WO2023204148A1 - Treatment of inflammatory conditions - Google Patents
Treatment of inflammatory conditions Download PDFInfo
- Publication number
- WO2023204148A1 WO2023204148A1 PCT/JP2023/015132 JP2023015132W WO2023204148A1 WO 2023204148 A1 WO2023204148 A1 WO 2023204148A1 JP 2023015132 W JP2023015132 W JP 2023015132W WO 2023204148 A1 WO2023204148 A1 WO 2023204148A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- protein
- galectin
- antigen
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/145—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0008—Antigens related to auto-immune diseases; Preparations to induce self-tolerance
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36123—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36141—Use of virus, viral particle or viral elements as a vector
- C12N2770/36143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- the present disclosure relates to a treatment of inflammatory conditions, especially age related inflammatory condition in a subject.
- Aging is the major risk factor for most neurodegenerative diseases, such as Alzheimer's disease and Parkinson's disease.
- the most common types of neurodegenerative diseases primarily occur in older individuals. In fact, 1 in 10 individuals over 65 years old is expected to suffer a neurodegenerative condition, with that likelihood increasing exponentially with age.
- Neurodegenerative diseases of the central nervous system are defined by the progressive and irreversible loss of neuronal cells and is associated to behavioral impairment, including loss of motor and/or cognitive functions. Given the strong link between neurodegenerative diseases and aging, neurodegeneration is often considered as part of the aging process in the brain.
- Neurodegenerative diseases encompass a range of seriously debilitating conditions including Parkinson's disease, amyotrophic lateral sclerosis (ALS, "Lou Gehrig's disease”), Huntington's disease, Alzheimer's disease, and the like. These conditions are characterized by a gradual but relentless worsening of the patient's condition over time.
- Parkinson's disease amyotrophic lateral sclerosis (ALS, "Lou Gehrig's disease”
- ALS amyotrophic lateral sclerosis
- Huntington's disease Huntington's disease
- Alzheimer's disease and the like.
- AD Alzheimer's disease
- PD Parkinson's disease
- AD Alzheimer's disease
- AD is a multifactorial progressive neurodegenerative disease characterized by loss of memory and cognitive deficits.
- therapies for Alzheimer's disease (AD) have shown limited efficacy, with no true cure to this day being present.
- Parkinson's disease is characterized by the progressive degeneration of dopamine (DA) neurons projecting from the substantia nigra pars compacta (SNpc) to the dorsal striatum.
- DA dopamine
- SNpc substantia nigra pars compacta
- the resulting loss of dopamine in the striatum leads to debilitating motor dysfunction, including rigidity, resting tremor, postural instability, and bradykinesia.
- therapies for Parkinson's disease (PD) provide relief of motor symptoms, but fall short of exhibiting the neuroprotective effect required to prevent progressive degeneration of dopamine (DA) neurons.
- Neurodegenerative diseases show chronic aberrant inflammation.
- Galectins are members of the lectin family, which show high affinity for ⁇ -galactosides. There have been about 15 galectins discovered in mammals, encoded by the LGALS genes, which are numbered in a consecutive manner. Currently only galectin-1, -2, -3, -4, -7, -7B, -8, -9, -9B, 9C, -10, -12, -13, -14, and -16 have been identified in humans.
- Galectin-3 (Gal-3) is a member of a highly conserved family of animal lectins binding to ⁇ -galactoside-containing glycoconjugates (glycoprotein or glycolipids) (Non Patent Literature 1: Henderson NC 2006, Non Patent Literature 2: Mourad-Zeidan AA 2008). Gal-3 is unique among other Galectin-family proteins in its structure composed of two domains: a carboxyl-terminal domain that contains the carbohydrate-binding region and an amino-terminal domain consisting primarily of tandem repeat of nine amino acids to cross-link carbohydrate and noncarbohydrate ligands (Non Patent Literature 3: Barondes SH 1994).
- Non Patent Literature 4 Reynolds 2005
- Non Patent Literature 5 MacKinnon AC 2008
- Secreted extracellular Gal-3 forms homo-dimer or pentamer and it is important for the biological function.
- the N-terminal domain of galectin-3 has been demonstrated to be important for the formation of protein oligomers (Non Patent Literature 6: Dumic J 2006, Non Patent Literature 7: Kuklinski S 1998, Non Patent Literature 8: Lepur A 2012).
- Non Patent Literature 9 Yang RY 1996.
- Gal-3 was shown to be increased in various models of fibrotic diseases and patients including lung fibrosis, liver fibrosis, systemic sclerosis and cardiac fibrosis (Non Patent Literature 10: Henderson NC 2008, Non Patent Literature 11: Barman, et al. 2019, Non Patent Literature 12: Nishi Y 2007, Non Patent Literature 13: De Boer 2010). This suggests that Gal-3 may be an important mediator of and effective therapeutic target for tissue fibrosis.
- preclinical and clinical studies of investigational Galectin-3 inhibitors showed protection against fibrotic disorders (Non Patent Literature 14: Nikhil Hirani 2017, Non Patent Literature 15: Yu L 2013).
- Non Patent Literature 16 Yazar HO, et al., J Clinical Neuroscience 2019.
- Galectin-3 was highly upregulated in the brains of AD patients and 5xFAD (familial Alzheimer’s disease) mice and found specifically expressed in microglia associated with A ⁇ plaques (Non Patent Literature 17: Boza-Serrano A et al. Acta Neuropathology, 2019).
- Galectin-3 levels in serum and CSF samples are higher in AD and ALS patients compared to controls potentially suggests a definitive association between the serum and CSF levels of Gal-3 and the cognitive status in AD and ALS patients and healthy individuals (controls) (Non Patent Literature 18: Ashraf GM et.al. Front Neuroscience, 2018).
- Alphaviruses comprise a set of genetically, structurally, and serologically related mosquito-borne viruses of the Togaviridae family.
- the alphaviruses include Eastern Equine Encephalitis Virus (EEEV), Venezuelan Equine Encephalitis Virus (VEEV), Everglades Virus, Mucambo Virus, Pixuna Virus, Western Equine Encephalitis Virus (WEEV), Sindbis Virus, Semliki Forest Virus, Middleburg Virus, Chikungunya Virus (CHIKV), O'nyong-nyong Virus, Ross River Virus, Barmah Forest Virus, Getah Virus, Sagiyama Virus, Bebaru Virus, Mayaro Virus, Una Virus, Aura Virus, Whataroa Virus, Babanki Virus, Kyzylagach Virus, Highlands J virus, Fort Morgan Virus, Ndumu Virus, and Buggy Creek Virus.
- EEEV Eastern Equine Encephalitis Virus
- VEEV
- Structural subunits containing a single viral protein, capsid associate with the RNA genome in an icosahedral nucleocapsid.
- the capsid is surrounded by a lipid envelope covered with a regular array of transmembrane protein spikes, each of which consists of a heterodimeric complex of two glycoproteins, E1 and E2.
- VLPs Virus-like particles
- GlaxoSmithKline s EngerixR (hepatitis B virus) and CervarixR (human papillomavirus), and Merck and Co., Inc.’s Recombivax HBR (hepatitis B virus) and GardasilR (human papillomavirus) are some examples.
- Other VLP-based vaccine candidates are in clinical trials or undergoing preclinical evaluation, such as, influenza virus, parvovirus, Norwalk and various chimeric VLPs.
- VLP-based vaccine blockbusters are briefly presented concomitantly with the latest results from clinical trials and the recent developments in chimeric VLP-based technology for either therapeutic or prophylactic vaccination.
- VLP-based vaccines have been produced for more than 30 different viruses that infect human and other animals.
