembrane domain of the aCAR comprises a CD8 hinge.
- Embodiment 96 The multicistronic expression system of embodiment 95, wherein the CD8 transmembrane comprises the amino acid sequence IYIWAPLAGTCGVLLLSLVITLYCNHR (SEQ ID NO: 206).
- Embodiment 97 The multicistronic expression system of embodiment 96, wherein the CD8 transmembrane comprises is encoded by a polynucleotide sequence comprising the sequence ATCTATATCTGGGCCCCTCTGGCTGGCACATGCGGAGTTCTGCTGCTCAGCCT GGTCATCACCCTGTACTGCAACCACAGA (SEQ ID NO: 261).
- Embodiment 98 The multicistronic expression system of any one of embodiments 1-97, wherein the aCAR signal peptide of the aCAR is present.
- Embodiment 99 The multicistronic expression system of embodiment 98, wherein the signal peptide of the aCAR is selected from the group consisting of: IgE, IL-12, IL-2, optimized IL-2, trypsiongen-2, Gaussia luciferase, CD5, human IgKVII, murine IgKVII, VSV-G, prolactin, serum albumin preprotein, azurocidin preprotein, osteonectin, CD33, IL-6, IL-8, CCL2, TIMP2, VEGFB, osteoprotegerin, serpin E1, GROalpha, CXCL12, IL-21, CD8, NKG2D, TNFR2, GMCSF, and GM-CSFRa.
- Embodiment 100 The multicistronic expression system of embodiment 98, wherein the signal peptide of the aCAR comprises a GM-CSFRa signal peptide.
- Embodiment 101 The multicistronic expression system of embodiment 100, wherein the GM-CSFRa signal peptide comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIP (SEQ ID NO: 423).
- Embodiment 102 The multicistronic expression system of embodiment 101, wherein the GM-CSFRa signal peptide is encoded by a polynucleotide sequence comprising the sequence ATGCTGCTGCTGGTTACATCTCTGCTGCTGTGCGAGCTGCCCCATCCTGCCTT TCTGCTTATTCCT (SEQ ID NO: 424).
- Embodiment 103 The multicistronic expression system of any one of embodiments 1-103, wherein the aCAR comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAI SWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRS EDTAVYYCATFALFGFREQAFDIWGQGTTVTVSSGGGGSQVQLVQSGAEVKKP GSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYNQKFKS KATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSSGST SGSGKPGSGEGSTKGDIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWF QQKPGKAPKLLIYAASNQGSGVPSRFSGSGSGTDFTLTISSLQPDD
- Embodiment 104 The multicistronic expression system of any one of embodiments 1-103, wherein the aCAR comprises the amino acid sequence MLLLVTSLLLCELPHPAFLLIPEVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAI SWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRS EDTAVYYCATFALFGFREQAFDIWGQGTTVTVSSGGGGSGGGGSQVQLVQSGA EVKKPGSSVKVSCKASGYTFTDYNMHWVRQAPGQGLEWIGYIYPYNGGTGYN QKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTV SSGGGGSGGSDIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQ KPGKAPKLLIYAASNQGSGVPSRFSGSGSGTDFTLTISSLQPDDFATYYC
- Embodiment 105 An expression vector comprising the multicistronic expression system of any one of embodiments 1-104.
- Embodiment 106 The expression vector of embodiment 105, wherein the expression vector comprises the polynucleotide of SEQ ID NO: 425, SEQ ID NO: 426, SEQ ID NO: 427, SEQ ID NO: 428, SEQ ID NO: 429, SEQ ID NO: 433, or SEQ ID NO: 432.
- Embodiment 107 An isolated cell comprising the multicistronic expression system of any one of embodiments 1-104 or the expression vector of embodiment 105 or 106.
- Embodiment 108 The isolated cell of embodiment 107, wherein the cell comprises an immune cell.
- Embodiment 109 The isolated cell of embodiment 107, wherein the cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a Natural Killer T (NKT) cell, a myeloid cell, a macrophage, a human embryonic stem cell (ESC), an ESC-derived cell, a pluripotent stem cell, and induced pluripotent stem cell (iPSC), and an iPSC-derived cell.
