WO2023182861A1 - 항-hla-g 키메라 항원 수용체 및 이의 용도 - Google Patents

항-hla-g 키메라 항원 수용체 및 이의 용도 Download PDF

Info

Publication number
WO2023182861A1
WO2023182861A1 PCT/KR2023/003960 KR2023003960W WO2023182861A1 WO 2023182861 A1 WO2023182861 A1 WO 2023182861A1 KR 2023003960 W KR2023003960 W KR 2023003960W WO 2023182861 A1 WO2023182861 A1 WO 2023182861A1
Authority
WO
WIPO (PCT)
Prior art keywords
hla
cells
amino acid
seq
acid sequence
Prior art date
Application number
PCT/KR2023/003960
Other languages
English (en)
French (fr)
Inventor
권기문
이보은
변성현
김착희
양유희
김지은
Original Assignee
에이치케이이노엔 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 에이치케이이노엔 주식회사 filed Critical 에이치케이이노엔 주식회사
Publication of WO2023182861A1 publication Critical patent/WO2023182861A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0636—T lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515—Animal cells
    • A61K2039/5156—Animal cells expressing foreign proteins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515—Animal cells
    • A61K2039/5158—Antigen-pulsed cells, e.g. T-cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Definitions

  • the present invention relates to a chimeric antigen receptor containing an antigen-binding domain that specifically binds to HLA-G, immune cells into which the receptor has been introduced, and their uses.
  • CAR-T cells are cells that have been given a targeting function to T cells by introducing an artificially designed CAR molecule into them. Since the CAR molecules show specificity for specific tumor antigens, they can eliminate only tumor cells.
  • chimeric antigen receptors include an extracellular antigen binding domain, a transmembrane domain, and an intracellular signaling domain.
  • the extracellular antigen binding domain may comprise a single-chain variable fragment (scFv) targeting an identified tumor antigen.
  • histocompatibility antigen, class I, G also known as human leukocyte antigen-G (HLA-G)
  • HLA-G human leukocyte antigen-G
  • ILT2 Ig-like transcript 2
  • ILT4 KIR2DL4
  • ITIM motif Immunoreceptor tyrosine
  • HLA-G Human Leukocyte Antigen-G
  • the present inventors have made extensive research efforts to develop chimeric antigen receptors and immune cells containing them that can effectively treat diseases related to HLA-G (Human leukocyte antigen-G) expression.
  • HLA-G Human leukocyte antigen-G
  • an anti-HLA-G chimeric antigen receptor that specifically binds to HLA-G and T cells and NK cells expressing the chimeric antigen receptor were produced.
  • the present invention was completed by confirming that the corresponding T cells and NK cells exhibit high anticancer activity against cell lines expressing HLA-G.
  • an object of the present invention is to provide an anti-HLA-G chimeric antigen receptor and an immune cell expressing the receptor.
  • Another object of the present invention is to provide a nucleic acid containing a nucleotide encoding an anti-HLA-G chimeric antigen receptor and a vector containing the nucleic acid.
  • Another object of the present invention is to provide a pharmaceutical composition containing the immune cells and a pharmaceutically acceptable carrier.
  • one aspect of the present invention includes an antigen binding domain that specifically binds to HLA-G (human leukocyte antigen-G); transmembrane domain; It provides an anti-HLA-G chimeric antigen receptor comprising an intracellular signaling domain.
  • HLA-G human leukocyte antigen-G
  • transmembrane domain It provides an anti-HLA-G chimeric antigen receptor comprising an intracellular signaling domain.
  • the antigen binding domain that specifically binds to HLA-G may include a sequence selected from the following:
  • a heavy chain comprising a heavy chain complementarity determining region 1 (CDR1) having the amino acid sequence of SEQ ID NO: 31, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 32, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 33 variable region; and
  • a light chain variable region comprising a light chain CDR1 having the amino acid sequence of SEQ ID NO: 34, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 35, and a light chain CDR3 having the amino acid sequence of SEQ ID NO: 36;
  • a heavy chain variable region comprising a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 37, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 38, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 39;
  • a light chain variable region comprising a light chain CDR1 having the amino acid sequence of SEQ ID NO: 40, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 41, and a light chain CDR3 having the amino acid sequence of SEQ ID NO: 42; or
  • a heavy chain variable region comprising a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 43, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 44, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 45;
  • a light chain variable region comprising a light chain CDR1 having the amino acid sequence of SEQ ID NO: 46, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 47, and a light chain CDR3 having the amino acid sequence of SEQ ID NO: 48.
  • chimeric antigen receptor refers to a receptor protein that combines the receptor site of an immune cell and the recognition site of a specific antigen expressed on the surface of cancer cells so that immune cells (e.g., T cells) can recognize a specific protein. am. These receptors have chimeric properties because they combine an antigen-binding site that can recognize antigens expressed by tumors and a signal transduction site that can activate T cells.
  • the chimeric antigen receptor includes an antigen binding domain, a transmembrane domain, and an intracellular signaling domain.
  • the antigen binding domain recognizes HLA-G of target cells and may be an antibody or antibody fragment. Additionally, the antigen-binding fragment may be an scFv, but is not limited thereto.
  • the antigen binding site may include a heavy chain variable region sequence and a light chain variable region sequence, and the two sequences may be connected by a linker including the amino acid sequence of SEQ ID NO: 24. Therefore, the antigen binding site may be in the form of a scFv (single-chain fragment variable).
  • variable chain refers to a full-length heavy chain comprising a variable region domain VH comprising the amino acid sequence of the variable region sufficient to confer specificity for an antigen and three constant region domains CH1, CH2 and CH3, and It refers to all fragments of this.
  • the term “light chain” refers to both a full-length light chain and fragments thereof comprising the variable region domain VL and the constant region domain CL, which contain the amino acid sequence of the variable region sufficient to confer specificity to the antigen.
  • the antigen binding domain may include the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 4, or SEQ ID NO: 6, and specifically, the amino acid sequence of SEQ ID NO: 2, SEQ ID NO: 4, or SEQ ID NO: 6. It may be composed of an amino acid sequence having a sequence identity of at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 99%.
  • the antigen binding domain is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoe
  • a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 25 or an amino acid sequence having at least 80% homology to SEQ ID NO: 25, and a light chain comprising the amino acid sequence of SEQ ID NO: 26 or an amino acid sequence having at least 80% homology to SEQ ID NO: 26 variable region;
  • a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 27 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 27, and an amino acid sequence of SEQ ID NO: 28 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 28
  • a light chain variable region comprising an amino acid sequence having homology
  • a heavy chain variable region comprising an amino acid sequence of SEQ ID NO: 29 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 29 and an amino acid sequence of SEQ ID NO: 30 or an amino acid sequence with 80% or more homology to the amino acid sequence of SEQ ID NO: 30 It may include a light chain variable region containing an amino acid sequence having homology.
  • the chimeric antigen receptor may additionally include a signal sequence (leader sequence, LS).
  • the signal sequence refers to a sequence that moves the chimeric antigen receptor to the cell membrane so that it can be expressed and exposed on the cell surface.
  • the signal sequence may be a signal sequence derived from CD8 alpha, human immunoglobulin heavy chain, or hGM-CSF receptor alpha-chain, and specifically may be a signal sequence derived from CD8 alpha.
  • the CD8 alpha-derived signal sequence may include the amino acid sequence of SEQ ID NO: 8, and specifically, at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 95% of the amino acid sequence of SEQ ID NO: 8. In other words, it may be composed of an amino acid sequence having more than 99% sequence identity.
  • the antigen binding domain that specifically binds to HLA-G may be connected to the transmembrane domain by a hinge.
  • the hinge may be derived from the group consisting of the hinge of CD8 alpha, the hinge of IgG1, the hinge of IgG4, the hinge of IgD, the extracellular domain of IgG1 CH3, CD28, or a combination thereof, and specifically, derived from CD8 alpha. It may have happened.
  • the hinge derived from CD8 alpha may include the amino acid sequence of SEQ ID NO: 10, and specifically, at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 95% of the amino acid sequence of SEQ ID NO: 10. In other words, it may be composed of an amino acid sequence having more than 99% sequence identity.
  • the transmembrane domain is a domain that connects the antigen-binding domain and the intracellular signaling domain between the cell membrane.
  • the transmembrane domain is CD8 alpha, T cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD99, CD134, CD137 and CD154. It may be a transmembrane domain of a protein selected from the group consisting of alpha ( ⁇ ), beta ( ⁇ ), or zeta ( ⁇ ), and specifically may be the transmembrane domain of CD8 alpha.
  • the transmembrane domain of CD8 alpha may include the amino acid sequence of SEQ ID NO: 12, and specifically, at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 95% of the amino acid sequence of SEQ ID NO: 12. Preferably, it may be composed of an amino acid sequence having a sequence identity of 99% or more.
  • the intracellular signaling domain is a region that generates a signal that activates the immune response of immune cells when the antigen binding site of the extracellular domain binds to HLA-G.
  • the intracellular signaling domains include CD3 zeta ( ⁇ ), Fc ⁇ R, ICOS (Inducible T-cell costimulator, CD278), 4-1BB (CD137, TNFRSF9), OX40 (CD134), CD27, CD28, IL-2R ⁇ , IL- 15R- ⁇ , CD40, MyD88, DAP10 (DNAX-activating protein 10), DAP12, MHC class I molecule, TNF receptor (tumor necrosis factor receptor) protein, immunoglobulin-like protein, cytokine receptor, integrin, SLAM (Signaling lymphocytic) activation molecule) protein, activation NK cell receptor, BTLA (B and T Lymphocyte Attenuator), Toll ligand receptors (Toll-like receptors, TLRs), CD2, CD7, CD30, CD99, CDS, ICAM-1 (Intercellular adhesion molecule-1) ), B7-H3 (CD276), GITR (Glucocortico
  • the CD3 zeta ( ⁇ )-derived intracellular signaling domain may include the amino acid sequence of SEQ ID NO: 16, and specifically, at least 80%, preferably at least 90%, and more preferably at least 90% of the amino acid sequence of SEQ ID NO: 16. It may consist of an amino acid sequence having a sequence identity of 95% or more, most preferably 99% or more.
  • the intracellular signaling domain may additionally include a co-stimulatory domain to further activate immune cells and increase viability.
  • the co-stimulatory domain may be derived from a protein selected from the group consisting of OX40, CD2, CD27, CD28, CD99, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) and 4-1BB (CD137) , specifically, may be derived from 4-1BB.
  • the 4-1BB-derived co-stimulatory domain may include the amino acid sequence of SEQ ID NO: 14, and specifically, at least 80%, preferably at least 90%, and more preferably at least 95% of the amino acid sequence of SEQ ID NO: 14, Most preferably, it may be comprised of an amino acid sequence having 99% or more sequence identity.
  • the chimeric antigen receptor may include the amino acid sequence of SEQ ID NO: 18, SEQ ID NO: 20, or SEQ ID NO: 22, and specifically, the amino acid sequence of SEQ ID NO: 18, SEQ ID NO: 20, or SEQ ID NO: 22. It may consist of an amino acid sequence having sequence identity of at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 99%.
  • Another aspect of the invention is an isolated nucleic acid comprising a nucleotide sequence encoding the anti-HLA-G chimeric antigen receptor.
  • nucleic acid is meant to comprehensively include DNA and RNA molecules, and nucleotides, which are the basic structural units in nucleic acid molecules, include not only natural nucleotides but also analogues with modified sugar or base sites. Also included (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews (1990) 90:543-584).
  • sequence of the nucleic acid molecule encoding the anti-HLA-G chimeric antigen receptor of the invention may be modified, including the addition, deletion, or non-conservative or conservative substitution of nucleotides.