- the examples include AAV (Adeno-associated virus), H5N3 (Avian influenza), BFDV (Budgerigar fledgling disease virus), BTV (Bluetongue virus), Ebola, Enterovirus 71, GHPV (Goose hemorrhagic polyoma virus), HBV (Hepatitis B virus), HCV (Hepatitis C virus), HDV (Hepatitis ⁇ virus), HEV (Hepatitis E virus), HIV, HPV (Human papillomavirus), IBDV (Infectious bursal disease virus), Influenza A, Influenza A H1N1, Influenza A H3N2, JC polymavirus, Margurg, MS2, IPCV (Indian peanut clump virus), NDV (Newcastle disease virus), No (Norovirus) Nv (Norwalk virus), PhMV (Physalis mottle virus), Polymavirus,
- US patent No. 9,353,353 discloses a virus-like particle (VLP) comprising one or more Chikungunya viral structural proteins which is useful for formulating a vaccine or antigenic composition for Chikungunya that induces immunity to an infection or at least one symptom thereof.
- VLP virus-like particle
- US patent No. 9,487,563 discloses modified alphavirus or flavivirus virus-like particles (VLPs) and methods for enhancing production of modified VLPs for use in the prevention or treatment of alphavirus and flavivirus-mediated diseases.
- VLPs virus-like particle
- US patent No. 9,487,563 discloses modified alphavirus or flavivirus virus-like particles (VLPs) and methods for enhancing production of modified VLPs for use in the prevention or treatment of alphavirus and flavivirus-mediated diseases.
- 9,249,191 discloses a Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) virus-like particle, wherein said virus-like particle contains at least one antigen inserted into an E2 envelope protein to form a fusion protein.
- US patent No. 9,969,986 discloses an alphavirus virus-like particle, wherein said virus-like particle comprises an alphavirus structural protein that comprises an envelope protein E3, wherein said envelope protein E3 is modified to contain at least one foreign antigen inserted into furin cleavage site thereof (these cited references are herein incorporated by reference).
- NPL 11 Barman, Scott A, Xueyi Li, Stephen Haigh, Dmitry Kondrikov, Keyvan Mahboubi, Zsuzsanna Bordan, and Stepp W David. 2019. "Galectin-3 is Expressed in Vascular Smooth Muscle Cells and Promotes Pulmonary Hypertension through changes in Proliferation, Apoptosis and Fibrosis.” Epub ahead of print. [NPL 12] Nishi Y, Sano H, Kawashima T, Okada T, Kuroda T, Kikkawa K, Kawashima S, Tanabe M, Goto T, Matsuzawa Y, Matsumura R, Tomioka H, Liu FT, Shirai K. 2007.
- TD139 A Novel Inhaled Galectin-3 Inhibitor for the Treatment of Idiopathic Pulmonary Fibrosis (IPF). Results from the First in (IPF) Patients Study.” American Journal of Respiratory and Critical Care Medicine 195:A7560.
- NPL 15 Yu L, Ruifrok WP, Meissner M, Bos EM, van Goor H, Sanjabi B, van der Harst P, Pitt B, Goldstein IJ, Koerts JA, et al. 2013. "Genetic and pharmacological inhibition of galectin-3 prevents cardiac remodeling by interfering with myocardial fibrogenesis.” Circ Heart Fail 6:107-117.
- NPL 16 H.O. Yazar et al.
- the present disclosure relates to a treatment of an inflammatory condition.
- the present disclosure provides a method for treating an inflammatory condition, especially an age related inflammatory condition in a mammalian subject, which comprises administering an effective amount of a virus like particle comprising a viral structural protein and a galectin-3 antigen to the subject in need thereof.
- the present disclosure also provides a virus like particle comprising a viral structural protein and a galectin-3 antigen for use in the treatment of an inflammatory condition, especially an age related inflammatory condition in a mammalian subject.
- the present disclosure also provides a pharmaceutical composition for the treatment of an inflammatory condition, especially an age related inflammatory condition in a mammalian subject, comprising a virus like particle comprising a viral structural protein and a galectin-3 antigen.
- the present disclosure also provides use of a virus like particle comprising a viral structural protein and a galectin-3 antigen for the manufacture of a medicament for the treatment of an inflammatory condition, especially an age related inflammatory condition in a mammalian subject.
- Gal-3 antibody Anti-Mouse Galectin-3 (Gal-3) antibody in mice sera immunized with VEEV-Gal-3-VLP.
- the VEEV-Gal-3 VLPs were intramuscularly administered to one group of mice (Group 2) and normal saline to the other group (Group 1). The mice were administered at the beginning of the experiment, two and four weeks after the first administration. 6 weeks after the beginning of the experiment, blood samples were obtained from each mouse and the Gal-3 in the sera was detected by using ELISA.
- step-through passive avoidance test in 5 ⁇ FAD mice. 5 months after the beginning of the experiment, step-through passive avoidance test was conducted and the latencies 24h after the electrical stimulus were measured.
- the amount of Gal-3 in the hippocampus of 5 ⁇ FAD mice immunized with VEEV-Gal-3-VLP was measured.
- VEEV-Gal-3-VLP Effects of VEEV-Gal-3-VLP on survival of aged C57BL/6J mice.
- C57BL/6J mice were divided into two groups.
- the VEEV-Gal-3 VLPs were intramuscularly administered to one group of mice (Group B6-V) and normal saline to the other group (Group B6-N)
- VEEV-Gal-3-VLP Effects of VEEV-Gal-3-VLP on survival of 5 ⁇ FAD mice.5 ⁇ FAD mice were divided into two groups. The VEEV-Gal-3 VLPs were intramuscularly administered to one group of mice (Group F-V) and normal saline to the other group (Group F-N)
- galectin-3 antigen refers to any antigenic structure derived from galectin-3 protein which can be recognized by the immune system and/or that stimulates a cell-mediated immune response and/or stimulates the generation of antibodies specific to the antigen.
- the galectin-3 epitope peptide may be a fragment of a naturally occurring galectin-3 protein, or a fragment of a naturally occurring galectin protein with some modifications.
- the naturally occurring galectin-3 protein may preferably human galectin protein and especially, human galectin-3 protein.
- the modified fragment has at least 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a fragment of the naturally occurring galectin-3 protein.
- the modified peptide fragment is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a fragment of the naturally occurring galectin-3 protein.
- Galectin-3 Homo sapiens [Homo sapiens] (GenBank Accession No: AAB86584.1) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI (SEQ ID NO: 1)
- galectin-3 antigens i.e. galectin-3 epitope peptides may include the followings: ADNFSLHDALSGSGNPNPQGWPGAWGNQPA (SEQ ID NO: 2) YPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAPGA (SEQ ID NO: 3) YPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGA (SEQ ID NO: 4) ADSFSLNDALAGSGNPNPQGYPGAWGNQPA (SEQ ID NO: 5)
- Gal-3 epitope peptide SEQ ID NO: 2 is consisting of human N-term Gal-3 epitope peptide.
- Gal-3 epitope peptides SEQ ID NOs: 3 and 4 consisting of human Gal-3 N-term repeat sequence epitope peptide and SEQ ID NO: 4 has longer repeat sequence than that of SEQ ID NO: 3.
- SEQ ID NO: 5 encodes mouse Gal-3 N-term peptide
- VLPs bearing the above Gal-3 epitope peptides were prepared and immunogenicity of those VLPs were confirmed.
- Alphavirus is meant to refer to RNA-containing viruses that belong to the Togaviridae family of viruses.