- NK Natural Killer
- CTL cytotoxic T lymphocyte
- NKT Natural Killer T
- myeloid cell a macrophage
- ESC human embryonic stem cell
- ESC-derived cell a pluripotent stem cell
- iPSC induced pluripotent stem cell
- iPSC induced pluripotent stem cell
- Embodiment 111 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 425, SEQ ID NO: 426, SEQ ID NO: 427, SEQ ID NO: 428, SEQ ID NO: 429, SEQ ID NO: 433, or SEQ ID NO: 432.
- Embodiment 112 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 425.
- Embodiment 113 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 426.
- Embodiment 114 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 427.
- Embodiment 115 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 428.
- Embodiment 116 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 429.
- Embodiment 117 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 432.
- Embodiment 118 A method of treating a subject in need thereof, the method comprising administering a therapeutically effective dose of any of the isolated cells of any one of embodiments 107-110 or the polynucleotide of any one of embodiments 111-117, and 124.
- Embodiment 119 A method of treating a subject with cancer, the method comprising administering to the subject an immunotherapy comprising of any of the isolated cells of any one of embodiments 107-110 or the polynucleotide of any one of embodiments 111- 117, and 124.
- Embodiment 120 A method of stimulating a cell-mediated immune response to a tumor cell in a subject, the method comprising administering to a subject having a tumor a therapeutically effective dose of any of the isolated cells of any one of embodiments 107-110 or the polynucleotide of any one of embodiments 111-117, and 124.
- Embodiment 121 The method of any one of embodiments 111-120, wherein the isolated cell is derived from the subject.
- Embodiment 122 The method of any one of embodiments 111-121, wherein the isolated cell is allogeneic with reference to the subject.
- Embodiment 123 A method of making an engineered cell, comprising transducing an isolated cell with the multicistronic expression system of any one of embodiments 1-104, the expression vector of embodiment 105 or 106, or the polynucleotide of any one of embodiments 111-117, and 124.
- Embodiment 124 A polynucleotide comprising the nucleic acid sequence of SEQ ID NO: 433.
- Example 1 FLT3 OR CD33 NOT EMCN Logic Gated CAR-NK Cell Circuit Optimization
- Various components, organization, and methods for FLT3 OR CD33 NOT EMCN logic- gated CAR-NK cell therapies were assessed.
- the overall FLT3 OR CD33 NOT EMCN logic- gated CAR-NK cell system is illustrated in FIG.
- aCAR bivalent activating CAR
- iCAR inhibitory CAR
- crIL-15 conditional-release IL-15
- the EMCN iCAR represents the “NOT-logic gate.”
- the bivalent FLT3/CD33 aCAR represents the “OR- logic gate.” All the components were encoded in constructs in a multicistronic system where each of the components were encoded in a single engineered nucleic acid capable of transcription as a single mRNA transcript and separated by 2A ribosome skipping elements.
- each of the encoded proteins would be translated as distinct peptides.
- the various components and organizations that are assessed are shown in FIG. 2. Assessed were the order the EMCN iCAR and FLT3/CD33 bivalent aCAR were encoded, various inhibitory intracellular inhibitory domains, tag presence, various hinges, various linkers between antibody binding domains, and different retrovirus-based vectors. In total, the initial screen assessed 90 constructs.
- Component Sequences The component sequences of the assessed lead constructs are shown in Table C (Table C1 showing amino acid sequences and Table C2 showing nucleotide sequences).
- FIG. 6 Representative flow cytometry plots are shown for membrane-bound IL-15 expression at Day 15 for a RetroVec (FIG. 6) and SINvec (FIG. 7) series of constructs.
- a first series of comparisons for expression is shown in FIG. 8.
- a second series of comparisons for expression is shown in FIG. 9.
- a third series of comparisons for expression is shown in FIG. 10.
- a summary of aCAR and iCAR as assessed by MFI is shown in FIG. 11.
- Retrovec also had a higher virus yield than SINvec SV40 (data not shown). The results show at the same genomic titer MOI, the SINvec SV40 constructs demonstrated a similar CAR expression percentage as the Retrovec system while the MFI is lower.