  • the isolated nucleic acid comprising a nucleotide sequence encoding the anti-HLA-G chimeric antigen receptor includes a nucleotide sequence encoding an antigen binding site that specifically binds to HLA-G.
  • the nucleotide sequence encoding the antigen binding site may include the nucleotide sequence of SEQ ID NO: 1, SEQ ID NO: 3, or SEQ ID NO: 5, and specifically, the nucleotide sequence of SEQ ID NO: 1, SEQ ID NO: 3, or SEQ ID NO: 5 and 80% It may be composed of a nucleotide sequence having a sequence identity of at least 90%, more preferably at least 95%, and most preferably at least 99%.
  • the isolated nucleic acid comprising a nucleotide sequence encoding the anti-HLA-G chimeric antigen receptor may include the nucleotide sequence of SEQ ID NO: 17, SEQ ID NO: 19, or SEQ ID NO: 21, and may include a specific A nucleotide sequence having a sequence identity of at least 80%, preferably at least 90%, more preferably at least 95%, and most preferably at least 99% with the nucleotide sequence of SEQ ID NO: 17, SEQ ID NO: 19, or SEQ ID NO: 21. It can be done.
  • Another aspect of the present invention is a recombinant vector containing the above nucleic acid molecule.
  • the vector used in the present invention may be a variety of vectors known in the art, and may include a promoter, terminator, enhancer, etc. depending on the type of host cell intended to produce the antigen receptor. Expression control sequences, sequences for membrane targeting or secretion, etc. can be appropriately selected and combined in various ways depending on the purpose.
  • Vectors can be easily introduced into host cells, such as mammalian, bacterial, yeast, or insect cells, by methods known in the art.
  • vectors can be delivered into host cells by physical, chemical, or biological means.
  • the physical means include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, etc.
  • Such chemical means include colloidal dispersion systems such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • the biological means include the use of DNA or RNA vectors, such as lentiviruses and retroviruses, as described above.
  • Vectors of the present invention include, but are not limited to, plasmid vectors, cosmid vectors, bacteriophage vectors, viral vectors, etc.
  • Suitable vectors include expression control elements such as promoters, operators, start codons, stop codons, polyadenylation signals, and enhancers, as well as signal sequences or leader sequences for membrane targeting or secretion, and can be prepared in various ways depending on the purpose.
  • a lenti-viral vector was used.
  • the vector further includes a promoter.
  • the promoter may be, for example, the EF-1 promoter, but is not limited thereto.
  • the present invention also provides an immune cell expressing the above-described anti-HLA-G chimeric antigen receptor on its cell surface.
  • the immune cells are selected from the group consisting of natural killer cells, T cells, natural killer T cells, B cells, macrophages, dendritic cells, natural killer dendritic cells, mast cells, and progenitor cells thereof. It can be.
  • the anti-HLA-G chimeric antigen receptor can be introduced into immune cells through the above-described vector, and the introduction method can be a suitable standard technique depending on the host cell, as known in the art.
  • T cells and NK cells expressing the chimeric antigen receptor are produced by infecting T cells and NK cells with a recombinant vector containing a polynucleotide capable of encoding an anti-HLA-G chimeric antigen receptor. did. Specifically, the anti-HLA-G chimeric antigen receptor coding sequence contained in the recombinant vector is transcribed into mRNA, and the anti-HLA-G chimeric antigen receptor polypeptide is translated from the mRNA and expressed on the surface of T cells and NK cells. If necessary, recombinant vectors can be used to culture infected T cells and NK cells.
  • Immune cells expressing anti-HLA-G chimeric antigen receptors can recognize HLA-G as an antigen and bind specifically to HLA-G, and after binding, induce activation of immune cells through intracellular signaling domains. Can induce tumor-specific death.
  • another aspect of the present invention provides a pharmaceutical composition for use in the prevention or treatment of cancer, comprising an immune cell and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition can be used for the treatment of cancer overexpressing HLA-G, but is not limited thereto.
  • the above cancers include pancreatic cancer, breast cancer, ovarian cancer, glioma, cervical cancer, endometrial cancer, esophageal cancer, stomach cancer, liver cancer, lung cancer, colon cancer, nasopharyngeal cancer, oral cancer, thyroid cancer, prostate cancer, kidney cancer, gallbladder cancer, bile duct cancer, and blood cancer. and melanoma.
  • the blood cancer is acute myeloid leukemia (AML), acute lymphoblastic leukemia (ALL), chronic myelogenous leukemia (CML), multiple myeloma (MM), or lymphoma ( Lymphoma).
  • AML acute myeloid leukemia
  • ALL acute lymphoblastic leukemia
  • CML chronic myelogenous leukemia
  • MM multiple myeloma
  • Lymphoma lymphoma
  • prevention refers to any action that suppresses or delays the progression of a disease by administering the composition of the present invention
  • treatment refers to suppressing, alleviating, or eliminating the development of a disease.
  • the pharmaceutical composition of the present invention may further include a pharmaceutically acceptable carrier, and the pharmaceutically acceptable carrier is one commonly used in formulations, such as lactose, dextrose, sucrose, sorbitol, mannitol, starch. , acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methylcellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, stear. Includes, but is not limited to, magnesium acid and mineral oil.
  • composition for preventing or treating cancer of the present invention may further include lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc. in addition to the above components.
  • lubricants wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc.
  • suitable pharmaceutically acceptable carriers and agents are described in detail in Remington's Pharmaceutical Sciences (19th ed., 1995).
  • the pharmaceutical composition according to the present invention can be administered by oral administration, infusion, intravenous injection, intramuscular injection, subcutaneous injection, intraperitoneal injectoon, or rectal administration. It may be administered by intrarectal administration, topical administration, intranasal injection, etc., but is not limited thereto.
  • oral compositions can be formulated to coat the active agent or protect it from degradation in the stomach, and the composition of the present invention can be used in any device through which the active agent can move to target cells. It can be administered by.
  • the appropriate dosage of the pharmaceutical composition of the present invention varies depending on factors such as formulation method, administration method, patient's age, weight, gender, pathological condition, food, administration time, administration route, excretion rate, and reaction sensitivity, and is usually A skilled doctor can easily determine and prescribe an effective dosage for desired treatment or prevention.
  • the composition preferably contains 1 to 10 times the number of immune cells expressing the chimeric antigen receptor according to the present invention as the number of tumor cells (e.g., pancreatic cancer, breast cancer, ovarian cancer, or glioma) in the treatment target, but is limited to this. It doesn't work.
  • the pharmaceutical composition of the present invention reduces the number of immune cells (e.g., T cells or natural killer cells) within a single dose to the tumor cells in the treatment target, such as pancreatic cancer cells, breast cancer cells, etc. It may be contained in 1 to 10 times the number of cells, ovarian cancer cells, or glioma cells.
  • immune cells e.g., T cells or natural killer cells
  • the term “pharmaceutically effective amount” refers to an amount sufficient to treat, prevent, and diagnose a disease.
  • the pharmaceutical composition of the present invention is prepared in unit dosage form by formulating using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by a person skilled in the art to which the present invention pertains. Alternatively, it can be manufactured by placing it in a multi-capacity container. At this time, the formulation may be in the form of a solution, suspension, or emulsion in an oil or aqueous medium, or may be in the form of an extract, powder, suppository, powder, granule, tablet, or capsule, and may additionally contain a dispersant or stabilizer.
  • composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents.
  • Another aspect of the present invention is administering the anti-HLA-G chimeric antigen receptor of the present invention, the immune cell expressing the chimeric antigen receptor, or the pharmaceutical composition in a pharmaceutically effective amount to a subject, such as a human or a non-human mammal. It is a method for diagnosing, preventing, or treating diseases related to HLA-G overexpression, such as cancer, including.
  • the present invention also includes the step of administering the anti-HLA-G chimeric antigen receptor of the present invention or an immune cell expressing the chimeric antigen receptor to an individual in need, such as a human or non-human mammal, HLA-G
  • a method for diagnosing diseases related to G overexpression, such as cancer, is provided.
  • the term "individual” refers to monkeys, cows, horses, sheep, pigs, chickens, turkeys, quail, cats, dogs, mice, rats, including humans who have or may develop diseases related to HLA-G overexpression. Means any animal, including rabbits or guinea pigs.
  • the chimeric antigen receptor according to the present invention has excellent specificity and affinity for HLA-G
  • immune cells expressing the anti-HLA-G chimeric antigen receptor have excellent cytotoxicity against cancer cells and are associated with high expression of HLA-G. It can be used to treat various cancers, etc.
  • HLA-G CAR antibody fragment 1 CAR
  • HLA-G CAR antibody fragment 2 CAR
  • HLA-G CAR antibody fragment 3 CAR
  • FIGS. 2A to 2C show pLV-EF1A-HLA-G CAR (antibody fragment 1 CAR), pLV-EF1A-HLA-G CAR (antibody fragment 2 CAR), and pLV-EF1A-HLA-G CAR (antibody fragment 2 CAR) of the present invention.
  • This is a diagram showing the structure of the fragment 3 CAR) plasmid.
  • Figure 3 is a diagram showing the structure of the pLV-EF1A-B2M-IRES-HLA-G-CMV-EGFP-T2A-PuroR plasmid of the present invention.
  • Figure 4 is a diagram confirming the HLA-G expression rate in the SK-OV-3-HLA-G and MDA-MB-231-HLA-G overexpressing cell lines of the present invention.
  • Figures 5A to 5C are diagrams confirming the expression rate of CAR on the surface of anti-HLA-G CAR expressing T cells of the present invention.
  • 6A to 6C show anti-HLA-G CAR expression of the present invention on SK-OV-3-HLA-G, MDA-MB-231-HLA-G, SK-OV-3 and MDA-MB-231 cell lines. This diagram shows the anti-cancer efficacy of T cells.
  • Figure 7 shows the anti-HLA-G CAR expression T cells of the present invention against SK-OV-3-HLA-G, MDA-MB-231-HLA-G, SK-OV-3 and MDA-MB-231 cell lines. The activity was confirmed by the secretion of interferon gamma.
  • Figure 8 is a diagram confirming the expression rate of CAR on the surface of anti-HLA-G CAR expressing T cells cultured with the addition of IL-2 and IL-7/IL-15 cytokines in the present invention.
  • Figure 9 shows SK-OV-3-HLA-G and SK-OV-3 of anti-HLA-G CAR expressing T cells cultured with IL-2 and IL-7/IL-15 cytokines, respectively. This diagram shows the anticancer efficacy against cell lines.
  • Figure 10 shows SK-OV-3-HLA-G and SK-OV-3 of anti-HLA-G CAR expressing T cells cultured with IL-2 and IL-7/IL-15 cytokines, respectively. This diagram shows that activity against cell lines was confirmed by secretion of interferon gamma.
  • Figure 11 is a diagram confirming the expression rates of CD3 and CD56 in NK cells expressing anti-HLA-G CAR of the present invention.
  • Figure 12 is a diagram confirming the expression rate of CAR on the surface of NK cells expressing anti-HLA-G CAR of the present invention.
  • Figure 13 is a diagram showing the anticancer efficacy of NK cells expressing the anti-HLA-G CAR of the present invention against SK-OV-3-HLA-G and SK-OV-3 cell lines.
  • Example 1 Cell lines and culture
  • the human ovarian cancer cell line SK-OV-3 and the human triple negative breast cancer cell line MDA-MB-231 were supplied from the Korea Cell Line Bank (Korea).
  • SK-OV-3 and MDA-MB-231 were cultured in RPMI 1640 (Gibco, USA) medium containing 10% FBS (Gibco, USA) and 1% Antibiotic-Antimycotic (Gibco, USA).