- Exemplary Togaviridae viruses include but are not limited to Eastern Equine Encephalitis Virus (EEEV), Venezuelan Equine Encephalitis Virus (VEEV), Everglades Virus, Mucambo Virus, Pixuna Virus, Western Equine Encephalitis Virus (WEEV), Sindbis Virus, Semliki Forest Virus, Middleburg Virus, Chikungunya Virus (CHIKV), O'nyong-nyong Virus, Ross River Virus, Barmah Forest Virus, Getah Virus, Sagiyama Virus, Bebaru Virus, Mayaro Virus, Una Virus, Aura Virus, Whataroa Virus, Babanki Virus, Kyzylagach Virus, Highlands J virus, Fort Morgan Virus, Ndumu Virus, Buggy Creek Virus, Ockelbo virus.
- EEEV Eastern Equine Encephalitis Virus
- viral structural protein is meant a polypeptide or fragment thereof having at least about 80% amino acid sequence identity to a naturally occurring viral capsid or envelope protein and having immunogenic activity in a mammal.
- the alphavirus structural protein has at least about 85%, 90%, 95% or greater amino acid sequence identity with the above discussed alphaviruses.
- a viral structural protein and a galectin-3 antigen may be directly or indirectly fused.
- one or two linkers may intervene between N-terminal residue of an antigen and a viral structural protein and/or between C-terminal residue of an antigen and a viral structural protein.
- an antigen or a viral structural protein can be truncated and replaced by short linkers.
- an antigen or a viral structural protein include one or more peptide linkers.
- a linker consists of from 2 to 25 amino acids (e.g. 2, 3, 4, 5 or 6 amino acids). Usually, it is from 2 to 15 amino acids in length, although in certain circumstances, it can be only one, such as a single glycine residue.
- a nucleic acid molecule in which polynucleotide encoding the viral structural protein is genetically fused with polynucleotide encoding the antigen, is expressed in a host cell (e.g. mammalian cells (e.g. 293F cells)) so that the first attachment site and the second attachment site are linked through a peptide bond.
- a host cell e.g. mammalian cells (e.g. 293F cells)
- the first attachment site and/or the second attachment site may be genetically modified from the original protein or antigen.
- the first attachment site is modified from the viral structural protein so that through a linker peptide including SG, GS, SGG, GGS and SGSG, the protein is conjugated with the antigen.
- the first attachment site and the second attachment site may be linked through a chemical cross-linker which is a chemical compound.
- the cross-linker include, but are not limited to, SMPH, Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA and other cross-linkers available from the Pierce Chemical Company.
- an antigen may be linked to the Chikungunya viral structural protein or Venezuelan equine encephalitis viral structural protein as a fusion protein produced by way of genetic engineering.
- a Chikungunya viral structural protein or Venezuelan equine encephalitis viral structural protein used in the present application may be a Chikungunya or Venezuelan equine encephalitis virus envelope protein or a capsid or a complex of one or more envelope proteins and/or a capsid protein.
- Chikungunya virus examples include, but are not limited to, strains 37997 and strain LR2006 OPY-1.
- Examples of Venezuelan equine encephalitis virus include, but are not limited to, strain TC-83.
- Chikungunya viral structural protein or Venezuelan equine encephalitis viral structural protein used in the present application may be a naturally occurring viral structural protein or modified protein thereof.
- the modified protein may be a fragment of the naturally occurring viral structural protein.
- the modified protein has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a naturally occurring viral capsid and/or envelope protein.
- the modified protein is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a naturally occurring viral capsid and/or envelope protein.
- K64A or K64N mutation may be introduced into a capsid of Venezuelan equine encephalitis viral structural protein used in the present application.
- Chikungunya or Venezuelan equine encephalitis viral structural protein may consist of or comprise a capsid, E3, E2 and E1 proteins. E3 and E2 proteins may be expressed together so that E2 and E3 can form one protein.
- Chikungunya viral structural protein examples include, but are not limited to, Capsid-E3-E2-E1 of Chikungunya virus Strain 37997, and Capsid-E3-E2-E1 of Chikungunya virus LR2006 OPY-1.
- Venezuelan equine encephalitis viral structural protein examples include, but are not limited to, Capsid-E3-E2-E1 of Venezuelan equine encephalitis virus Strain TC-83.
- a first attachment site comprises an amino group, preferably an amino group of a lysine residue.
- the second attachment site comprises sulfhydryl group, preferably, a sulfhydryl group of a cysteine.
- a Chikungunya virus like particle or Venezuelan equine encephalitis virus like particle comprising a Chikungunya or Venezuelan equine encephalitis viral structural protein and at least one galectin-3 antigen, wherein the at least one galectin-3 antigen is inserted in E3 of the viral structural protein, and the Chikungunya viral structural protein or Venezuelan equine encephalitis viral structural protein and the galectin-3 antigen are expressed as a fusion protein
- the galectin-3 antigen may be inserted directly or indirectly in E3 of the viral structural protein.
- the viral structural protein of Chikungunya virus as well as Venezuelan equine encephalitis consist of E1, E2, 6K and E3. 6K is naturally cleaved during the process of assemble and removed from the VLPs.
- the mature VLPs consists of capsid, E1 and E2.
- "viral structural protein” refers not only those having 6K but also after 6K is removed.
- 6K sequences of the CHIKV and VEEV used in the working examples are as follows: CHIKV OPY-1 Strain, 6K: 749-809aa of SEQ ID NO: 6 atyqeaaiylwneqqplfwlqaliplaalivlcnclrllpcccktlaflavmsvgahtvsa (SEQ ID NO: 9) CHIKV 37997 strain, 6K: 749-809aa of SEQ ID NO: 7 atyyeaaaylwneqqplfwlqaliplaalivlcnclkllpcccktlaflavmsigahtvsa (SEQ ID NO: 10) VEEV TC-83strain, 6K: 758-813aa of SEQ ID NO: 8 ettwesldhlwnnnqqmfwiqlliplaalivvtrllrcvccvvpflv
- At least one galectin-3 antigen may be inserted instead of furin site (RKRR) from 322R to 325R of SEQ ID NO: 6 or 7.
- RKRR furin site
- at least one galectin-3 antigen is inserted between residues H at 321-position and S at 326-position of SEQ ID NO: 6 or 7; between P at 320-position and S at 326-position of SEQ ID NO: 6 or 7; or between S at 319-position and S at 326-position of SEQ ID NO: 6 or 7.
- VLP_CHI 0.56 vector may be used for preparing Chikungunya virus like particle where the galectin-3 antigen is inserted between residues 321 and 326 of SEQ ID NO: 6 or 7.
- the virus like particle provided by the present application may be Chikungunya virus like particle consisting of a complex of E2 and E3, capsid and E1, and wherein the at least one galectin-3 antigen is inserted into E3 region.
- At least one galectin-3 antigen may be inserted instead of furin site (RKRR) from 331R to 334R of SEQ ID NO: 8.
- RKRR furin site
- at least one galectin-3 antigen is inserted between G at 330-position and S at 335-position of SEQ ID NO: 8; between P at 329-position and S at 335-position of SEQ ID NO: 8; or between C at 328-position and S at 335-position of SEQ ID NO: 8.
- VLP_VEEV 0.66 vector may be used for preparing Venezuelan equine encephalitis virus like particle where the antigen is inserted between residues 330 and 335 of SEQ ID NO: 8.
- the virus like particle provided by the present application may be Venezuelan equine encephalitis virus like particle consisting of a complex of E2 and E3, capsid and E1, and wherein the at least one galectin-3 antigen is inserted into E3 region.
- an alteration is meant a change in an amino acid or nucleotide at a specified position with reference to a polypeptide sequence or polynucleotide sequence.