- SINvec NFAT SINvec NFAT
- results show at the same genomic titer MOI, the SINvec SV40 constructs show lower membrane-bound IL-15 expression than the RetroVec system. Expression generally trended higher for constructs with a native hinge from the intracellular domain (ICD) LIR1.
- ICD intracellular domain
- Cytotoxicity Assessment Cytotoxicity for the FLT3 OR CD33 NOT EMCN logic gate was assessed for multicistronic systems expressing the EMCN iCAR, the FLT3/CD33 bivalent aCAR, and IL-15. Each of the constructs in the screen had tags and used the “loop 6” linker.
- Total cytotoxicity against target cell lines expressing FLT3/CD33 (AML cell line MV4- 11) and target cell lines engineered to also express the NOT gate target antigen EMCN (MV4-11 + EMCN) for constructs using a LIR1 ICD is shown in FIG. 13. Normalized cytotoxicity was also assessed, as shown in FIG. 14.
- LIR1 constructs demonstrated up to 55% total killing (endogenous + aCAR-mediated killing). The LIR1 constructs also demonstrated up to ⁇ 50% protection from total killing (24% absolute protection; 100% protection of aCAR-mediated killing). As shown in FIG. 15, cytotoxicity was also assessed at Day 17 post-transduction for different effector:target ratios and demonstrated good cytotoxicity profiles at 1:2 and 1:4 ratios. As shown in FIG. 16, normalized cytotoxicity was also assessed at Day 10 post-transduction at a 1:2 effector:target ratio for the various LIR1-ICD constructs and demonstrated up to 18% absolute protection. The cytotoxicity profile indicate constructs with a native hinge from the intracellular domain (ICD) LIR1 generally worked best.
- ICD intracellular domain
- Component Sequences The component sequence of the assessed constructs are shown in Table C in Example 1.
- Bivalent FLT3 OR CD33 CAR-NK cells and monospecific CAR-NK cells were assessed in MV4-11 murine tumor models. Survival is shown in FIG. 20. Representative tumor imaging is shown in FIG. 21. The results show that CARs with the loop 4 linker demonstrated better efficacy than CARs with the loop 4 linker. The order for efficacy (starting with the best) was determined to be: (1) Bivalent Loop4 CAR, (2) CD33 mono CAR, (3) Bivalent Loop4 CAR, (4) FLT3 mono CAR.
- NV NK group had higher basal killing observed than in previous experiments (data not shown).
- the results demonstrate that the bivalent loop4 CAR NK had the best anti-tumor efficacy and survival rate among all the groups and had similar/better efficacy as compared to the mono CAR approach.
- Example 3 - FLT3 OR CD33 NOT EMCN CAR-NK Cell Further Optimization Various components, organization, and methods for FLT3 OR CD33 NOT EMCN logic- gated CAR-NK cell therapies were further assessed. As above, all the components were encoded in constructs in a multicistronic system.
- FIG. 22 illustrates the various tagged and tagless combinations assessed. The additional candidates assessed are shown in Table E. Also assessed were the top candidates from Example 1, as shown in Table F. Controls were the same as those in Example 1.
- Table F Component Sequences The component sequence of the assessed constructs are shown in Table C in Example 1. Lead candidates and their domain organizations are: - SB06342; SINvec SV40 (full vector sequence is SEQ ID NO: 425) o IgGE SS -- Il15 -- LR1 split N term linker + Tace10 -- B7-1 TM -- E2A/T2A -- GM-CSFRa SS -- FLT3 VH – GGGGS -- CD33 VH -- 6 Loop (GSTSGSGKPGSGEGSTKG) -- CD33 VL – GGGGS -- FLT3 VL -- CD8 Hinge -- CD8 TM -- CD28 -- CD3z -- E2A/T2A -- CD8 SS -- EMCN VH -- (GGGGS)3 linker -- EMCN VL -- CD8 Hinge --LIR1 TM -- LIR1 ICD - SB06463; SINvec SV40 (full vector sequence is SEQ ID NO: 426) o IgGE
- CD33 and EMCN were run in same panel and FLT3 run in separate panel.