  • Lentivirus for delivery of the B2M-HLA-G-EGFP-PuroR gene was produced using plasmid DNA transformation.
  • TransIT-293 Transfection Reagent (Mirus Bio LLC, USA) was used and performed according to the manufacturer's protocol. The day before the experiment , 5 ⁇ 10 6 cells of the Lenti- ), gag-pol expression vector and VSV-G envelope expression vector were transformed. After culturing the cells for about 72 hours, all cell supernatants were harvested. The supernatant was filtered through a 0.45 um filter (Millipore, USA) to remove cell debris, and the filtrate containing B2M-HLA-G-EGFP-PuroR lentivirus was stored frozen at -80°C until use. .
  • the cells were subcultured in a 96-well plate at a concentration of 0.5 cells/well to separate the HLA-G overexpressing cells into single cells.
  • puromycin was added to the medium at a concentration of 0.5 ug/mL.
  • a fluorescence microscope By observing with a fluorescence microscope, several wells with high EGFP fluorescence signals were selected, and when the wells were filled with cells, the cells were recovered and cultured in order in 48-well, 24-well, 12-well, 6-well, T25, and T75 flasks. Finally, cells were cultured in a T175 flask to produce a cell stock.
  • HLA-G in the HLA-G overexpressing cell line prepared in 2-2 above was confirmed as follows.
  • B2M-HLA-G-EGFP-PuroR gene expression Cell samples were prepared by suspending 5 cells of SK-OV-3 and MDA-MB-231 cell lines 1 ⁇ 10 in 100 uL D-PBS (Gibco, USA). 1 ug of anti-HLA-G (TANKIO17) antibody was added to the cell sample and reacted at 4°C for 30 minutes. After the reaction was completed, the cells were washed twice with D-PBS and resuspended.
  • the chimeric antigen receptor (CAR) of the present invention was artificially synthesized.
  • CAR was produced by artificially synthesizing the following extracellular domain and intracellular domain coding sequences through SOE-PCR (Splicing by overlap extension PCR) ( Figures 1a to 1c).
  • the PCR product was digested with MluI and XbaI and then inserted into the MluI and
  • CD8 ⁇ -derived signal sequence leader sequence, LS
  • HLA-G binding domain antibody fragment 1, antibody fragment 2, or antibody fragment 3
  • scFv CD8 ⁇ -derived hinge
  • CD8 ⁇ -derived transmembrane , TM CD8 ⁇ -derived transmembrane
  • Intracellular domain intracellular signaling domain of 4-1BB and CD3 ⁇
  • Chimeric antigen receptors according to an example of the present invention are summarized in Table 1 below.
  • the domains of the chimeric antigen receptor are connected to each other in tandem and in frame.
  • CD8 ⁇ -derived signal sequence HLA-G binding domain (scFv form), CD8 ⁇ -derived hinge, CD8 ⁇ -derived transmembrane domain, 4-1BB-derived intracellular signaling domain, CD3 ⁇ -derived intracellular signaling domain and stop codon ( TAA, a stop codon, is connected.
  • HLA-G CAR lentiviral vectors include: Antibody Fragment 1, Antibody Fragment 2, or Antibody Fragment 3. After transfection, the cells were cultured for about 72 hours, and after completion of culture, all cell supernatants were harvested. The supernatant was filtered through a 0.45 um filter (Millipore, USA) to remove cell fragments. Lentivirus was concentrated approximately 100 times using Lenti-X TM Concentrator (Clontech, USA) according to the manufacturer's protocol and stored frozen at -80°C until use.
  • PBMC Peripheral blood mononuclear cells
  • SepMate TM -50 SemMate TM -50 (STEMCELL technology, Canada) and Ficoll-Paque PLUS (GE healthcare, Sweden).
  • positive selection was performed using QuadroMACS TM Separator (Miltenyi Biotec, Germany), LS column (Miltenyi Biotec, Germany), human CD4 MicroBeads (Miltenyi Biotec, Germany), and human CD8 MicroBeads (Miltenyi Biotec, Germany). Human T cells were isolated using this method.
  • Human T cells were activated using TexMACS TM medium (Miltenyi Biotec, Germany) as a culture medium and adding T Cell TransAct TM , human (Miltenyi Biotec, Germany). For the growth of T cells, 100 U/mL of human IL-2 (R&D systems, USA) was added to the culture medium. After 48 hours of culture, activated T cells were harvested and used for lentiviral delivery.
  • Activated human T cells with lentivirus at an MOI (Multiplicity of infection) of about 3 were added at 1x10 6 per well in a 12-well plate, and the culture medium was made to be 2.5 mL.
  • Lentivirus was delivered to T cells by centrifugation at 1,000 xg for 15 minutes. T cells were cultured for 48 hours and then replaced with fresh medium.
  • the transduced human T cells were subcultured at 5x10 5 per mL at intervals of 2 to 3 days, and the cell number was maintained not to exceed 2x10 6 per mL.
  • human T cells were cultured by adding 100 U/mL of IL-2 (R&D systems, USA) to the culture medium.
  • anti-HLA-G CAR was expressed on the cell surface in anti-HLA-G CAR expressing T cells produced from white blood cells obtained from three donors.
  • 1x10 5 cells were harvested and suspended in 100 uL D-PBS to prepare a cell suspension.
  • PE fluorescence was conjugated to the B2M-HLA-G antigen used to produce anti-HLA-G antibodies using a PE conjugation kit (Abcam, USA).
  • the B2M-HLA-G antigen-PE conjugate was added to the cell suspension and reacted at 4°C for 30 minutes. After completion of the reaction, the cells were washed twice with D-PBS, and the expression level of anti-HLA-G CAR was confirmed by flow cytometry.
  • Example 5 In vitro ( in vitro ) confirmed the anti-cancer efficacy of anti-HLA-G CAR expressing T cells
  • Target cells were added to a 48 well plate at 1x10 5 cells/150 uL per well.
  • Cytotoxicity (%) 100- ⁇ (Number of EGFP + cells after co-culture of target cells and effector cells/Number of EGFP + cells after culture of target cells alone) x 100 ⁇
  • T cells expressing three types of anti-HLA-G CAR (antibody fragment 1 CAR), anti-HLA-G CAR (antibody fragment 2 CAR), and anti-HLA-G CAR (antibody fragment 3 CAR) produced from white blood cells of donor 2
  • the anticancer efficacy against HLA-G overexpressing MDA-MB-231-HLA-G cell line was significantly higher than that of control T cells not expressing anti-HLA-G CAR.
  • the MDA-MB-231 cell line which does not express HLA-G, there was no difference in killing ability between the three types of anti-HLA-G CAR expressing T cells and control T cells (Figure 6b).
  • T cells expressing three types of anti-HLA-G CAR (antibody fragment 1 CAR), anti-HLA-G CAR (antibody fragment 2 CAR), and anti-HLA-G CAR (antibody fragment 3 CAR) produced from white blood cells of donor 5
  • the anticancer efficacy against HLA-G overexpressing SK-OV-3-HLA-G and MDA-MB-231-HLA-G cell lines was also significantly higher than that of control T cells not expressing anti-HLA-G CAR.
  • there was no difference in killing ability between the three types of anti-HLA-G CAR expressing T cells and control T cells against SK-OV-3 and MDA-MB-231 cell lines that do not express HLA-G (Figure 6c).
  • anti-HLA-G CAR expressing T cells have a high killing ability specifically only against cells that highly express HLA-G.
  • Cell supernatants were harvested from the experimental group in which anti-HLA-G CAR expressing T cells produced by donor 5 and control T cells were treated with target cells at an E:T ratio of 1:1.
  • the concentration of interferon gamma was measured in the harvested supernatant using the Human IFN-gamma Quantikine ELISA Kit (R&D systems, USA).
  • Example 6 In vitro ( in vitro ) Comparison of anticancer efficacy of anti-HLA-G CAR expressing T cells according to T cell culture conditions
  • Anti-HLA-G CAR antibody fragment 2 CAR
  • T cells were produced in the manner previously mentioned in Example 4-2.
  • human IL-2 R&D systems, USA
  • IL-7 Miltenyi Biotec, Germany
  • IL-15 Miltenyi Biotec, Germany
  • anti-HLA-G CAR was found on the surface of anti-HLA-G CAR expressing T cells cultured with IL-2 in the culture medium.
  • G CAR was expressed at approximately 48.3%
  • anti-HLA-G CAR was expressed at approximately 47.9% on the surface of anti-HLA-G CAR expressing T cells cultured with IL-7 and IL-15 in the culture medium.
  • anti-HLA-G CAR expressing T cells As a result of confirming anticancer efficacy by co-culturing anti-HLA-G CAR expressing T cells and target cells, anti-HLA-G CAR expressing T cells ( The anticancer efficacy of anti-HLA-G CAR expressing T cells (IL-2) and anti-HLA-G CAR (IL-7/IL-15) was similarly excellent. On the other hand, the killing ability was significantly low for the SK-OV-3 cell line, which does not express HLA-G, and there was no difference in killing ability between the two types of anti-HLA-G CAR expressing T cells (Figure 9).
  • Cell supernatants were harvested from the experimental group in which anti-HLA-G CAR expressing T cells were treated with target cells at an E:T ratio of 1:1, and the concentration of interferon gamma was measured using the Human IFN-gamma Quantikine ELISA Kit (R&D systems, USA). Measured.
  • anti-HLA-G CAR expressing T cells IL-2
  • anti-HLA-G CAR expressing T cells IL-7/IL-15
  • SK-OV-3-HLA overexpressing HLA-G Only when the -G target cell line was co-cultured, the secretion of interferon gamma was significantly increased, and it was confirmed that there was little difference between the two types of anti-HLA-G CAR expressing T cells (FIG. 10).
  • PBMC Peripheral blood mononuclear cells
  • SepMate TM -50 SemMate TM -50 (STEMCELL technology, Canada) and Ficoll-Paque PLUS (GE healthcare, Sweden).
  • human NK (natural killer) cells were isolated by negative selection using an NK cell isolation kit (Miltenyi Biotec, Germany).
  • NK MACS ® Medium (Miltenyi Biotec, Germany) was used as a culture medium.
  • NK cells For efficient growth of NK cells, 5% GemCell TM Human Serum AB (GeminiBio, USA), 500 U/mL each of human IL-2 (R&D systems, USA) and IL-15 (Miltenyi Biotec, Germany) were added to the culture medium. It was added at a concentration of 140 U/mL and cultured.
  • RetroNectin ® (Takara, Japan) and BX-795 (Sigma-aldrich, USA) were used. Lentivirus with an MOI of about 10 was placed in a 24-well plate coated with RetroNectin, and the lentivirus was adsorbed according to the manufacturer's protocol. 5x10 5 NK cells on the 10th day of culture were treated with 2.5 uM of BX-795 for 30 minutes. Afterwards, BX-795-treated NK cells were added to the lentivirus-adsorbed plate and centrifuged at 1,000 xg for 15 minutes to transfer the lentivirus to the NK cells. Afterwards, NK cells were cultured for 24 hours and then replaced with new medium. The transduced human NK cells were subcultured appropriately at intervals of 3 to 4 days.
  • a cell suspension was prepared by suspending them in 100 uL D-PBS.
  • VioBlue-conjugated CD3 antibody (Miltenyi Biotec, Germany) and FITC-conjugated CD56 antibody (Miltenyi Biotec, Germany) were added to the cell suspension and reacted at 4°C for 30 minutes. After the reaction, the cells were washed twice with D-PBS, and the expression levels of CD3 and CD56 were confirmed by flow cytometry.
  • the proportion of NK cells that were CD3 - CD56 + was 99.1% in control NK cells, 99.1% in NK cells that delivered the anti-HLA-G CAR (antibody fragment 1 CAR) gene, and 99.1% in NK cells that delivered the anti-HLA-G CAR (antibody fragment 1 CAR) gene.