- an alteration includes a substitution, deletion, or insertion of an amino acid or nucleotide at a specified position of a polypeptide or polynucleotide.
- an alteration in an alphavirus capsid protein nuclear localization signal includes substitution of a charged amino acid (e.g., lysine or arginine) with an uncharged amino acid (e.g., alanine or asparagine, or any amino acid except a basic charged amino acid such as lysine or arginine).
- an analog is meant a molecule that is not identical, but has analogous functional or structural features.
- a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
- An analog may include an unnatural amino acid.
- Detect refers to identifying the presence, absence or amount of the analyte to be detected.
- disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
- agent any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
- an effective amount is meant the amount of an agent required to ameliorate the symptoms of a disease relative to an untreated patient.
- the effective amount of active compound(s) used to practice the method disclosed herein for the prevention or treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
- ameliorate decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease or a symptom thereof.
- the present disclosure provides a number of targets that are useful for the development of highly specific drugs to treat or prevent a diseases described herein.
- the methods disclosed herein provide a facile means to identify therapies that are safe for use in subjects.
- the methods provide a route for analyzing virtually any number of compounds for effects on a disease described herein with high- volume throughput, high sensitivity, and low complexity.
- fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
- a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
- isolated polynucleotide is meant a nucleic acid molecule (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule is derived, flank the gene.
- the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
- the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
- an “isolated polypeptide” is meant a polypeptide that has been separated from components that naturally accompany it.
- the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
- An isolated polypeptide may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
- marker any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
- nuclear localization signal or “NLS” is an amino acid sequence that, when present on the surface of a polypeptide, targets the polypeptide to the nucleus of the cell.
- NLS sequences are known in the art. See, for example, Non Patent Literature 22: Goldfarb, D., and N. Michaud (1991) Trends Cell Biol. 1, 20-24; Non Patent Literature 23: Gorlich, D., and I. W. Mattaj (1996) Science 271, 1513-1518).
- an NLS includes one or more short sequences of positively charged amino acids, such as lysines or arginines.
- Consensus sequences for NLS include K-K/R-X-K/R (Non Patent Literature 24: Schneider, J. et al. (1988) Cell 54,117-125) and two clusters of basic amino acids, separated by a spacer of about 10 amino acids, e.g., KR[PAATKKAGQA] KKKK (Non Patent Literature 25: Dingwall et al., Cell Biol. 107 (3): 841-9).
- NLS are present at amino acids 67-70 of an EEEV capsid protein (KRKK); at amino acids 67-70 of an WEEV capsid protein (KKKK); at amino acids 64-68 of a VEEV capsid protein (KKPKK); at amino acids 62-69 of a CHIKV capsid protein (RRNRKNKK); at amino acids 71-74 of a Ross River virus capsid protein (RKKK); and at amino acids 64-68 of a Barmah Forest virus capsid protein (KKPKK).
- KRKK EEEV capsid protein
- KKKK WEEV capsid protein
- KKPKK VEEV capsid protein
- RRNRKNKK CHIKV capsid protein
- RKKK Ross River virus capsid protein
- KKPKK Barmah Forest virus capsid protein
- obtaining as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
- reduces is meant a negative alteration of at least 10%, 25%, 50%, 75%, or 100%.
- reference is meant a standard or control condition.
- a “reference sequence” is a defined sequence used as a basis for sequence comparison.
- a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
- the length of the reference polypeptide sequence will generally be at least about 16 amino acids, preferably at least about 20 amino acids, more preferably at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids.
- the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, preferably at least about 60 nucleotides, more preferably at least about 75 nucleotides, and even more preferably about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
- telomere binding By “specifically binds” is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
- Nucleic acid molecules useful in the methods herein include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
- Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule.
- hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30°C, more preferably of at least about 37°C, and most preferably of at least about 42°C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
- concentration of detergent e.g., sodium dodecyl sulfate (SDS)
- SDS sodium dodecyl sulfate
- Various levels of stringency are accomplished by combining these various conditions as needed.
- hybridization will occur at 30°C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37°C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ⁇ g/ml denatured salmon sperm DNA (ssDNA).
- hybridization will occur at 42°C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25 °C, more preferably of at least about 42°C, and even more preferably of at least about 68°C.
- wash steps will occur at 25 °C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68°C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
- Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e ⁇ "3> and e ⁇ "100> indicating a closely related sequence.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University
- subject is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
- Ranges provided herein are understood to be shorthand for all of the values within the range.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
- treat refers to reducing or ameliorating a disorder and/or symptoms associated therewith. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
- the term "about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
- compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
- Alphavirus Polynucleotides in general, includes any nucleic acid sequence encoding a VLP having an alteration in a structural protein that enhances VLP expression in a mammalian cell.
- the alphavirus polypeptide(s) includes at least an alphavirus E2 protein or capsid protein NLS comprising an alteration that increases VLP expression in a mammalian cell.
- the alphavirus E2 protein has a non-lysine residue (e.g., asparagine) at the amino acid position corresponding to amino acid 234 in the CHIKV E2 protein and/or a modification at the amino acid position corresponding to amino acid 251 in the CHIKV E2 protein that destabilizes the E2 protein during viral budding.
- a non-lysine residue e.g., asparagine
- the alphavirus polypeptide(s) includes at least an alphavirus capsid protein having a non-lysine residue (e.g., alanine or asparagine) at an amino acid position corresponding to a lysine residue in an alphavirus capsid protein NLS and/or a non-arginine residue (e.g., alanine or asparagine) at an amino acid position corresponding to a arginine residue in an alphavirus capsid protein NLS.
- the alphavirus capsid protein is a WEEV CBA87 strain capsid protein having one or more of the alterations K67N, K68N, and/or K69N.
- the alphavirus capsid protein is a VEEV TC83 strain capsid protein having one or more of the alterations K64N, K65A, K65N, K67A, and/or K67N.
- the alphavirus capsid protein is a EEEV PE-6 strain capsid protein having an alteration K67N.
- the alphavirus capsid protein is a CHIKV(Strain 37997) strain capsid protein having one or more of the alterations R62A, R63A, R65A, K66A, K68A, and/or K69A.
- the alphavirus capsid protein is a Ross River Virus capsid protein having one or more of the alterations R71N, K72N, K73N, and/or K74N.
- the alphavirus capsid protein is a Barmah Forest Virus capsid protein having one or more of the alterations K64A, K64N, K65A, K65N, K67A, K67N, K68A and/or K68N.
- An isolated nucleic acid molecule can be manipulated by recombinant DNA techniques well known in the art.
- nucleotide sequence contained in a vector in which 5' and 3' restriction sites are known, or for which polymerase chain reaction (PCR) primer sequences have been disclosed is considered isolated, but a nucleic acid sequence existing in its native state in its natural host is not.
- the vector comprises CHIKV 37997 or WEEV 71V-1658 nucleic acid segments, or fragments thereof.
- the vector may further comprise a CMV/R promoter.
- the vector may also comprise the capsid protein, or a fragment thereof.
- the vector in addition to the E2 protein, comprises another envelope protein selected from the group consisting of E3, 6K, and El.
- the vaccine may comprise capsid, E3, E2, 6K and El. In other examples, the vaccine may comprise E3, E2, 6K and El.
- a nucleic acid molecule set forth in the sequences disclosed herein includes a nucleotide sequence encoding a polypeptide having at least about 50%, 60%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or more identity (e.g., when compared to the overall length of the amino acid sequence) to a polypeptide encoding a protein selected from alphavirus capsid, E3, E2, 6K and El, including CHIKV or VEEV capsid, E3, E2, 6K and El.
- proteins may comprise mutations containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded protein or how the proteins are made.
- Nucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host, see U.S. patent publication 2005/0118191, herein incorporated by reference in its entirety for all purposes.
- nucleotides can be sequenced to ensure that the correct coding regions were cloned and do not contain any unwanted mutations.
- the nucleotides can be subcloned into an expression vector (e.g., baculovirus) for expression in any cell.
- an expression vector e.g., baculovirus
- An isolated nucleic acid may be substantially purified, but need not be.
- a nucleic acid that is isolated within a cloning or expression vector is not pure in that it may comprise only a tiny percentage of the material in the cell in which it resides.
- Such a nucleic acid is isolated, as the term is used herein, because it is readily manipulatable by standard techniques known to those of ordinary skill in the art.
- VLPs comprising one or more alphavirus polypeptides herein may be produced by transformation of a suitable host cell with all or part of a polypeptide- encoding nucleic acid molecule or fragment thereof in a suitable expression vehicle.
- a polypeptide of the invention may be produced in a prokaryotic host (e.g., E. coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS cells).
- a prokaryotic host e.g., E. coli
- a eukaryotic host e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS cells.
- Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, Md.; also, see, e.g., Ausubel et al., supra).
- Non limiting examples of insect cells are, Spodoptera frugiperda (Sf) cells, e.g., Sf9, Sf21, Trichoplusia ni cells, e.g., High Five cells, and Drosophila S2 cells.
- Sf Spodoptera frugiperda
- Sf9 Sf9, Sf21
- Trichoplusia ni cells e.g., High Five cells
- Drosophila S2 cells e.g., Drosophila S2 cells.
- yeast host cells are S. cerevisiae, Kluyveromyces lactis (K lactis), species of Candida including C. albicans and C.
- mammalian cells are COS cells, baby hamster kidney cells, mouse L cells, LNCaP cells, Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) cells, African green monkey cells, CV1 cells, HeLa cells, MDCK cells, Vero and Hep-2 cells. Xenopus laevis oocytes, or other cells of amphibian origin, may also be used.
- Prokaryotic host cells include bacterial cells, for example, E. coli, B. subtilis, and mycobacteria.
- the gene encoding a specific alphavirus protein e.g., a CHIKV, WEEV, EEEV, VEEV, Ross River virus, or Barmah Forest virus structural protein can be isolated by RT-PCR from polyadenylated mRNA extracted from cells which had been infected with said virus.
- the resulting product gene can be cloned as a DNA insert into a vector.
- vector refers to the means by which a nucleic acid can be propagated and/or transferred between organisms, cells, or cellular components.
- Vectors include plasmids, viruses, bacteriophages, pro-viruses, phagemids, transposons, artificial chromosomes, and the like, that replicate autonomously or can integrate into a chromosome of a host cell.
- a vector can also be a naked RNA polynucleotide, a naked DNA polynucleotide, a polynucleotide composed of both DNA and RNA within the same strand, a poly-lysine-conjugated DNA or RNA, a peptide-conjugated DNA or RNA, a liposome-conjugated DNA, or the like, that is not autonomously replicating.
- the vectors of the present invention are plasmids or bacmids.
- the invention further provides nucleotides that encode proteins, including chimeric molecules, cloned into an expression vector that can be expressed in a cell that provides for the formation of VLPs.
- An "expression vector” is a vector, such as a plasmid, that is capable of promoting expression, as well as replication of a nucleic acid incorporated therein.
- the nucleic acid molecule to be expressed is "operably linked" to a promoter and/or enhancer, and is subject to transcription regulatory control by the promoter and/or enhancer.
- Expression vectors useful for producing such polypeptides include, without limitation, chromosomal, episomal, and virus-derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof.
- virus-derived vectors e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retrovirus
- Constructs and/or vectors provided herein comprise alphavirus polynucleotides that encode structural polypeptides, including envelope proteins or capsid proteins or portions thereof as described herein.
- the vector may be, for example, a phage, plasmid, viral, or retroviral vector.
- the constructs and/or vectors that comprise the nucleotides should be operatively linked to an appropriate promoter, such as the CMV promoter, phage lambda PL promoter, the E. coli lac, phoA and tac promoters, the SV40 early and late promoters, and promoters of retroviral LTRs are non-limiting examples.
- Other suitable promoters will be known to the skilled artisan depending on the host cell and/or the rate of expression desired.
- the expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome-binding site for translation.
- the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon appropriately positioned at the end of the polypeptide to be translated.
- Expression vectors will preferably include at least one selectable marker.
- markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria.
- virus vectors such as baculovirus, poxvirus (e.g., vaccinia virus, avipox virus, canarypox virus, fowlpox virus, raccoonpox virus, swinepox virus, etc.), adenovirus (e.g., canine adenovirus), herpesvirus, and retrovirus.
- vectors for use in bacteria comprise vectors for use in bacteria, which comprise pQE70, pQE60 and pQE-9, pBluescript vectors, Phagescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5.
- preferred eukaryotic vectors are pFastBacl pWINEO, pSV2CAT, pOG44, pXTl and pSG, pSVK3, pBPV, pMSG, and pSVL.
- Other suitable vectors will be readily apparent to the skilled artisan.
- Recombinant constructs can be prepared and used to transfect, infect, or transform and can express viral proteins, including those described herein, into eukaryotic cells and/or prokaryotic cells.
- the invention provides for host cells which comprise a vector (or vectors) that contain nucleic acids which code for alphavirus structural genes, including capsid, E3, E2, 6K, and El or portions thereof, and/or any chimeric molecule described above, and permit the expression of alphavirus structural genes, including capsid E3, E2, 6K, and El, or portions thereof, and/or any chimeric molecule described above in said host cell under conditions which allow the formation of VLPs.
- said vector is a recombinant baculovirus.
- said recombinant baculovirus is transfected into an insect cell.
- said cell is an insect cell.
- said insect cell is a Sf9 cell.
- said vector and/or host cell comprises nucleotides that encode alphavirus genes, including capsid, E3, E2, 6K, and El, or portions thereof as described
- said vector and/or host cell consists essentially of alphavirus capsid, E3, E2, 6K, and El, or portions thereof as described herein.
- said vector and/or host cell consists of alphavirus protein comprising capsid, E3, E2, 6K, and El, or portions thereof, as described herein.
- These vector and/or host cell contain alphavirus core, E3, E2, 6K, and El, or portions thereof, as described herein, and may contain additional cellular constituents such as cellulVLProteins, baculovirus proteins, lipids, carbohydrates etc.
- E. coli pET expression system (Novagen, Inc., Madison, Wis). According to this expression system, DNA encoding a polypeptide is inserted into a pET vector in an orientation designed to allow expression. Since the gene encoding such a polypeptide is under the control of the T7 regulatory signals, expression of the polypeptide is achieved by inducing the expression of T7 RNA polymerase in the host cell. This is typically achieved using host strains that express T7 RNA polymerase in response to IPTG induction. Once produced, a recombinant polypeptide is then isolated according to standard methods known in the art, for example, those described herein.
- pGEX expression system Another bacterial expression system for polypeptide production is the pGEX expression system (Pharmacia).
- This system employs a GST gene fusion system that is designed for high-level expression of genes or gene fragments as fusion proteins with rapid purification and recovery of functional gene products.
- the protein of interest is fused to the carboxyl terminus of the glutathione S-transferase protein from Schistosoma japonicum and is readily purified from bacterial lysates by affinity chromatography using Glutathione Sepharose 4B. Fusion proteins can be recovered under mild conditions by elution with glutathione.
- Cleavage of the glutathione S-transferase domain from the fusion protein is facilitated by the presence of recognition sites for site-specific proteases upstream of this domain.