- Tagged and Tagless Expression Assessment The expression of the tagless versions of the EMCN iCAR and the FLT3/CD33 bivalent aCAR were assessed for various constructs by flow cytometry. Staining of the “no virus” control is shown in FIG. 23. Staining of tagless constructs SB07401 and SB07405 is shown in FIG. 24. Staining of iCAR tagged only construct SB06467 is shown in FIG. 25. The results demonstrate “tagless” CARs could be detected using FLT3, CD33, and EMCN fluorophore-conjugated antigens expression was similar to tagged CAR versions.
- Loop 4 and Loop 6 Expression Assessment The expression of constructs including either Loop 4 or Loop 6 linkers were assessed for various constructs by flow cytometry.
- a summary of CD33/EMCN double positive cells is shown in FIG. 26, with the results demonstrating double positive populations of CD33+ and EMCN+ CAR NK cells ranged from 40-60%.
- a summary of expression for each of the CD33, FLT3, and EMCN CARs for constructs with Loop 4 linkers is shown in FIG. 27, demonstrating expression levels of CD33 and FLT3 populations were nearly identical and EMCN expression generally detectable.
- a summary of expression for each of the CD33, FLT3, and EMCN CARs for constructs with Loop 6 linkers is shown in FIG.
- a summary of killing activity for effector:target ratio of 1:2 is shown in FIG. 29 and normalized to no virus (NV) in FIG. 30.
- a summary of killing activity for effector:target ratio of 1:4 is shown in FIG. 31. The results demonstrated significant CAR-specific killing and significant EMCN-dependent protection of MV4-11 target cells.
- Example 4 In vitro characterization of SEM target cells A cell cytotoxicity assay was performed using SEM cells to assess the logic gating of an aCAR/iCAR system in NK cells expressing the aCAR/iCAR.
- NK cells transduced with SB07401, SB07403, SB07412, and SB07418 were co-cultured with SEM cells expressing EMCN (“EMCN+”) or not expressing EMCN (“EMCN-”) for 20 hours.
- EMCN+ expressing EMCN
- EMCN- not expressing EMCN
- FIG. 33A – FIG. 33C shows specific killing and protections after 2 challenges. SB07412 and SB07418 demonstrated significant CAR-specific killing and iCAR protection after two re-challenges.
- FIG. 34A shows a general schematic of the experimnet. FIG.
- FIG. 34B shows the expression of the SEM population comprising a 1:1 mixture of SEM cells expressing EMCN (CD33+/EMCN+) and SEM cells not expressing EMCN (CD33+/EMCN-).
- the aCAR/iCAR constructs were tested in an in vivo mouse model. JAX IL15 NSG mice were injected with a mixture of tumor cells and NK cells (1:1 ratio) at day 0. IL-2 was injected twice per week. Table G shows the constructs used for this study.
- FIG. 34A shows a general schematic of the experimnet.
- FIG. 34A shows a general schematic of the experimnet.
- FIG. 34B shows the expression of the SEM population comprising a 1:1 mixture of SEM cells expressing EMCN (CD33+/EMCN+) and SEM cells not expressing EMCN (CD33+/EMCN-).
- the animals were visualized by bioluminesence imaging (BLI) on days 11 and 19 (days after SEM injection).
- BLI bioluminesence imaging
- FIG. 35 shows mice treated wth PBS or NK cells transduced with no virus (NV), SB07401, SB07779, SB07403, or SB07569. BLI measurements were performed at specified time points after SEM cell injection.
- mice injected with NK cells transduced with SB07779 and SB07569 exhibited reduced BLI as compared to mice injected with untransduced NK cells (NV).
- FIG. 36 shows BLI quantification of the region of interested from time points, day 11 and day 19.
- Table H summarizies the observations of the study as noted in Table G.
- SB07779, SB07569 and SB07403 groups desmonstrated lower BLI quantification at day 19 as compared to NV Group.
- peripheral blood was drawn from animals and quantified.
- FIG. 37A shows quantification of proportion of SEM cells in the peripheral blood after injection of the NK cells transduced with the respective constructs. Mice were injected with a 1:1 ratio of EMCN(+) to EMCN(-) SEM cells, thus an increase in the percentage of EMCN+ cells would be indicative of iCAR expression when compared to the treatment group consisting of NK cells expressing the aCAR alone (OR Gate only control). On day 13, peripheral blood was drawn and the proportion of EMCN+ cells were quantified using flow cytometry.