  • 2 CAR) gene-transferred NK cells were 98.9%, and anti-HLA-G CAR (antibody fragment 3 CAR) gene-transferred NK cells were 98.9%, confirming that almost all cells were CD3 - CD56 + NK cells ( Figure 11 ).
  • anti-HLA-G CAR was about 18.8% on the surface of NK cells that delivered the anti-HLA-G CAR (antibody fragment 1 CAR) gene, and NK cells that delivered the anti-HLA-G CAR (antibody fragment 2 CAR) gene were about 18.8%. It was confirmed that anti-HLA-G CAR was expressed by about 25.5% on the surface of cells, and about 22.4% of anti-HLA-G CAR was expressed on the surface of NK cells to which anti-HLA-G CAR (antibody fragment 3 CAR) gene was delivered. (Figure 12).

Abstract

본 발명은 면역관문인 HLA-G에 특이적으로 결합하는 항원 결합 부위를 포함하는 키메라 항원 수용체, 상기 수용체가 도입된 면역세포 및 이들의 용도에 관한 것이다. 상기 면역세포는 면역관문을 발현하는 암세포를 효율적으로 제거할 수 있고, 그에 따라 면역관문에 의해 억제되어 있던 내인성 면역세포들의 활성화도 기대할 수 있기 때문에 HLA-G와 관련된 다양한 암 질환의 면역 치료 방법으로서 유용하게 사용될 수 있다.

Description

항-HLA-G 키메라 항원 수용체 및 이의 용도
본 발명은 HLA-G에 특이적으로 결합하는 항원 결합 도메인을 포함하는 키메라 항원 수용체, 상기 수용체가 도입된 면역세포 및 이들의 용도에 관한 것이다.
암을 치료하기 위한 방법은 꾸준한 발전과 변화 과정을 거쳐 왔으며, 외과적 수술, 화학요법, 방사선 요법 등의 방법이 현재까지 계속 이용되고 있다. 그러나 이러한 기존의 암 치료 방법들은 암이 전이되지 않은 초기 상태에만 효과가 있는 경우가 대부분이며, 이미 전이가 진행된 상태에서는 예컨대 외과적 수술을 하더라도 추후 재발의 가능성이 높다는 문제점이 있다. 이에, 최근 암을 치료하기 위해 면역 반응을 이용하는 방법에 대한 연구가 계속되어 오고 있다.
그 중에서도 면역세포를 이용하여 면역 반응을 강화시키거나 면역세포를 유전공학적으로 변형하여 다시 환자에게 주입하는 세포치료 방법에 대한 관심이 높아지고 있다. 후자의 방법에는 키메라 항원 수용체(chimeric antigen receptor, CAR)-T 세포가 많이 연구되고 있다. CAR-T 세포는 T 세포에 인공적으로 설계된 CAR 분자를 도입하여 T 세포에 표적 기능을 부여한 세포로 CAR 분자가 특정 종양 항원에 대해 특이성을 보이므로 종양 세포만을 제거할 수 있다.
일반적으로 키메라 항원 수용체 (CAR)는 세포외 항원 결합 도메인, 막관통 도메인 및 세포내 신호전달 도메인을 포함한다. 세포외 항원 결합 도메인은 확인된 종양 항원을 표적으로 하는 단일 사슬 가변 단편(single-chain variable fragment; scFv)을 포함할 수 있다.
한편, 인간 주요 조직적합성 항원, 클래스 I, G (histocompatibility antigen, class I, G)는 인간 백혈구 항원 G (Human leukocyte antigen-G, HLA-G)로도 알려져 있는 면역관문인자로 T 세포, NK 세포, 세포독성 (cytotoxic) T 세포 등의 활성 및 분열을 억제한다. HLA-G의 면역세포 수용체는 ILT2 (Ig-like transcript 2), ILT4, KIR2DL4 (Killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4) 등으로 알려져 있으며, 이 수용체들은 모두 ITIM 모티프 (immunoreceptor tyrosine-based inhibitory motif)를 가지고 있다. HLA-G가 수용체에 결합하면 이 모티프로 인해 면역세포를 억제하는 신호전달체계가 활성화된다.
일반세포에서 HLA-G의 발현은 제한적이나, 많은 종류의 암세포에서 HLA-G가 발현되는 것으로 보고되었다 (Lin A, Yan WH. Human Leukocyte Antigen-G (HLA-G) Expression in Cancers: Roles in Immune Evasion, Metastasis and Target for Therapy. Mol. Med. 21(1), 782-791 (2015)). 또한, 다수 암환자의 암세포에서 HLA-G의 발현량과 암 질병의 기수가 연관성이 있다는 보고가 있으며, HLA-G 발현 환자는 생존률이 낮다는 보고도 있다 (Ye, Sr., Yang, H., Li, K. et al. Human leukocyte antigen G expression: as a significant prognostic indicator for patients with colorectal cancer. Mod. Pathol. 20, 375-383 (2007)).
본 발명자들은 HLA-G (Human leukocyte antigen-G) 발현과 관련된 질환을 효과적으로 치료할 수 있는 키메라 항원 수용체 및 이를 포함하는 면역세포를 개발하고자 예의 연구 노력하였다. 그 결과 HLA-G에 특이적으로 결합하는 항-HLA-G 키메라 항원 수용체 및 상기 키메라 항원 수용체를 발현하는 T 세포와 NK 세포를 제작하였다. 또한, 해당 T 세포 및 NK 세포가 HLA-G를 발현하는 세포주에 대해 높은 항암 활성을 나타내는 것을 확인하여 본 발명을 완성하게 되었다.
따라서, 본 발명의 목적은 항-HLA-G 키메라 항원 수용체 및 상기 수용체를 발현하는 면역세포를 제공하는 것이다.
본 발명의 다른 목적은 항-HLA-G 키메라 항원 수용체를 암호화하는 뉴클레오티드를 포함하는 핵산 및 상기 핵산을 포함하는 벡터를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 면역세포 및 약학적으로 허용되는 담체를 포함하는 약학적 조성물을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명의 일 양태는 HLA-G (human leukocyte antigen-G)에 특이적으로 결합하는 항원 결합 도메인; 막관통 도메인; 및 세포내 신호전달 도메인;을 포함하는 항-HLA-G 키메라 항원 수용체를 제공한다.
본 발명의 일 구체예에서, 상기 HLA-G에 특이적으로 결합하는 항원 결합 도메인은 하기에서 선택되는 서열을 포함할 수 있다:
(a) 서열번호 31의 아미노산 서열을 갖는 중쇄 상보성 결정 부위 1 (complementarity determining region 1, CDR1), 서열번호 32의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 33의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 34의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 35의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 36의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역;
(b) 서열번호 37의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 38의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 39의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 40의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 41의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 42의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역; 또는
(c) 서열번호 43의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 44의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 45의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
서열번호 46의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 47의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 48의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역.
본 발명에서, 용어 "키메라 항원 수용체"는 면역세포 (예를 들어, T 세포)가 특정한 단백질을 인식할 수 있도록 면역세포의 수용체 부위와 암세포 표면에서 발현되는 특정한 항원의 인식부위를 조합한 수용체 단백질이다. 이 수용체들은 키메라의 성질을 띠는데 일반적으로 종양이 발현하는 항원을 인식할 수 있는 항원 결합 부위와 T 세포를 활성화시킬 수 있는 신호 전달 부위를 하나로 합치기 때문이다.
본 발명의 일 구체예에서, 상기 키메라 항원 수용체는 항원 결합 도메인 막관통 도메인 및 세포내 신호전달 도메인을 포함한다. 상기 항원 결합 도메인은 타깃 세포의 HLA-G를 인식하며, 항체 또는 항체 단편일 수 있다. 또한, 상기 항원 결합 단편은 scFv일 수 있으나 이에 제한되지 않는다.
본 발명의 일 구체예에서, 상기 항원 결합 부위는 중쇄 가변 영역 서열과 경쇄 가변 영역 서열을 포함할 수 있으며, 두 서열은 서열번호 24의 아미노산 서열을 포함하는 링커에 의해 연결될 수 있다. 따라서, 상기 항원 결합 부위는 scFv (single-chain fragment variable) 형태일 수 있다.
본 발명에서, 용어 "중쇄"는, 항원에 대한 특이성을 부여하기 위해 충분한 가변 영역의 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3 개의 불변 영역 도메인인 CH1, CH2 및 CH3을 포함하는 전체 길이 중쇄 및 이의 단편을 모두 일컫는다.
본 발명에서, 용어 "경쇄"는, 항원에 특이성을 부여하기 위해 충분한 가변영역의 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전체 길이 경쇄 및 이의 단편을 모두 일컫는다.
본 발명의 일 구체예에서, 상기 항원 결합 도메인은 서열번호 2, 서열번호 4 또는 서열번호 6의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 2, 서열번호 4 또는 서열번호 6의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열동일성을 가지는 아미노산 서열로 이루어질 수 있다.
또한, 상기 항원 결합 도메인은
(a) 서열번호 25의 아미노산 서열 또는 서열번호 25에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 26의 아미노산 서열 또는 서열번호 26에 80% 이상의 상동성을 포함하는 경쇄 가변 영역;
(b) 서열번호 27의 아미노산 서열 또는 서열번호 27의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 28의 아미노산 서열 또는 서열번호 28의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변 영역; 또는
(c) 서열번호 29의 아미노산 서열 또는 서열번호 29의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 중쇄 가변 영역 및 서열번호 30의 아미노산 서열 또는 서열번호 30의 아미노산 서열에 80% 이상의 상동성을 가지는 아미노산 서열을 포함하는 경쇄 가변 영역;을 포함할 수 있다.
상기 키메라 항원 수용체는 신호 서열 (leader sequence, LS)을 추가로 포함할 수 있다. 신호 서열은 키메라 항원 수용체를 세포막으로 이동시켜 세포 표면에 발현노출될 수 있도록 하는 서열을 말한다.
본 발명의 일 구현예에서, 상기 신호 서열은 CD8 알파, 인간 면역글로불린 중쇄 또는 hGM-CSF 수용체 알파-사슬 유래 신호 서열일 수 있으며, 구체적으로는 CD8 알파 유래 신호 서열일 수 있다.
상기 CD8 알파 유래 신호 서열은 서열번호 8의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 8의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열동일성을 가지는 아미노산 서열로 이루어질 수 있다.
본 발명의 키메라 항원 수용체에서 상기 HLA-G에 특이적으로 결합하는 항원 결합 도메인은 힌지에 의해 막관통 도메인과 연결될 수 있다. 상기 힌지는 힌지는 CD8 alpha의 힌지, IgG1의 힌지, IgG4의 힌지, IgD의 힌지, IgG1 CH3, CD28의 세포외 도메인 또는 이들의 조합으로 이루어진 군에서 유래될 수 있으며, 구체적으로는 CD8 알파에서 유래된 것일 수 있다. CD8 알파에서 유래된 힌지는 서열번호 10의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 10의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열동일성을 가지는 아미노산 서열로 이루어질 수 있다.
본 발명의 키메라 항원 수용체에서 막관통 도메인 (transmembrane domain, TM)은 항원 결합 도메인과 세포내 신호전달 도메인을 세포막 사이로 연결하는 도메인이다. 상기 막관통 도메인은 CD8 알파, T 세포 수용체, CD28, CD3 엡실론(epsilon), CD45, CD4, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD99, CD134, CD137 및 CD154의 알파(α), 베타(β) 또는 제타(ζ)로 이루어진 군으로부터 선택되는 단백질의 막관통 도메인일 수 있으며, 구체적으로는 CD8 알파의 막관통 도메인인 일 수 있다.