- proteins expressed in pGEX-2T plasmids may be cleaved with thrombin; those expressed in pGEX-3X may be cleaved with factor Xa.
- VLPs comprising one or more alphavirus polypeptides. Also included in the invention are VLPs comprising one or more alphavirus polypeptides or fragments thereof that are modified in ways that enhance or do not inhibit their ability to modulate an immune response.
- the invention provides methods for optimizing an alphavirus amino acid sequence or nucleic acid sequence by producing an alteration. Such alterations may include certain mutations, deletions, insertions, or post-translational modifications.
- the invention further includes analogs of any naturally-occurring polypeptide of the invention. Analogs can differ from the naturally-occurring the polypeptide of the invention by amino acid sequence differences, by post-translational modifications, or by both.
- Analogs of the invention will generally exhibit at least 85%, more preferably 90%, and most preferably 95% or even 99% identity with all or part of a naturally-occurring amino, acid sequence of the invention.
- the length of sequence comparison is at least 10, 13, 15 amino acid residues, preferably at least 25 amino acid residues, and more preferably more than 35 amino acid residues.
- Alterations of an alphavirus polypeptide include but are not limited to site-directed, random point mutagenesis, homologous recombination (DNA shuffling), mutagenesis using uracil containing templates, oligonucleotide-directed mutagenesis, phosphorothioate- modified DNA mutagenesis, mutagenesis using gapped duplex DNA or the like. Additional suitable methods include point mismatch repair, mutagenesis using repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, double-strand break repair, and the like. Mutagenesis, e.g., involving chimeric constructs, is also included in the present invention. In one embodiment, mutagenesis can be guided by known information of the naturally occurring molecule or altered or mutated naturally occurring molecule, e.g., sequence, sequence comparisons, physical properties, crystal structure or the like.
- the invention provides polypeptide variants that differ from a reference polypeptide.
- variant refers to an amino acid sequence that is altered by one or more amino acids with respect to a reference sequence.
- the variant can have "conservative” changes, wherein a substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine.
- a variant can have "nonconservative” changes, e.g., replacement of a glycine with a tryptophan.
- Analogous minor variations can also include amino acid deletion or insertion, or both.
- variants show substantial biological activity.
- a protein variant forms an VLP and elicits an antibody response when administered to a subject.
- Natural variants can occur due to mutations in the proteins. These mutations may lead to antigenic variability within individual groups of infectious agents. Thus, a person infected with a particular strain develops antibody against that virus, as newer virus strains appear, the antibodies against the older strains no longer recognize the newer virus and reinfection can occur.
- the invention encompasses all antigenic and genetic variability of proteins from infectious agents for making VLPs.
- the invention also includes fragments of any one of the polypeptides of the invention.
- a fragment means at least 5, 10, 13, or 15.
- a fragment is at least 20 contiguous amino acids, at least 30 contiguous amino acids, or at least 50 contiguous amino acids, and in other embodiments at least 60 to 80 or more contiguous amino acids. Fragments of the invention can be generated by methods known to those skilled in the art or may result from normal protein processing (e.g., removal of amino acids from the nascent polypeptide that are not required for biological activity or removal of amino acids by alternative mRNA splicing or alternative protein processing events).
- Non-protein analogs having a chemical structure designed to mimic alphavirus VLPs or one or more alphavirus polypeptides functional activity can be administered according to methods of the invention.
- Alphavirus analogs may exceed the physiological activity of native alphavirus.
- the analogs are relatively resistant to in vivo degradation, resulting in a more prolonged therapeutic effect upon administration.
- Assays for measuring functional activity include, but are not limited to, those described in the Examples below.
- compositions and Administration features pharmaceutical compositions that comprise VLPs comprising the alphavirus viral structural protein and a galectin-3 antigen as described herein.
- the pharmaceutical compositions useful herein contain a pharmaceutically acceptable carrier, including any suitable diluent or excipient, which includes any pharmaceutical agent that does not itself induce the production of an immune response harmful to the vertebrate receiving the composition, and which may be administered without undue toxicity and a VLP of the invention.
- pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopia, European Pharmacopia or other generally recognized pharmacopia for use in mammals, and more particularly in humans.
- These compositions can be useful as a vaccine and/or antigenic compositions for inducing a protective immune response in a vertebrate.
- Pharmaceutically acceptable carriers include but are not limited to saline, buffered saline, dextrose, water, glycerol, sterile isotonic aqueous buffer, and combinations thereof.
- saline buffered saline
- dextrose dextrose
- water glycerol
- sterile isotonic aqueous buffer and combinations thereof.
- the formulation should suit the mode of administration.
- the formulation is suitable for administration to humans, preferably is sterile, non-particulate and/or non-pyrogenic.
- composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- the composition can be a solid form, such as a lyophilized powder suitable for reconstitution, a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
- the VLP composition is supplied in liquid form, for example in a sealed container indicating the quantity and concentration of the VLP composition.
- the liquid form of the VLP composition is supplied in a hermetically sealed container at least about 50 ⁇ g/ml, more preferably at least about 100 ⁇ g/ml, at least about 200 ⁇ g/ml, at least 500 ⁇ g/ml, or at least 1 mg/ml.
- the vaccine formulation is administered intranasally, either by drops, large particle aerosol (greater than about 10 microns), or spray into the upper respiratory tract or small particle aerosol (less than 10 microns) or spray into the lower respiratory tract. While any of the above routes of delivery results in an immune response, intranasal administration confers the added benefit of eliciting mucosal immunity at the site of entry of many viruses, including alphaviruses, for example CHIKV or VEEV.
- the invention also comprises a method of formulating a vaccine or antigenic composition that induces immunity to an infection or at least one symptom thereof to a mammal, comprising adding to said formulation an effective dose of VLPs, e.g., alphavirus (e.g., CHIKV or VEEV).
- VLPs e.g., alphavirus (e.g., CHIKV or VEEV).
- stimulation of immunity with a single dose is preferred, however additional dosages can be also be administered, by the same or different route, to achieve the desired effect.
- additional dosages can be also be administered, by the same or different route, to achieve the desired effect.
- multiple administrations may be required to elicit sufficient levels of immunity. Administration can continue at intervals throughout childhood, as necessary to maintain sufficient levels or protection.
- induced immunity can be monitored, for example, by measuring amounts of neutralizing secretory and serum antibodies, and dosages adjusted or vaccinations repeated as necessary to elicit and maintain desired levels of protection.
- the dosage of the pharmaceutical formulation can be determined readily by the skilled artisan, for example, by first identifying doses effective to elicit a prophylactic or therapeutic immune response, e.g., by measuring the serum titer of virus specific immunoglobulins or by measuring the inhibitory ratio of antibodies in serum samples, or urine samples, or mucosal secretions. Said dosages can be determined from animal studies.
- a non-limiting list of animals used to study the efficacy of vaccines include the guinea pig, hamster, ferrets, chinchilla, mouse and cotton rat, and non-human primates. Most animals are not natural hosts to infectious agents but can still serve in studies of various aspects of the disease.
- any of the above animals can be dosed with a vaccine candidate, e.g., VLPs of the invention, to partially characterize the immune response induced, and/or to determine if any neutralizing antibodies have been produced.
- a vaccine candidate e.g., VLPs of the invention
- many studies have been conducted in the mouse model because mice are small size and their low cost allows researchers to conduct studies on a larger scale.
- the immunogenicity of a particular composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
- adjuvant is meant to refer to a compound that, when used in combination with a specific immunogen in a formulation, will augment, alter or modify the resultant immune response.