- FIG. 37B shows the results of peripheral blood quantification of SEM in mice at day-21.
- NK cells trasnsduced with 7401 and 7412 showed increased protection of EMCN+ cells as compared to the NK cells transduced with 7779 OR gate only control, resulting in EMCN+ cells as the more dominant population as compared to EMCN- SEM cells.
- Table G Experimental Groups used in SEM in vivo study
- Table H Structure and Brief Summary of Study
- MV4-11 in vivo study An in vivo study was conducted to assess the functionality of NK cells expressing the aCAR/iCAR, by using MV4-11 target cells in a mouse model. Table I summarizes the experimental groups used in this study and Table J summarizes the results of the study. 50 ⁇ L of MV4-11 cells and 150 ⁇ L of NK cells were injected into the JAX IL15 NSG mouse on day 0. IL2 was also administered to the animal two times per week. On day 21, IL2 administration was ended. BLI measurements were performed on days 7, 21, 28, and 34. FIG. 38A-B shows representative images and quantification, respectively, of the BLI measurements at the indicated time points.
- FIG. 39A shows a representative BLI image of animals injected with PBS, untransduced NK cells, and NK cells transduced with SB07412 and SB07418 at day 55.
- mice receiving NK cells trasnduced with constructs SB07412 and SB07418 exhibited decreased signal at day 55, indicating killing of the injected MV4-11 cells compared to the PBS and transduced NK cell controls.
- median survival for mice receiving PBS or untransduced NK cells were calculated to be 49 and 55 days respectively, whereas the mice receiving the transduced NK cells (SB07412 and SB07418) have undefined median survival.
- mice treated with NK cells transduced with SB07412 or SB07418 were found to be significant when compared to mice treated with PBS or untransduced NK cells, showing that the constructs encoded by SB07412 or SB07418 increase survival in an MV4-11 tumor model.
- FIG. 39D the same study of FIG. 39C has been carried out until day 120, in which the median survival (days) was found for mice injected with PBS (49 days), non-engineered NK cells (NV) (55 days), engineered NK cells transduced with SB07412 Sinvec (81.5 days) or SB07418 Retrovec (108 days).
- Table I Table J shows the quantification of the NK cells after transduction with the respective viruses having the specific construct.
- Table J Example 6: Validation of other iCAR Architectures
- additional ICDs were tested for use in an EMCN iCAR.
- Table 9 provides the sequences of the full-length anti-EMCN iCARs assessed, which include the various ICDs indicated with all iCARs including the same anti-EMCN binder sequence: iCARs with the various ICDs were tested in a cytotoxicity assay as previously described in the present disclosure.
- Cells were engineered to express an aCAR and an iCAR with different ICDs to determine the inhibitory effect of various iCAR architectures on the activity of an aCAR.
- FLT3 NOT EMCN CAR-NK cells expressing iCARs having different ICDs were used in an in vitro cytotoxicity protection assay screen using target cells that expressed only FLT3 or target cells that expressed both FLT3 and EMCN (FIG. 40).
- the target cell population expressing FLT3 and EMCN should be protected from aCAR-mediated killing if the tested iCAR is functional and able to inhibit the aCAR activity.
- Multiple functional iCAR architectures were identified that enabled robust target cell killing in the absence of EMCN expression and provided significant antigen-dependent target cell protection in the presence of EMCN.
- Table 9 List of exemplary EMCN iCARs having different intracellular signaling domains
- Example 7 Characterization of FLT3/CD33 NOT EMCN expressing NK cells derived from different donors
- NK cells obtained from different donors were characterized to assess donor-to-donor variability. These cells were non-engineered or engineered with the FLT3/CD33 NOT EMCN Circuit (SB07412).
- NK cells derived from different donors were characterized for their ability to express different components within SB07412 (FLT3/CD33 bivalent aCAR, EMCN iCAR, and crIL15).
- FIGs 45A-45D show expression of crIL15-positive NK cells (FIG. 45A), secreted crIL15 (FIG. 45B), the CD33/FLT3 bivalent aCAR (FIG.