상기 CD8 알파의 막관통 도메인은 서열번호 12의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 12의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열동일성을 가지는 아미노산 서열로 이루어질 수 있다.
본 발명의 키메라 항원 수용체에서 세포내 신호전달 도메인(intracellular signaling domain, ICD)은 세포외 도메인의 항원 결합 부위가 HLA-G에 결합하면 면역세포의 면역 반응을 활성화 시키는 신호를 발생시키는 부위이다.
상기 세포내 신호전달 도메인은 CD3 제타(ζ), FcγR, ICOS (Inducible T-cell costimulator, CD278), 4-1BB (CD137, TNFRSF9), OX40 (CD134), CD27, CD28, IL-2Rβ, IL-15R-α, CD40, MyD88, DAP10 (DNAX-activating protein 10), DAP12, MHC 클래스 I 분자, TNF 수용체 (tumor necrosis factor receptor) 단백질, 면역글로불린-유사 단백질, 사이토카인 수용체, 인테그린, SLAM (Signaling lymphocytic activation molecule) 단백질, 활성화 NK 세포 수용체, BTLA (B and T Lymphocyte Attenuator), Toll 리간드 수용체 (Toll-like receptors, TLRs), CD2, CD7, CD30, CD99, CDS, ICAM-1 (Intercellular adhesion molecule-1), B7-H3 (CD276), GITR (Glucocorticoid-induced TNFR-related protein), BAFFR (BAFF (B-cell activating factor)-receptor), LIGHT, HVEM (LIGHTR), KIRDS2 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2), SLAMF7 (SLAM Family Member 7), NKp80 (KLRF1 (killer cell lectin-like receptor subfamily F, member 1)), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, IL2Rγ, IL7Rα, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6 (integrin Subunit Alpha 6), VLA-6, CD49f, ITGAD (integrin subunit alpha D), CD11d, ITGAE (integrin subunit alpha E), CD103, ITGAL (integrin subunit alpha L), CD11a, LFA-1 (lymphocyte function-associated antigen-1; CD11a/CD18), ITGAM (integrin subunit alpha M), CD11b, ITGAX (integrin subunit alpha X), CD11c, ITGB1 (integrin beta-1), CD29, ITGB2 (integrin beta-2), CD18, ITGB7 (integrin beta-7), NKG2D (KLRK1 (killer cell lectin like receptor K1), NKG2C (KLRC2 (Killer Cell Lectin Like Receptor C2)), TNFR2 (Tumor necrosis factor receptor 2), TRANCE (receptor activator of NF-kappa B ligand; RANKL (receptor activator of nuclear factors κB ligand)), DNAM1 (DNAX accessory molecule-1, CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1 (carcinoembryonic antigen-related cell adhesion molecule 1), CRTAM (cytotoxic and regulatory T cell molecule), Ly9 (CD229), CD160 (BY55), PSGL1 (P-selectin glycoprotein Ligand 1, CD162), CD100 (SEMA4D (Semaphorin 4D)), CD69, SLAMF6 (NTB-A (NK-T-B-antigen)), Ly108), SLAMF1 (CD150, IPO-3), BLAME (SLAMF8), LTBR (lymphotoxin-beta receptor), LAT (Linker For Activation Of T Cells), GADS (glutamate decarboxylase), SLP-76 (Src homology 2 (SH2) domain-containing leukocyte phosphoprotein of 76-kDa), PAG/Cbp, CD19a, 및 CD83 특이적 리간드로 이루어진 군에서 선택되는 단백질에서 유래될 수 있으며, 구체적으로는 CD3 제타(ζ) 유래 세포내 신호전달 도메인일 수 있다.
상기 CD3 제타(ζ) 유래 세포내 신호전달 도메인은 서열번호 16의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 16의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열동일성을 가지는 아미노산 서열로 이루어질 수 있다.
또한, 상기 세포내 신호전달 도메인은 면역세포를 보다 더 활성화시키고 생존력을 높이기 위해 공동자극 도메인으로 추가로 포함할 수 있다. 상기 공동자극 도메인은 OX40, CD2, CD27, CD28, CD99, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 단백질에서 유래될 수 있으며, 구체적으로는 4-1BB에서 유래된 것일 수 있다.
상기 4-1BB 유래 공동자극 도메인은 서열번호 14의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 14의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 가지는 아미노산 서열로 이루어질 수 있다.
본 발명의 일 구체예에서, 상기 키메라 항원 수용체는 서열번호 18, 서열번호 20 또는 서열번호 22의 아미노산 서열을 포함할 수 있으며, 구체적으로는 서열번호 18, 서열번호 20 또는 서열번호 22의 아미노산 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 가지는 아미노산 서열로 이루어질 수 있다.
본 발명의 또 다른 양태는 상기 항-HLA-G 키메라 항원 수용체를 암호화하는 뉴클레오티드 서열을 포함하는 단리된 핵산이다.
본 명세서에서 사용되는 용어, "핵산"은 DNA 및 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오티드는 자연의 뉴클레오티드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다 (Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews(1990) 90:543-584). 본 발명의 항-HLA-G 키메라 항원 수용체를 암호화하는 핵산 분자의 서열은 변형될 수 있으며, 상기 변형은 뉴클레오티드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 일 구체예에서, 상기 항-HLA-G 키메라 항원 수용체를 암호화하는 뉴클레오티드 서열을 포함하는 단리된 핵산은 HLA-G에 특이적으로 결합하는 항원 결합 부위를 암호화하는 뉴클레오티드 서열을 포함한다. 상기 항원 결합 부위를 암호화하는 뉴클레오티드 서열은 서열번호 1, 서열번호 3 또는 서열번호 5의 뉴클레오티드 서열을 포함할 수 있으며, 구체적으로는 서열번호 1, 서열번호 3 또는 서열번호 5의 뉴클레오티드 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 가지는 뉴클레오티드 서열로 이루어질 수 있다.
본 발명의 일 구체예에서, 상기 항-HLA-G 키메라 항원 수용체를 암호화하는 뉴클레오티드 서열을 포함하는 단리된 핵산은 서열번호 17, 서열번호 19 또는 서열번호 21의 뉴클레오티드 서열을 포함할 수 있으며, 구체적으로는 서열번호 17, 서열번호 19 또는 서열번호 21의 뉴클레오티드 서열과 80% 이상, 바람직하게는 90% 이상, 더욱 바람직하게는 95% 이상, 가장 바람직하게는 99% 이상의 서열 동일성을 가지는 뉴클레오티드 서열로 이루어질 수 있다.
본 발명의 또 다른 양태는 상기 핵산 분자를 포함하는 재조합 벡터이다.
본 발명에서 사용되는 벡터는 당 분야에 공지된 벡터를 다양하게 사용할 수 있고, 상기 항원 수용체를 생산하고자 하는 숙주세포의 종류에 따라 프로모터 (promoter), 종결자 (terminator), 인핸서 (enhancer) 등과 같은 발현조절 서열, 막 표적화 또는 분비를 위한 서열 등을 적절히 선택하고 목적에 따라 다양하게 조합할 수 있다.
본 발명의 벡터를 세포 내로 도입하고 발현시키는 방법은 관련 기술분야에 잘 알려져 있다. 벡터는 당업계에 공지된 방법에 의해 숙주 세포, 예를 들어 포유동물, 박테리아, 효모, 또는 곤충 세포 내로 쉽게 도입될 수 있다. 예를 들면, 벡터는 물리적, 화학적, 또는 생물학적 수단에 의해 숙주 세포 내로 전달될 수 있다. 상기 물리적 수단은 인산칼슘 침전, 리포펙션, 입자 폭격(particle bombardment), 미세주입, 전기천공(electroporation) 등을 포함한다. 상기 화학적 수단은 콜로이드 분산액 시스템, 예컨대 거대분자 복합체, 나노 캡슐, 마이크로스피어, 비드, 및 수중유 에멀젼, 마이셀(micelle), 혼합된 마이셀, 및 리포좀을 포함하는 지질-기반 시스템을 포함한다. 또한, 상기 생물학적 수단은 상술한 렌티바이러스, 레트로바이러스 등, DNA 또는 RNA 벡터의 사용을 포함한다.
본 발명의 벡터는 플라스미드 벡터, 코즈미드 벡터, 박테리오 파아지 벡터 및 바이러스 벡터 등을 포함하나 이에 제한되지 않는다. 적합한 벡터는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 폴리아데닐화 시그널 및 인핸서 같은 발현 조절 요소 외에도 막 표적화 또는 분비를 위한 시그널 서열 또는 리더 서열을 포함하며 목적에 따라 다양하게 제조될 수 있다.
본 발명의 일 구체예에서는 렌티-바이러스 벡터를 사용하였다. 본 발명의 구체적인 일 구현예에 있어서, 상기 벡터는 프로모터를 추가로 포함한다. 상기 프로모터는 예컨대 EF-1 프로모터일 수 있으나, 이에 한정되는 것은 아니다.
본 발명은 또한 전술한 항-HLA-G 키메라 항원 수용체를 세포 표면에 발현하는 면역세포를 제공한다.
본 발명에서 상기 면역세포는 자연 살해 세포 (natural killer cell), T 세포, 자연 살해 T 세포, B 세포, 대식세포, 수지상 세포, 자연 살해 수지상 세포, 비만세포 및 이들의 전구세포로 이루어진 군으로부터 선택될 수 있다.
상기 항-HLA-G 키메라 항원 수용체는 전술한 벡터를 통해 면역세포에 도입될 수 있으며, 도입 방법은 당 분야에서 공지된 바와 같이 숙주 세포에 따라 적합한 표준 기술을 선택할 수 있다.
본 발명의 일 구체예에서는 항-HLA-G 키메라 항원 수용체를 암호화할 수 있는 폴리뉴클레오티드를 포함하는 재조합 벡터를 T 세포 및 NK 세포에 감염시켜 키메릭 항원 수용체를 발현하는 T 세포 및 NK 세포를 제작하였다. 구체적으로 재조합 벡터에 포함된 항-HLA-G 키메라 항원 수용체 암호화 서열이 mRNA로 전사되고, 상기 mRNA로부터 항-HLA-G 키메라 항원 수용체 폴리펩티드가 번역되어 T 세포 및 NK 세포의 표면에 발현된다. 필요한 경우 재조합 벡터가 감염된 T 세포 및 NK 세포를 배양할 수 있다.
항-HLA-G 키메라 항원 수용체를 발현하는 면역세포는 HLA-G를 항원으로 인식하여 HLA-G에 특이적으로 결합할 수 있으며, 결합 후 세포내 신호전달 도메인을 통해 면역세포의 활성화를 유도하고 종양 특이적 사멸을 유도할 수 있다.
따라서, 본 발명의 또 다른 양태는 면역세포 및 약학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료에서의 사용을 위한 약학적 조성물을 제공한다.
본 발명에서, 상기 약학적 조성물은 HLA-G를 과발현하는 암의 치료에 사용될 수 있으나 이에 제한되지 아니한다. 상기 암은 췌장암, 유방암, 난소암, 신경교종, 자궁경부암, 자궁내막암, 식도암, 위암, 간암, 폐암, 대장암, 비인두암, 구강암, 갑상선암, 전립선암, 신장암, 담낭암, 담관암, 혈액암 및 흑색종 등으로 이루어진 군에서 선택될 수 있다.
상기 혈액암은 급성 골수성 백혈병 (Acute Myeloid Leukemia, AML), 급성 림프모구 백혈병 (Acute Lymphoblastic Leukemia, ALL), 만성 골수성 백혈병 (Chronic Myelogenous Leukemia, CML), 다발골수종 (Multiple Myeloma, MM), 또는 림프종 (Lymphoma)일 수 있다.