- adjuvants have been used experimentally to promote a generalized increase in immunity against unknown antigens. Immunization protocols have used adjuvants to stimulate responses for many years, and as such, adjuvants are well known to one of ordinary skill in the art. Some adjuvants affect the way in which antigens are presented. For example, the immune response is increased when protein antigens are precipitated by alum.
- Emulsification of antigens also prolongs the duration of antigen presentation.
- Exemplary adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
- Other adjuvants comprise GMCSP, BCG, aluminum hydroxide, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL).
- RIBI which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM) and cell wall skeleton (CWS) in a 2% squalene/Tween-80 emulsion also is contemplated.
- MF-59, Novasomes.RTM., MHC antigens may also be used.
- the VLPs of the invention can also be formulated with "immune stimulators.” These are the body's own chemical messengers (cytokines) to increase the immune system's response. Immune stimulators include, but not limited to, various cytokines, lymphokines and chemokines with immunostimulatory, immunopotentiating, and pro-inflammatory activities, such as interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-12, IL-13); growth factors (e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF)); and other immunostimulatory molecules, such as macrophage inflammatory factor, Flt3 ligand, B7.1; B7.2, etc.
- interleukins e.g., IL-1, IL-2, IL-3, IL-4, IL-12, IL-13
- growth factors e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF
- the immunostimulatory molecules can be administered in the same formulation as the VLPs, or can be administered separately. Either the protein or an expression vector encoding the protein can be administered to produce an immunostimulatory effect.
- the invention comprises antigenic and vaccine formulations comprising an adjuvant and/or an immune stimulator.
- Neurodegenerative diseases including Alzheimer’s disease, Parkinson’s disease, Multiple Sclerosis, and Huntington’s disease show chronic aberrant inflammation.
- the composition showed the reduction of intracerebral Gal-3 level as well as the improvement of cognitive function, which strongly suggests the usefulness not only for treatment of the neurogenerative diseases but also inflammatory conditions in general.
- inflammatory conditions are those of various organs such as the lungs, joints, eyes, bowel, skin, heart kidney and the central nervous system (CNS).
- Conditions of the lung include asthma, adult respiratory distress syndrome, bronchitis and cystic fibrosis (which may additionally or alternatively involve the bowel or other tissue(s)).
- Conditions of the joint include rheumatoid arthritis, rheumatoid spondylitis, osteoarthritis, gouty arthritis and other arthritic conditions.
- Inflammatory eye conditions include uveitis (including ulceris) and conjunctivitis.
- Inflammatory bowel conditions include Crohn's disease, ulcerative colitis and distal proctitis.
- Skin diseases include those associated with cell proliferation, such as psoriasis, eczema and dermatitis (whether or not of allergic origin).
- Conditions of the heart include coronary infarct damage.
- Conditions of the kidney include chronic kidney disease (CKD) such as glomerulonephritis (with and without nephrotic syndrome, e.g. including idiopathic nephrotic syndrome or minimal change nephropathy).
- CKD chronic kidney disease
- Other inflammatory conditions and immune disorders include tissue necrosis in chronic inflammation, endotoxin shock, smooth muscle proliferation disorders (for example, restenosis following angioplasty)and tissue rejection following transplant surgery.
- Neurodegenerative diseases include, but not limited to, Parkinson's disease, amyotrophic lateral sclerosis (ALS, "Lou Gehrig's disease”), Huntington's disease, Alzheimer's disease, Creutzfeldt-Jakob disease and neuro-degenerative conditions in general.
- Parkinson's disease amyotrophic lateral sclerosis
- ALS amyotrophic lateral sclerosis
- Huntington's disease Alzheimer's disease
- Creutzfeldt-Jakob disease Creutzfeldt-Jakob disease
- neuro-degenerative conditions in general.
- the composition or method is useful for the treatment of inflammatory condition, especially age related inflammatory condition, thereby can enhance biological functionalities related to overall health and disease progression, promote longevity and healthspan, and/or delay or inhibit the cellular aging process in the subject.
- Example 1 Preparation of VLPs having a Gal-3 antigen Galectin-3 (Gal-3) vaccine epitope was designed by using protein amino acid sequences and 3D-structure of human and mouse Gal-3 proteins (Table 1). Linkers SGG (N-terminal) and GGS (C-terminal) were attached to the epitope peptide SEQ ID NO: 5.
- pVEEV Gal-3 plasmid DNA vector For the generation of a mammalian expression vector, pVEEV Gal-3 plasmid DNA vector, a synthesized dsDNA fragment of Gal-3 epitope peptide sequence (gBlocks, IDT) was inserted into specific location (between G at 330-position and S at 335-position) of DNA encoding VEEV E3 envelope protein in pVEEV vector to obtain VEEV-Gal-3 VLP according to the procedures disclosed in WO 2022/225057.
- PEI Polyethylenimine, Polysciences, #23966
- VLP-containing culture supernatant was layered onto 1.5 mL OptiPrep (60 % w/v) Iodixanol, Accurate chemical, #AN1114542) and centrifuged at 52,000 x g for 1.5 hr in SW-28 rotor (Beckmann). After removing supernatant to leave 1.5 mL above the interface, two layers were mixed to make 50 % OptiPrep solution and centrifuged at 360,000 x g for 2.5 hrs in NVT100 rotor (Beckman) to form a density gradient.
- VLPs were collected and purified by size exclusion chromatography using Biologic Duo-Flow FPLC system (Bio-Rad) with Hiprep 16/60 Sephacryl S-500 HR column (GE, #28-9356-06) and phosphate-buffered saline (PBS). Fractions containing VLPs were concentrated by Amicon Ultra-15 centrifugal filter units (EMD Millipore, #UFC910024) and filtered through a 0.20 ⁇ m PES membrane.
- EMD Millipore #UFC910024
- VLP concentration was measured by BCA Protein Assay (Pierce, #23225) following the manufacturer’s instructions. Purity of the VLPs was confirmed by SDS-PAGE analysis (Any kD Mini-PROTEAN TGX Precast Protein Gel, Bio-Rad, #456-9035) followed by Coomassie dye-based staining using QC Colloidal Coomassie Stain (Bio-Rad, #1610803). Sucrose and EDTA were added to the VLP solution at the final concentration of 250 mM and 5 mM, respectively. Protein concentration of VLP samples were adjusted to 0.4 mg/mL and store at -80°C.
- VLPs comprising Gal-3 epitope peptide was analyzed by SDS-PAGE under denatured condition. The obtained VLP was matched with the theoretical molecular weight and the purity was more than 90%. Protein bands regarding the fusion protein Gal-3 peptide with VEEV viral structural protein was confirmed.
- mice were used as Alzheimer’s disease model mice. Mice were divided into two groups. The VEEV-Gal-3 VLPs were mixed with RIBI adjuvant and intramuscularly administered to one group of mice (Group 2) and normal saline to the other group (Group 1). The concentration of the VLPs was 0.2mg/ml and 50 micrograms of them were administered in each mice. The mice were administered at the beginning of the experiment, two and four weeks after the first administration. 6 weeks after the beginning of the experiment, blood samples were obtained from each mouse and serum was prepared.
- step-through passive avoidance test was performed.
- the passive avoidance test is generally used as a method for testing avoidance memory retention.
- the passive avoidance response was measured using a “step-through” apparatus.
- the apparatus is divided into two compartments. On the first day, the mice were placed in the illuminated compartment. When the mice moved from the illuminated area to the dark compartment, an electrical shock was delivered for 3 s (0.3mA). On the second day, the mice were placed in the illuminated compartment and the time when the mice entered into the dark compartment was recorded as “retention time”. The result showed VLP-Gal-3 injected group increased latency, which suggested memory retention in VLP-Gal-3 injected group (see Fig.2)
- VEEV-Gal-3-VLP decreased Gal-3 in the hippocampus of 5 ⁇ FAD mice.