- NK Cell Cytotoxicity In FIGs. 41A-41F, non-engineered or engineered NK cells were tested for cell-mediated cytotoxicity against AML cell lines line MOLM-13 or MV4-11, and SEM (FLT3+/CD33+/ EMCN-). A total of 16 lots of NK cells, produced from 11 different NK donors, were used in these assays. When cytotoxicity data was compared across all tested lots of NK cells, the average cytotoxicity induced by the transduced cells was significantly higher than that observed from non-engineered NK cells in all cell lines (FIGs. 41A-41C).
- FIGs. 41A-41C demonstrate NK cytotoxicity against MOLM-13 (FIG. 41D) and MV4-11 (FIG. 41E) cells at multiple E:T ratios. Data is shown from a single NK cell donor.
- FIG. 41F shows cytotoxicity of engineered NK cells and non-engineered NK cells from multiple experiments plotted against CD33 CAR expression. Error bars represent standard deviation across samples in triplicate, and data was fit using linear regression.
- Cytokine Profile of Engineered NK cells In FIG. 42, the cytokine profiles were obtained from the cell supernatant of non- engineered or engineered NK cells following the first round of serial killing of MOLM-13 or MV4-11. In FIG. 42, a heat map was generated by analysis of the specified cytokine profiles, comparing the cytokine levels between the engineered and unengineered NK cells for the respective cell lines that the NK cells were co-cultutred with.
- the cytokines with increased production from co-culturing with engineered NK cells were IFN ⁇ , GM-CSF, IL10, TNF ⁇ , and perforin which all mediate inflammatory or cytotoxic functions in NK cells.
- Cytokines were not detectable when NK cells were not added to the AML cell line culture, suggesting that cytokine production was due to presence of NK cells rather than expressed inherently by the target cell lines. Cytokines assayed from supernatants of the engineered NK cells and non-engineered NK cells from 5 different lots after co-culture with MOLM-13 and MV4-11 AML target cells at an E:T ratio of 2:1.
- Engineered NK Cell Cytotoxicity against Primary AML Samples Primary AML patient samples from different subtypes were purchased from Discovery Life Sciences. Cryopreserved samples were thawed and cultured overnight for assays.
- NK cells engineered NK cells and donor-matched non-engineered NK cell controls
- primary AML cells at 2:1 E:T ratio overnight.
- Viability of AML target cells was determined via flow cytometry using a viability dye (Sytox Red).
- CD45low target cells were further profiled using CD34 and CD38.
- Engineered cells were further tested for cytotoxicity against primary tumor-derived AML samples.
- AML patient samples from M0, M1, M4 and M5 subtypes were co-cultured with engineered NK cells or donor-matched non-engineered NK cells. Cytotoxicity was determined after an overnight co-culture in at 37oC/5% CO2 incubator via flow cytometry gating on AML blasts and leukemic stem cells (LSCs). In both lots of engineered NK cells tested, engineered NK cells demonstrated high target cell killing of primary tumor-derived AML samples. Cytotoxicity was demonstrated against each primary AML sample tested, including against both AML blasts and LSC cell types (FIGs. 43A - 43B). Notably, engineered NK cells demonstrated significantly greater cytotoxicity than non-engineered NK cells against primary AML blasts and LSCs in all samples tested.
- EMCN hematopoietic stem cells
- HSCs healthy hematopoietic stem cells
- LMPP lympho-myeloid primed progenitor
- HPC hematopoietic progenitor cell
- HSCs human hematopoietic stem cells
- NK cells engineered to express only the FLT3/CD33 bivalent aCAR and NK cells engineered to express both the FLT3/CD33 bivalent aCAR and an EMCN iCAR (SB07412) were tested for their ability to kill leukemia cells, while sparing primary healthy HSCs (in CD34-enriched healthy bone marrow) within an in vitro cytotoxicity assay.
- CAR NK cells were co-cultured with the leukemia cells at at an effector:target ratio of 1:2 for approximately 18 hours, then cells were collected, stained, and analyzed by flow cytometry, revealing that the EMCN iCAR did not significantly inhibit the killing of the tumor target cells in comparison to the CAR NK cells without an EMCN iCAR (FIG. 46B).