본 명세서에서 사용되는 용어, "예방"은 본 발명의 조성물의 투여로 질환을 억제시키거나 진행을 지연시키는 모든 행위를 의미하며, "치료"는 질환의 발전의 억제, 경감 또는 제거를 의미한다.
본 발명의 약학 조성물은 약제학적으로 허용되는 담체를 추가로 포함할 수 있으며, 상기 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산칼슘, 알기네이트, 젤라틴, 규산칼슘, 미세결정성 셀룰로오스, 폴리비닐피롤리돈, 셀룰로오스, 물, 시럽, 메틸셀룰로오스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 암 예방 또는 치료용 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)]에 상세히 기재되어 있다.
또한, 본 발명에 따른 약학적 조성물은 경구투여, 주입(infusion), 정맥내 투여 (intravenous injection), 근육내 투여 (intramuscular injection), 피하 투여 (subcutaneous injection), 복강내 투여 (intraperitoneal injectoon), 직장내 투여 (Intrarectal administration), 국소 투여(topical administration), 비내 투여(intranasal injection) 등으로 투여될 수 있지만, 이에 한정되는 것은 아니다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화될 수 있으며, 본 발명의 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
본 발명의 약학 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성별, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 상기 조성물에는 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포의 수가 치료 대상 내의 종양 세포 (예컨대, 췌장암, 유방암, 난소암 또는 신경교종)수의 1배 내지 10배로 포함되는 것이 바람직하지만, 이에 한정되는 것은 아니다.
본 발명의 일 구체예에 따르면, 본 발명의 약학적 조성물은 1회 투여량 내에 상기 면역세포 (예컨대, T 세포 또는 자연 살해 세포)의 수가 치료 대상 내의 상기 종양세포, 예를 들어 췌장암 세포, 유방암 세포, 난소암 세포 또는 신경교종 세포 수의 1배 내지 10배로 포함된 것일 수 있다.
본 명세서에서 용어 "약제학적 유효량"은 질환의 치료, 예방 및 진단하는 데 충분한 양을 의미한다.
본 발명의 약학 조성물은 당해 발명이 속하는 기술 분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화하여 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다.
본 발명의 또 다른 양태는 본 발명의 항-HLA-G 키메라 항원 수용체 또는 상기 키메라 항원 수용체가 발현된 면역세포 또는 상기 약학적 조성물을 약제학적 유효량으로 대상체, 예컨대 인간 또는 인간을 제외한 포유류에게 투여하는 것을 포함하는, HLA-G 과발현 관련 질환, 예를 들어 암의 진단, 예방 또는 치료 방법이다. 본 발명은 또한, 본 발명의 항-HLA-G 키메라 항원 수용체 또는 상기 키메라 항원 수용체가 발현된 면역세포를 이를 필요로 하는 개체, 예컨대 인간 또는 인간을 제외한 포유류에게 투여하는 단계를 포함하는, HLA-G 과발현 관련 질환, 예를 들어 암의 진단 방법을 제공한다.
본 발명에서, 용어 "개체"란, HLA-G 과발현 관련 질환이 발병하였거나 발병할 수 있는 인간을 포함한 원숭이, 소, 말, 양, 돼지, 닭, 칠면조, 메추라기, 고양이, 개, 마우스, 쥐, 토끼 또는 기니아 피그를 포함한 모든 동물을 의미한다.
본 발명에 따른 키메라 항원 수용체는 HLA-G에 대한 특이성 및 친화성이 우수하므로, 항-HLA-G 키메라 항원 수용체를 발현하는 면역세포는 암세포에 대한 세포독성이 우수하여 HLA-G의 고발현과 관련된 다양한 암 등의 치료에 사용될 수 있다.
도 1a 내지 도 1c는 본 발명의 HLA-G CAR(항체단편 1 CAR), HLA-G CAR(항체단편 2 CAR), 및 HLA-G CAR(항체단편 3 CAR) 컨스트럭트의 구조를 나타낸 도이다.
도 2a 내지 도 2c는 본 발명의 pLV-EF1A-HLA-G CAR(항체단편 1 CAR), pLV-EF1A-HLA-G CAR(항체단편 2 CAR), 및 pLV-EF1A-HLA-G CAR(항체단편 3 CAR) 플라스미드의 구조를 나타낸 도이다.
도 3은 본 발명의 pLV-EF1A-B2M-IRES-HLA-G-CMV-EGFP-T2A-PuroR 플라스미드의 구조를 나타낸 도이다.
도 4는 본 발명의 SK-OV-3-HLA-G 및 MDA-MB-231-HLA-G 과발현 세포주에서 HLA-G 발현율을 확인한 도이다.
도 5a 내지 도 5c는 본 발명의 항-HLA-G CAR 발현 T 세포 표면에서 CAR의 발현율을 확인한 도이다.
도 6a 내지 도 6c는 SK-OV-3-HLA-G, MDA-MB-231-HLA-G, SK-OV-3 및 MDA-MB-231 세포주에 대한 본 발명의 항-HLA-G CAR 발현 T 세포의 항암 효능을 나타낸 도이다.
도 7은 SK-OV-3-HLA-G, MDA-MB-231-HLA-G, SK-OV-3 및 MDA-MB-231 세포주에 대한 본 발명의 항-HLA-G CAR 발현 T 세포의 활성을 인터페론 감마의 분비로 확인한 도이다.
도 8은 본 발명에서 IL-2와 IL-7/IL-15 사이토카인을 첨가하여 각각 배양한 항-HLA-G CAR 발현 T 세포 표면에서 CAR의 발현율을 확인한 도이다.
도 9는 본 발명에서 IL-2와 IL-7/IL-15 사이토카인을 첨가하여 각각 배양한 항-HLA-G CAR 발현 T 세포의 SK-OV-3-HLA-G 및 SK-OV-3 세포주에 대한 항암 효능을 나타낸 도이다.
도 10은 본 발명에서 IL-2와 IL-7/IL-15 사이토카인을 첨가하여 각각 배양한 항-HLA-G CAR 발현 T 세포의 SK-OV-3-HLA-G 및 SK-OV-3 세포주에 대한 활성을 인터페론 감마의 분비로 확인한 도이다.
도 11은 본 발명의 항-HLA-G CAR 발현 NK 세포에서 CD3와 CD56의 발현율을 확인한 도이다.
도 12는 본 발명의 항-HLA-G CAR 발현 NK 세포 표면에서 CAR의 발현율을 확인한 도이다.
도 13은 SK-OV-3-HLA-G 및 SK-OV-3 세포주에 대한 본 발명의 항-HLA-G CAR 발현 NK 세포의 항암 효능을 나타낸 도이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예 1: 세포주 및 배양
인간 난소암 세포주 SK-OV-3와 인간 삼중 음성 유방암 세포주 MDA-MB-231은 한국세포주은행(Korea)으로부터 공급받아 사용하였다. SK-OV-3와 MDA-MB-231은 10% FBS(Gibco, USA)와 1% Antibiotic-Antimycotic(Gibco, USA)를 포함하는 RPMI 1640(Gibco, USA) 배지에서 배양하였다.
실시예 2: HLA-G 과발현 세포주 제작 및 배양
2-1. B2M-HLA-G-EGFP-PuroR 유전자 발현 렌티바이러스의 제조
B2M-HLA-G-EGFP-PuroR 유전자의 전달을 위한 렌티바이러스는 플라스미드 DNA 형질전환법을 이용하여 제작하였다. TransIT-293 Transfection Reagent(Mirus Bio LLC, USA)을 이용하였고, 제조사의 프로토콜에 따라 수행하였다. 실험 전날 100 ㎜ 접시에 Lenti-XTM 293T 세포주(Clontech, USA)를 5Х106개 파종하고, 다음날 pLV-EF1A-B2M-IRES-HLA-G-CMV-EGFP-T2A-PuroR 렌티바이러스 벡터(도 3), gag-pol 발현 벡터 및 VSV-G 외피(envelope) 발현 벡터를 형질전환시켰다. 세포를 약 72시간 동안 배양한 후 세포 상층액(supernatant)을 모두 수확하였다. 상층액을 0.45 um 필터(Millipore, USA)로 여과하여 세포 조각(cell debris)을 제거하고, B2M-HLA-G-EGFP-PuroR 렌티바이러스가 포함된 여과액은 사용 전까지 -80℃에 냉동 보관하였다.
2-2. B2M-HLA-G-EGFP-PuroR 유전자 발현 SK-OV-3 및 MDA-MB-231 세포주 제작 및 배양
실험 전날 100 ㎜ 접시에 SK-OV-3 및 MDA-MB-231 세포주 각각을 1Х106개씩 파종하고, 앞서 제작한 B2M-HLA-G-EGFP-PuroR 렌티바이러스를 접시 하나당 3 mL씩 새로운 배지 7 mL과 섞어서 접시에 넣어주었다. 추가로 배지에 폴리브렌(polybrene)을 8 ug/mL 농도로 첨가하였다. 그리고 24시간 후 배지를 2 ㎍/㎖ 농도의 퓨로마이신(puromycin; Sigma-aldrich, USA)이 포함된 새로운 배지로 교체하였다. 퓨로마이신에 의해 선별이 어느 정도 진행되면 HLA-G 과발현 세포를 단일 세포로 분리하기 위하여 96 웰 플레이트에서 세포를 0.5개 세포/웰 농도로 계대 배양하였다. 최종 선별이 완료된 후 배지에 퓨로마이신을 0.5 ug/mL 농도로 첨가하였다. 형광현미경으로 관찰하여 EGFP 형광 신호가 높은 몇 개의 웰을 선정하고, 해당 웰에 세포가 가득 차면 세포를 회수하여 차례대로 48웰, 24웰, 12웰, 6웰, T25 및 T75 플라스크에서 배양하였다. 최종적으로 세포를 T175 플라스크에서 배양하여 세포 스탁(stock)을 제작하였다.
2-3. B2M-HLA-G-EGFP-PuroR 유전자 발현 SK-OV-3 및 MDA-MB-231 세포주에서의 HLA-G 발현 확인
상기 2-2에서 제작한 HLA-G 과발현 세포주에서 HLA-G의 발현을 다음과 같이 확인하였다.
B2M-HLA-G-EGFP-PuroR 유전자 발현 SK-OV-3 및 MDA-MB-231 세포주 1Х105개 세포를 100 uL D-PBS(Gibco, USA)에 부유시켜 세포 샘플을 준비하였다. 상기 세포 샘플에 항-HLA-G(TANKIO17) 항체 1 ug을 첨가하여 4℃에서 30분 동안 반응시켰다. 반응이 끝나면 세포를 D-PBS로 2회 세척한 후 다시 부유시켰다. 세포 샘플에 R-Phycoerythrin AffiniPure F(ab')2 Fragment Goat Anti-Human IgG (H+L)(Jackson ImmunoResearch, USA) 0.25 ug을 첨가하여 4℃에서 30분 동안 반응시켰다. 반응 후 세포를 D-PBS로 2회 세척하고, 유세포분석법으로 HLA-G의 발현을 확인하였다. 그 결과, B2M-HLA-G-EGFP-PuroR 렌티바이러스를 전달한 SK-OV-3 세포의 표면에서는 HLA-G가 약 99.8%, MDA-MB-231 세포의 표면에서는 HLA-G가 약 98.9% 발현되고 있음을 확인하였다(도 4).
실시예 3: 키메라 항원 수용체 구축
본 발명의 키메라 항원 수용체(chimeric antigen receptor, CAR)는 인공적으로 합성되었다.