- mouse brains were collected in microtube and homogenized with lysis buffer. The lysates were centrifuged for 10 min at 4°C and the supernatants were resolved on NUPAGE 12%, Bis-Tris gel and transferred to PVDF membrane. The membrane was blocked with Bullet Blocking One (nacalai tesque) and were incubated with primary antibody overnight at 4°C. Primary antibodies were anti-Gal-3 (1:1000, R&D) and anti- ⁇ -Amyloid(1:1000, BioLegend).
- the membranes were incubated with anti-rat secondary antibody(1:3000, Jackson ImmunoResearch) or anti-mouse secondary antibody(1:5000, Jackson ImmunoResearch).
- the blots were developed by chemiluminescence and images were scanned using a chemiluminescence detector (LAS500; GE Healthcare).
- LAS500 chemiluminescence detector
- ⁇ -actin was used for a loading control.
- Gal-3 expression level in hippocampus significantly decreased in VLP-Gal-3 injected group (see Fig. 3).
- VEEV-Gal-3-VLP extended lifespan in aged C57BL/6J mice.
- C57BL/6J mice were divided into two groups.
- the VEEV-Gal-3 VLPs were intramuscularly administered to one group of mice (Group B6-V) and normal saline to the other group (Group B6-N).
- mice in Group B6-N gradually died.
- mice in Group B6-V didn’t die at all (see Fig.4)
- VEEV-Gal-3-VLP extended lifespan in 5 ⁇ FAD mice.
- 5 ⁇ FAD mice were divided into two groups.
- the VEEV-Gal-3 VLPs were intramuscularly administered to one group of mice (Group F-V) and normal saline to the other group (Group F-N).
- mice in Group F-N gradually died after 50 weeks of age.
- mice in Group B6-V didn’t die at all until 54 weeks of age (see Fig.5).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Pharmacology & Pharmacy (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Biomedical Technology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Psychiatry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Hospice & Palliative Care (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Pulmonology (AREA)
- Rheumatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2024561984A JP2025513920A (ja) | 2022-04-18 | 2023-04-14 | 炎症性疾患の処置 |
| CN202380034277.3A CN119546752A (zh) | 2022-04-18 | 2023-04-14 | 炎性病况的治疗 |
| EP23791796.8A EP4511479A1 (en) | 2022-04-18 | 2023-04-14 | Treatment of inflammatory conditions |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263332037P | 2022-04-18 | 2022-04-18 | |
| US63/332,037 | 2022-04-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023204148A1 true WO2023204148A1 (en) | 2023-10-26 |
Family
ID=88308716
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2023/015132 Ceased WO2023204148A1 (en) | 2022-04-18 | 2023-04-14 | Treatment of inflammatory conditions |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20230330209A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4511479A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2025513920A (cg-RX-API-DMAC7.html) |
| CN (1) | CN119546752A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023204148A1 (cg-RX-API-DMAC7.html) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118812696A (zh) * | 2024-08-21 | 2024-10-22 | 南通大学附属医院 | Galectin-3抗原表位肽、抗原、抗体及化学发光试剂盒 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016021209A1 (en) * | 2014-08-08 | 2016-02-11 | Vlp Therapeutics, Llc | Virus like particle comprising modified envelope protein e3 |
| WO2022225057A1 (en) * | 2021-04-23 | 2022-10-27 | Vlp Therapeutics, Inc. | Galectin-targeting immunotherapy |
-
2023
- 2023-04-14 CN CN202380034277.3A patent/CN119546752A/zh active Pending
- 2023-04-14 EP EP23791796.8A patent/EP4511479A1/en active Pending
- 2023-04-14 JP JP2024561984A patent/JP2025513920A/ja active Pending
- 2023-04-14 WO PCT/JP2023/015132 patent/WO2023204148A1/en not_active Ceased
- 2023-04-17 US US18/301,542 patent/US20230330209A1/en active Pending
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016021209A1 (en) * | 2014-08-08 | 2016-02-11 | Vlp Therapeutics, Llc | Virus like particle comprising modified envelope protein e3 |
| WO2022225057A1 (en) * | 2021-04-23 | 2022-10-27 | Vlp Therapeutics, Inc. | Galectin-targeting immunotherapy |
Non-Patent Citations (2)
| Title |
|---|
| GOTO, K. ET AL.: "A development of novel vaccine targeting galectin-3 for Alzheimer's disease", CLINICAL NEUROLOGY, vol. 61, 2021, pages S223, XP093100734, ISSN: 0009-918X, Retrieved from the Internet <URL:https://www.jstage.jst.go.jp/article/clinicalneurol/61/Supplement/6161supplement5221/_pdf/-char/ja> [retrieved on 20230606], DOI: 10.5692/clinicalneuro1.61_supplement_5221 * |
| GOTO, K. ET AL.: "Development of novel vaccine to reduce galectin-3 for Alzheimer's disease", JOURNAL OF THE NEUROLOGICAL SCIENCES, vol. 429, 2021, pages 108 - 109, XP086817572, DOI: 10.1016/j.jns.2021.119028 * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20230330209A1 (en) | 2023-10-19 |
| EP4511479A1 (en) | 2025-02-26 |
| CN119546752A (zh) | 2025-02-28 |
| JP2025513920A (ja) | 2025-04-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12168675B2 (en) | Virus-like particles and methods of use | |
| JP7701080B2 (ja) | アルファウイルスレプリコン粒子 | |
| AU2021242030A1 (en) | Coronavirus vaccine | |
| WO2020234300A1 (en) | A subunit vaccine for treatment or prevention of a respiratory tract infection | |
| AU2016257196A1 (en) | Oncolytic adenoviruses with mutations in immunodominant adenovirus epitopes and their use in cancer treatment | |
| BR112015030229B1 (pt) | Partícula semelhante a vírus compreendendo um polipeptídeo e um antígeno da malária, vetor, composições farmacêutica e de vacina, bem como molécula de ácido nucleico isolado | |
| WO2024082681A1 (zh) | 截短的呼吸道合胞病毒f蛋白及其用途 | |
| WO2023204148A1 (en) | Treatment of inflammatory conditions | |
| US20220347261A1 (en) | Galectin-targeting immunotherapy | |
| KR102725189B1 (ko) | 재조합 호흡기 세포융합 바이러스 f 단백질 및 이를 포함하는 백신 조성물 | |
| JP6675185B2 (ja) | 免疫誘導剤およびその製造方法 | |
| CN110229219B (zh) | 一种新型的呼吸道合胞病毒疫苗抗原的制备方法及其用途 | |
| WO2025084276A1 (ja) | 肥満の処置 | |
| CN112823021A (zh) | 稳定化的丝状病毒糖蛋白三聚体 | |
| WO2024143497A1 (ja) | Cd153を標的とする医薬組成物 | |
| RU2811991C2 (ru) | Субъединичная вакцина для лечения или предотвращения инфекции дыхательных путей | |
| OA20123A (en) | Alphavirus replicon particle. | |
| LU92997B1 (en) | Means and methods for treating HSV | |
| CA2985029C (en) | Oncolytic adenoviruses with mutations in immunodominant adenovirus epitopes and their use in cancer treatment | |
| LU92998B1 (en) | Means and methods for treating HSV |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23791796 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380034277.3 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024561984 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023791796 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023791796 Country of ref document: EP Effective date: 20241118 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380034277.3 Country of ref document: CN |