- HSPCs hematopoietic stem and progenitor cells
- HSPCs primary healthy HSPCs (CD34-enriched bone marrow) were co-cultured with (or without, as control) CAR-NK cells that were transduced to express the FLT3/CD33 bivalent aCAR and an EMCN iCAR (SB07412) at an effectontarget ratio of 1:2 for approximately 18 hours (in triplicate), then cells from each well were collected and 1/10 of the cells were re-plated methylcellulose optimized for the growth and enumeration of hematopoietic stem and progenitor cell colonies, where each colony is a functional readout for a single parental stem/progenitor cell.
- NK cells engineered to express only the FLT3/CD33 bivalent aCAR and NK cells engineered to express both the FLT3/CD33 bivalent aCAR and an EMCN iCAR (SB07412) were tested for their ability to spare primary healthy MPPs (in CD34-enriched healthy bone marrow) within an in vitro cytotoxicity assay.
- CAR NK cells were co-cultured with primary healthy MPPs (within a CD34-enriched healthy bone marrow mixture) at an effector:target ratio of 3:1 for approximately 18 hours, then collected, stained, and analyzed by flow cytometry, revealing that the NK cells expressing the FLT3/CD33 bivalent aCAR and an EMCN iCAR demonstrated significantly reduced cytotoxicity against both the whole healthy MPP population (FIG. 46D) and healthy EMCN+ MPPs (FIG. 46E).
- NK activation marker expression analyzed by flow cytometry (FIG. 44). Each row represents a different phenotypic marker. Markers are rank ordered based on the mean fold change value across all samples.
- HIV-1 protease PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQY DQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
- Angiotensin converting enzyme SEQ ID NO: 156): MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQL RRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNIL ASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNS PTFEDDLEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPA
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Zoology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3247450A CA3247450A1 (en) | 2022-04-21 | 2023-04-17 | MULTICISTRONIC CHIMERIC PROTEIN EXPRESSION SYSTEMS |
| EP23792689.4A EP4511495A2 (en) | 2022-04-21 | 2023-04-17 | Multicistronic chimeric protein expression systems |
| KR1020247038570A KR20250007582A (ko) | 2022-04-21 | 2023-04-17 | 다중시스트론 키메라 단백질 발현 시스템 |
| AU2023256633A AU2023256633A1 (en) | 2022-04-21 | 2023-04-17 | Multicistronic chimeric protein expression systems |
| CN202380046362.1A CN119343457A (zh) | 2022-04-21 | 2023-04-17 | 多顺反子嵌合蛋白表达系统 |
| JP2024562022A JP2025513427A (ja) | 2022-04-21 | 2023-04-17 | マルチシストロンキメラタンパク質発現系 |
| US18/922,220 US20250041345A1 (en) | 2022-04-21 | 2024-10-21 | Multicistronic chimeric protein expression systems |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263333483P | 2022-04-21 | 2022-04-21 | |
| US63/333,483 | 2022-04-21 | ||
| US202263370219P | 2022-08-02 | 2022-08-02 | |
| US63/370,219 | 2022-08-02 | ||
| US202363440668P | 2023-01-23 | 2023-01-23 | |
| US63/440,668 | 2023-01-23 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/922,220 Continuation US20250041345A1 (en) | 2022-04-21 | 2024-10-21 | Multicistronic chimeric protein expression systems |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023205614A2 true WO2023205614A2 (en) | 2023-10-26 |
| WO2023205614A3 WO2023205614A3 (en) | 2024-01-04 |
Family
ID=88420634
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/065860 Ceased WO2023205614A2 (en) | 2022-04-21 | 2023-04-17 | Multicistronic chimeric protein expression systems |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20250041345A1 (https=) |
| EP (1) | EP4511495A2 (https=) |
| JP (1) | JP2025513427A (https=) |
| KR (1) | KR20250007582A (https=) |
| CN (1) | CN119343457A (https=) |
| AU (1) | AU2023256633A1 (https=) |
| CA (1) | CA3247450A1 (https=) |
| TW (1) | TW202346326A (https=) |