좀 더 상세하게는, 하기의 세포 외 도메인과 세포 내 도메인 코딩 서열을 SOE-PCR(Splicing by overlap extension PCR)을 통해 인공적으로 합성하여 CAR를 제작하였다 (도 1a 내지 1c). PCR 산물을 MluI 및 XbaI으로 절단한 후 3세대 자가-불활성화 렌티바이러스 발현 벡터인 pLV-EF1A-MCS 벡터의 MluI 및 XbaI 사이트에 삽입하였다 (도 2a 내지 2c).
- 세포 외 도메인: CD8α 유래 신호 서열(leader sequence, LS), HLA-G 결합 도메인 (항체단편 1, 항체단편 2 또는 항체단편 3; scFv), CD8α 유래 힌지(hinge) 및 CD8α 유래 막관통(transmembrane, TM) 도메인
- 세포 내 도메인: 4-1BB 및 CD3ζ의 세포 내 신호전달 도메인
본 발명의 일 예에 따른 키메라 항원 수용체를 하기 표 1에 정리하였다. 키메라 항원 수용체의 도메인들은 서로 직렬로(in tandem) 연결되며, 또한 인프레임(in frame)으로 연결된다. 상세하게는, CD8α 유래 신호 서열, HLA-G 결합 도메인(scFv 형태), CD8α 유래 힌지, CD8α 유래 막관통 도메인, 4-1BB 유래 세포 내 신호전달 도메인, CD3ζ 유래 세포 내 신호전달 도메인과 종결 코돈 (stop codon)인 TAA가 연결된 것이다.
일련번호 약칭 신호서열 scFv 힌지 TM 신호-1 신호-2
S1 CAR 1 CD8α 항체단편 1 CD8α CD8α 4-1BB CD3ζ
S2 CAR 2 CD8α 항체단편 2 CD8α CD8α 4-1BB CD3ζ
S3 CAR 3 CD8α 항체단편 3 CD8α CD8α 4-1BB CD3ζ
본 발명의 실시예에 따른 키메라 항원 수용체 및 이의 제작에 사용된 도메인들의 서열 정보를 표 2 및 표 3에 정리하였다.
서열번호 서열이름 서열에 대한 설명
1 항체단편 1 뉴클레오티드 항체단편 1을 암호화하는 뉴클레오티드 서열
2 항체단편 1 아미노산 서열번호 1에 대응하는 아미노산 서열
3 항체단편 2 뉴클레오티드 항체단편 2를 암호화하는 뉴클레오티드 서열
4 항체단편 2 아미노산 서열번호 3에 대응하는 아미노산 서열
5 항체단편 3 뉴클레오티드 항체단편 3을 암호화하는 뉴클레오티드 서열
6 항체단편 3 아미노산 서열번호 5에 대응하는 아미노산 서열
7 CD8α LS 뉴클레오티드 CD8α 유래 신호 서열을 암호화하는 뉴클레오티드 서열
8 CD8α LS 아미노산 CD8α 유래 신호 서열의 아미노산 서열
9 CD8α 힌지 뉴클레오티드 CD8α 유래 힌지를 암호화하는 뉴클레오티드 서열
10 CD8α 힌지 아미노산 CD8α 유래 힌지의 아미노산 서열
11 CD8α TM 뉴클레오티드 CD8α 유래 막관통 도메인을 암호화하는 뉴클레오티드 서열
12 CD8α TM 아미노산 CD8α 유래 막관통 도메인의 아미노산 서열
13 4-1BB SD 뉴클레오티드 4-1BB 유래 세포내 신호전달 도메인 (signaling domain, SD)을 암호화하는 뉴클레오티드 서열
14 4-1BB SD 아미노산 4-1BB 유래 세포내 신호전달 도메인의 아미노산 서열
15 CD3ζ 뉴클레오티드 CD3ζ 유래 세포내 신호전달 도메인을 암호화하는 뉴클레오티드 서열
16 CD3ζ 아미노산 CD3ζ 유래 세포내 신호전달 도메인의 아미노산 서열
17 CAR 1 뉴클레오티드 표 1에서 CAR 1을 암호화하는 뉴클레오티드 서열
18 CAR 1 아미노산 표 1에서 CAR 1의 아미노산 서열
19 CAR 2 뉴클레오티드 표 1에서 CAR 2를 암호화하는 뉴클레오티드 서열
20 CAR 2 아미노산 표 1에서 CAR 2의 아미노산 서열
21 CAR 3 뉴클레오티드 표 1에서 CAR 3을 암호화하는 뉴클레오티드 서열
22 CAR 3 아미노산 표 1에서 CAR 3의 CAR의 아미노산 서열
23 링커 뉴클레오티드 VH와 VL을 연결하는 링커를 암호화하는 뉴클레오티드 서열
24 링커 아미노산 VH와 VL을 연결하는 링커의 아미노산 서열
서열번호 서열이름 서열
1 항체단편 1 뉴클레오티드 GAAGTACAACTGCTGGAAAGTGGCGGGGGTCTGGTTCAGCCGGGAGGCTCACTTAGGTTGTCATGTGCGGCATCCGGATTTACGTTCTCCGATTATGCGATGTCCTGGGTTCGGCAAGCTCCTGGTAAAGGTTTGGAGTGGGTATCCGTAATTTCTCATGATGGAGGCAGTATCTATTATGCCGATAGCGTCAAGGGACGCTTCACTATTTCCAGAGACAATTCCAAAAATACCCTGTACCTTCAAATGAACTCACTCCGAGCCGAGGACACCGCAGTTTACTACTGCGCGAAGGGGCCTAGGAGAATCGCGAACGCTATTTTCGATTATTGGGGTCAGGGGACCCTGGTGACGGTTAGTTCTGGGGGTGGAGGCAGTGGAGGCGGGGGTAGTGGAGGAGGGGGTTCACAATTTGTACTGACCCAACCTCCGTCAGTCTCTGCCGCCCCCGGCCAAAAAGTAACGATAAGCTGTTCAGGGAGCAACTCTAATATAGGCAACTCTTATGTCTCTTGGTACCAACAAGTACCCGGCGCAGCGCCTAGGCTTTTGATATATGGGTCAACTAACCGGCCGAGCGGCGTGCCAGACCGCTTTTCAGGTAGTAAGTCAGGGACGAGTGCCAGTCTGGCTATCACCGGTCTGCAAGCTGAGGACGAGGCTGATTATTACTGTCAAAGCTATGACTCCTCATTGTCCGGCTATGTTTTTGGAACGGGCACGAAGGTAACAGTTCTA
2 항체단편 1 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQFVLTQPPSVSAAPGQKVTISCSGSNSNIGNSYVSWYQQVPGAAPRLLIYGSTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL
3 항체단편 2 뉴클레오티드 GAGGTTCAGTTGCTTGAGTCAGGCGGAGGACTGGTTCAACCGGGCGGTAGTTTGAGGCTGAGCTGCGCCGCCAGTGGATTCACTTTCAGCGATTACGCGATGTCCTGGGTCCGGCAGGCTCCGGGAAAGGGCCTGGAGTGGGTTTCTGTCATAAGCCACGATGGCGACAGGGTATATTATGCTGACTCAGTGAAAGGTCGCTTCACAATTTCTCGGGACAACTCTAAAAATACCCTGTATTTGCAGATGAATTCTCTCAGAGCGGAGGACACCGCTGTTTATTATTGTGCAAAAGGCCCCCGGAGGATCGCGAATGCCATATTCGATTACTGGGGCCAAGGCACGCTTGTAACGGTTTCATCAGGTGGAGGAGGGAGCGGTGGAGGCGGGTCCGGTGGCGGTGGATCTCAGCTCGTACTCACTCAGCCTCCGTCAGTATCTGGGGCCCCGGGTCAAAAGGTCACAATAAGTTGTTCCGGTTCTTCTAGTAATATCGGGCATAGTTATGTCTCATGGTACCAGCAGTTGCCTGGAACTGCACCAAAGCTCCTGATATATGGGGATAACAATCGGCCTAGCGGTGTACCCGACCGCTTTAGCGGTTCTAAATCAGGCACATCTGCGTCCCTTGCTATTACCGGACTCCAGGCCGAAGACGAAGCGGACTATTACTGTCAGTCCTACGACAGTTCCTTGTCTGGGTATGTGTTCGGGACCGGAACCAAAGTCACTGTCCTA
4 항체단편 2 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGDRVYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQLVLTQPPSVSGAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGDNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL
5 항체단편 3 뉴클레오티드 GAAGTGCAGCTTTTGGAATCTGGCGGCGGACTCGTTCAGCCAGGAGGTTCCCTTAGACTGTCATGCGCGGCTAGCGGGTTTACGTTTAGCGACTATTCAATGTCTTGGGTTCGACAGGCACCGGGCAAAGGTCTGGAGTGGGTGAGCGCAATTAGCCCGGATCGGTCTCTGGAGTATTACGCCGACTCTGTGAAGGGGCGATTTACCATCAGCCGGGACAACTCCAAAAATACCCTGTATCTGCAAATGAACTCACTGCGAGCGGAAGACACCGCAGTCTACTATTGCGCAAAAGGGCCACGCCATCTGACGAATAATATATTTGACTATTGGGGTCAAGGTACCCTCGTCACAGTTAGCTCAGGTGGCGGCGGTTCCGGCGGCGGTGGTAGCGGTGGGGGAGGCTCCCAATTCGTCTTGACCCAGCCACCAAGCGTGAGTGCTGCCCCCGGTCAGAAGGTCACCATATCTTGTAGTGGCTCAAGTTCAAACATAGGTCACTCTTATGTTTCATGGTATCAACAACTCCCTGGAACGGCACCAAAACTTTTGATCTATGGTAACATTCACCGACCGTCCGGAGTACCTGATAGATTTAGCGGTTCTACGTCTGGGACTTCCGCTTCTCTTGCTATAACGGGCTTGCAGGCGGATGACGAGGCCGACTACTACTGTGGTGTGTGGGATTCTTCTCTGTCAGCGGTAGTGTTTGGAGGCGGGACAAAATTGACTGTACTA
6 항체단편 3 아미노산 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLEWVSAISPDRSLEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRHLTNNIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQFVLTQPPSVSAAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGNIHRPSGVPDRFSGSTSGTSASLAITGLQADDEADYYCGVWDSSLSAVVFGGGTKLTVL
7 CD8α LS 뉴클레오티드 ATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTGCTGCTCCACGCCGCCAGGCCG
8 CD8α LS 아미노산 MALPVTALLLPLALLLHAARP
9 CD8α 힌지 뉴클레오티드 ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT
10 CD8α 힌지 아미노산 TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
11 CD8α TM 뉴클레오티드 ATCTACATCTGGGCGCCCTTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGC
12 CD8α TM 아미노산 IYIWAPLAGTCGVLLLSLVITLYC
13 4-1BB SD 뉴클레오티드 AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG
14 4-1BB SD 아미노산 KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
15 CD3ζ 뉴클레오티드 AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC
16 CD3ζ 아미노산 RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
17 CAR 1 뉴클레오티드 AGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
18 CAR 1 아미노산 MALPVTALLLPLALLLHAARPEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQFVLTQPPSVSAAPGQKVTISCSGSNSNIGNSYVSWYQQVPGAAPRLLIYGSTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
19 CAR 2 뉴클레오티드 AGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
20 CAR 2 아미노산 MALPVTALLLPLALLLHAARPEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGDRVYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQLVLTQPPSVSGAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGDNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
21 CAR 3 뉴클레오티드 AGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
22 CAR 3 아미노산 MALPVTALLLPLALLLHAARPEVQLLESGGGLVQPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLEWVSAISPDRSLEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRHLTNNIFDYWGQGTLVTVSSGGGGSGGGGSGGGGSQFVLTQPPSVSAAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGNIHRPSGVPDRFSGSTSGTSASLAITGLQADDEADYYCGVWDSSLSAVVFGGGTKLTVLTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
23 링커 뉴클레오티드 GGGGGTGGAGGCAGTGGAGGCGGGGGTAGTGGAGGAGGGGGTTCA
24 링커 아미노산 GGGGSGGGGSGGGGS
본 발명의 실시예에 따른 키메라 항원 수용체의 제조에 사용된 항체 단편 가변 영역의 중쇄, 경쇄, 및 CDRs의 서열목록을 표 4 내지 표 5에 정리하였다.