| WO (1) | WO2023205614A2 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024245291A1 (zh) * | 2023-05-31 | 2024-12-05 | 郑州大学 | 一种金属蛋白酶激活型car-t结构的制备及其应用 |
| WO2025085867A1 (en) * | 2023-10-20 | 2025-04-24 | A2 Biotherapeutics, Inc. | Compositions and methods for treating blood cancers |
| EP4511403A4 (en) * | 2022-04-20 | 2026-04-15 | Senti Biosciences Inc | DOMAINS OF BINDING TO AN ANTIGEN AND THEIR METHODS OF USE |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7285220B2 (ja) * | 2017-05-18 | 2023-06-01 | モデルナティエックス インコーポレイテッド | 連結したインターロイキン-12(il12)ポリペプチドをコードするポリヌクレオチドを含む脂質ナノ粒子 |
| TW202110873A (zh) * | 2019-04-30 | 2021-03-16 | 美商聖堤生物科技股份有限公司 | 嵌合受體及其使用方法 |
-
2023
- 2023-04-17 WO PCT/US2023/065860 patent/WO2023205614A2/en not_active Ceased
- 2023-04-17 TW TW112114283A patent/TW202346326A/zh unknown
- 2023-04-17 CA CA3247450A patent/CA3247450A1/en active Pending
- 2023-04-17 AU AU2023256633A patent/AU2023256633A1/en active Pending
- 2023-04-17 CN CN202380046362.1A patent/CN119343457A/zh active Pending
- 2023-04-17 JP JP2024562022A patent/JP2025513427A/ja active Pending
- 2023-04-17 EP EP23792689.4A patent/EP4511495A2/en active Pending
- 2023-04-17 KR KR1020247038570A patent/KR20250007582A/ko active Pending
-
2024
- 2024-10-21 US US18/922,220 patent/US20250041345A1/en active Pending
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4511403A4 (en) * | 2022-04-20 | 2026-04-15 | Senti Biosciences Inc | DOMAINS OF BINDING TO AN ANTIGEN AND THEIR METHODS OF USE |
| WO2024245291A1 (zh) * | 2023-05-31 | 2024-12-05 | 郑州大学 | 一种金属蛋白酶激活型car-t结构的制备及其应用 |
| WO2025085867A1 (en) * | 2023-10-20 | 2025-04-24 | A2 Biotherapeutics, Inc. | Compositions and methods for treating blood cancers |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2023256633A1 (en) | 2024-12-05 |
| JP2025513427A (ja) | 2025-04-24 |
| WO2023205614A3 (en) | 2024-01-04 |
| CA3247450A1 (en) | 2023-10-26 |
| CN119343457A (zh) | 2025-01-21 |
| EP4511495A2 (en) | 2025-02-26 |
| US20250041345A1 (en) | 2025-02-06 |
| TW202346326A (zh) | 2023-12-01 |
| KR20250007582A (ko) | 2025-01-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240082303A1 (en) | Protein payload release | |
| US20250041345A1 (en) | Multicistronic chimeric protein expression systems | |
| US20240277766A1 (en) | Armed chimeric receptors and methods of use thereof | |
| EP4072596A1 (en) | Method and compositions for regulated armoring of cells | |
| US20240091358A1 (en) | Secretable payload regulation | |
| WO2022236049A1 (en) | Chimeric antigen receptors and methods of use | |
| EP4598553A1 (en) | Armed chimeric receptors and methods of use thereof | |
| AU2024256204C1 (en) | Antigen-binding domains and methods of use thereof | |
| WO2026085275A1 (en) | Bivalent chimeric receptors or chimeric receptor systems and methods of use thereof | |
| WO2024102943A1 (en) | Armed chimeric receptors and methods of use thereof | |
| CN117897163A (zh) | 武装嵌合受体及其使用方法 | |
| WO2025106924A1 (en) | Methods of enhancing engineered immune cell cytotoxicity | |
| CN116547001A (zh) | 蛋白质有效载荷释放 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23792689 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024562022 Country of ref document: JP |
|
| ENP | Entry into the national phase |
Ref document number: 20247038570 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247038570 Country of ref document: KR Ref document number: AU2023256633 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023792689 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023792689 Country of ref document: EP Effective date: 20241121 |
|
| ENP | Entry into the national phase |
Ref document number: 2023256633 Country of ref document: AU Date of ref document: 20230417 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380046362.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23792689 Country of ref document: EP Kind code of ref document: A2 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380046362.1 Country of ref document: CN |