클론 서열번호 가변 영역 아미노산 서열
항체
단편 1		 25 중쇄 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGGSIYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSS
26 경쇄 QFVLTQPPSVSAAPGQKVTISCSGSNSNIGNSYVSWYQQVPGAAPRLLIYGSTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL
항체
단편 2		 27 중쇄 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSVISHDGDRVYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRRIANAIFDYWGQGTLVTVSS
28 경쇄 QLVLTQPPSVSGAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGDNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVL
항체
단편 3		 29 중쇄 EVQLLESGGGLVQPGGSLRLSCAASGFTFSDYSMSWVRQAPGKGLEWVSAISPDRSLEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGPRHLTNNIFDYWGQGTLVTVSS
30 경쇄 QFVLTQPPSVSAAPGQKVTISCSGSSSNIGHSYVSWYQQLPGTAPKLLIYGNIHRPSGVPDRFSGSTSGTSASLAITGLQADDEADYYCGVWDSSLSAVVFGGGTKLTVL
클론 가변
영역		 서열
번호		 CDR1 서열
번호		 CDR2 서열
번호		 CDR3
항체단편 1 중쇄 31 DYAMS 32 VISHDGGSIYYADSVKG 33 GPRRIANAIFDY
경쇄 34 SGSNSNIGNSYVS 35 GSTNRPS 36 QSYDSSLSGYV
항체단편 2 중쇄 37 DYAMS 38 VISHDGDRVYYADSVKG 39 GPRRIANAIFDY
경쇄 40 SGSSSNIGHSYVS 41 GDNNRPS 42 QSYDSSLSGYV
항체단편 3 중쇄 43 DYSMS 44 AISPDRSLEYYADSVKG 45 GPRHLTNNIFDY
경쇄 46 SGSSSNIGHSYVS 47 GNIHRPS 48 GVWDSSLSAVV
실시예 4: 항-HLA-G CAR-T 세포의 제작
4-1. 항-HLA-G CAR 유전자 발현 렌티바이러스의 제조
항-HLA-G CAR 유전자의 전달을 위한 렌티바이러스는 플라스미드 DNA 형질전환법으로 제작하였다. TransIT-293 Transfection Reagent(Mirus Bio LLC, USA)을 이용하였고, 제조사의 프로토콜에 따라 수행하였다. 실험 전날 100 mm 접시에 Lenti-XTM 293T 세포주(Clontech, USA)를 5x106개로 파종하고, 다음날 pLV-EF1A-HLA-G CAR 렌티바이러스 벡터, gag-pol 발현 벡터 및 VSV-G 외피 발현 벡터를 형질전환시켰다. HLA-G CAR 렌티바이러스 벡터는 다음과 같다; 항체단편 1, 항체단편 2 또는 항체단편 3. 형질전환 후 세포를 약 72시간 배양하고 배양 완료 후 세포 상층액을 모두 수확하였다. 상층액을 0.45 um 필터(Millipore, USA)로 여과 세포 조각을 제거하였다. Lenti-XTM Concentrator(Clontech, USA)를 이용하여 제조사의 프로토콜에 따라 렌티바이러스를 약 100배 농축하고 사용 전까지 -80℃에 냉동 보관하였다.
4-2. 항-HLA-G CAR 발현 T 세포 제작 및 배양
공여자를 모집하고 백혈구성분채혈(leukapheresis)을 통해 백혈구를 얻었다. 상기 백혈구에서 SepMateTM-50(STEMCELL technology, Canada)과 Ficoll-Paque PLUS(GE healthcare, Sweden)를 이용하여 말초혈 단핵세포(peripheral blood mononuclear cell, PBMC)를 획득하였다. 그 후 QuadroMACSTM Separator(Miltenyi Biotec, Germany)와 LS 컬럼(Miltenyi Biotec, Germany), 인간 CD4 MicroBeads(Miltenyi Biotec, Germany) 및 인간 CD8 MicroBeads,(Miltenyi Biotec, Germany)을 이용하여 양성 선택(positive selection) 방법으로 인간 T 세포를 분리하였다. 인간 T 세포는 TexMACSTM 배지(Miltenyi Biotec, Germany)를 배양액으로 사용하고, T Cell TransActTM, human(Miltenyi Biotec, Germany)을 첨가하여 활성화시켰다. T 세포의 성장을 위해 배양액에 인간 IL-2(R&D systems, USA)를 100 U/mL로 첨가하여 배양하였다. 48시간 배양 후 활성화된 T 세포를 수확하여 렌티바이러스 전달에 사용하였다.
MOI(Multiplicity of infection, 감염 배수) 3 정도의 렌티바이러스와 함께 활성화된 인간 T 세포를 12 웰 플레이트에 웰 당 1x106개를 넣어주고 배양액이 2.5 mL이 되도록 하였다. 1,000 xg로 15분간 원심분리하여 T 세포에 렌티바이러스를 전달하였다. T 세포를 48시간 동안 정치 배양한 후 새로운 배지로 교체하였다. 형질도입된 인간 T 세포는 2~3일 간격으로 mL당 5x105개로 계대 배양하고, 세포 수가 mL당 2x106개를 넘지 않도록 유지하였다. 특별한 언급이 없는 한, 인간 T 세포는 배양액에 IL-2(R&D systems, USA)를 100 U/mL로 첨가하여 배양하였다.
4-3. 항-HLA-G CAR 발현 T 세포에서 CAR 발현 확인
3명의 공여자로부터 얻은 백혈구로 제작한 항-HLA-G CAR 발현 T 세포에서 세포 표면에 항-HLA-G CAR가 발현하는지 확인하였다.
1x105개의 세포를 수확한 후 100 uL D-PBS에 부유시켜 세포 부유액을 준비하였다. PE conjugation kit(Abcam, USA)를 사용하여 항-HLA-G 항체 제작에 사용한 B2M-HLA-G 항원에 PE 형광을 접합시켰다. 상기 B2M-HLA-G 항원-PE 접합체를 세포 부유액에 첨가하여 4℃에서 30분 동안 반응시켰다. 반응 종료 후 세포를 D-PBS로 2회 세척하고, 유세포분석법으로 항-HLA-G CAR의 발현 수준을 확인하였다.
그 결과, 공여자 1에서는 항-HLA-G CAR(항체단편 1 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 34.9%, 항-HLA-G CAR(항체단편 2 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 45.8%, 항-HLA-G CAR(항체단편 3 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 43.3% 발현되고 있음을 확인하였다(도 5a).
그 결과, 공여자 2에서는 항-HLA-G CAR(항체단편 1 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 37.6%, 항-HLA-G CAR(항체단편 2 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 57.3%, 항-HLA-G CAR(항체단편 3 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 38.1% 발현되고 있음을 확인하였다(도 5b).
그 결과, 공여자 5에서는 항-HLA-G CAR(항체단편 1 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 30.4%, 항-HLA-G CAR(항체단편 2 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 46.2%, 항-HLA-G CAR(항체단편 3 CAR) 유전자를 전달한 T 세포의 표면에서 항-HLA-G CAR가 약 37.4% 발현되고 있음을 확인하였다(도 5c).
실시예 5: 생체 외( in vitro )에서 항-HLA-G CAR 발현 T 세포의 항암 효능 확인
다음의 방법을 통해 타깃 세포(target cell, T)에 대한 항-HLA-G CAR 발현 T 세포(효과기 (effector) 세포, E)의 항암 효능을 확인하였다.
(i) 타깃 세포들은 모두 EGFP를 과발현할 수 있도록 제작되었다.
(ii) 타깃 세포들을 48 웰 플레이트에 웰 당 1x105 세포/150 uL로 첨가하였다.
(iii) 항-HLA-G CAR 발현 T 세포 및 대조군 T 세포를 웰 당 1x106 세포/150 uL, 5x105 세포/150 uL, 1x105 세포/150 uL(E:T 비율=10, 5, 1)로 첨가하여 타깃 세포와 24시간 반응시켰다.
(iv) 타깃 세포가 죽게 되면 EGFP 형광 신호가 사라지기 때문에 24시간 후에 유세포분석법을 이용하여 EGFP를 발현하는 세포의 수를 카운팅하였다.
[식 1]
Cytotoxicity(%)=100-{(타깃 세포와 효과기 세포의 공배양 후 EGFP+ 세포 수/타깃 세포 단독 배양 후 EGFP+ 세포 수)x100}
실험 결과, 공여자 1의 백혈구로부터 제작한 3종 항-HLA-G CAR(항체단편 1 CAR), 항-HLA-G CAR(항체단편 2 CAR), 항-HLA-G CAR(항체단편 3 CAR) 발현 T 세포의 HLA-G 과발현 SK-OV-3-HLA-G 세포주에 대한 항암 효능은 항-HLA-G CAR를 발현하지 않는 대조군 T 세포에 비해 상당히 높았다. 그러나 HLA-G를 발현하지 않는 SK-OV-3 세포주에 대해서는 3종의 항-HLA-G CAR 발현 T 세포와 대조군 T 세포의 살상능에 차이가 없었다 (도 6a).
공여자 2의 백혈구로부터 제작한 3종 항-HLA-G CAR(항체단편 1 CAR), 항-HLA-G CAR(항체단편 2 CAR), 항-HLA-G CAR(항체단편 3 CAR) 발현 T 세포의 HLA-G 과발현 MDA-MB-231-HLA-G 세포주에 대한 항암 효능은 항-HLA-G CAR를 발현하지 않는 대조군 T 세포에 비해 상당히 높았다. 반면, HLA-G를 발현하지 않는 MDA-MB-231 세포주에 대해서는 3종의 항-HLA-G CAR 발현 T 세포와 대조군 T 세포의 살상능 차이가 없었다 (도 6b).
공여자 5의 백혈구로부터 제작한 3종 항-HLA-G CAR(항체단편 1 CAR), 항-HLA-G CAR(항체단편 2 CAR), 항-HLA-G CAR(항체단편 3 CAR) 발현 T 세포의 HLA-G 과발현 SK-OV-3-HLA-G 및 MDA-MB-231-HLA-G 세포주에 대한 항암 효능도 항-HLA-G CAR를 발현하지 않는 대조군 T 세포에 비해 상당히 높았다. 그러나 HLA-G를 발현하지 않는 SK-OV-3 및 MDA-MB-231 세포주에 대해서는 3종의 항-HLA-G CAR 발현 T 세포와 대조군 T 세포의 살상능 차이가 없었다 (도 6c).
상기 결과들을 통해 항-HLA-G CAR 발현 T 세포가 HLA-G를 높게 발현하는 세포에 대해서만 특이적으로 높은 살상능을 가짐을 확인하였다.
공여자 5에서 제작한 항-HLA-G CAR 발현 T 세포 및 대조군 T 세포가 타깃 세포와 E:T 비율 1:1로 처리된 실험군에서 세포 상층액을 수확하였다. 수확한 상층액에서 Human IFN-gamma Quantikine ELISA Kit(R&D systems, USA)로 인터페론 감마의 농도를 측정하였다.
그 결과, 3종의 항-HLA-G CAR(항체단편 1 CAR), 항-HLA-G CAR (항체단편 2 CAR), 항-HLA-G CAR (항체단편 3 CAR) 발현 T 세포와 HLA-G를 과발현하는 SK-OV-3-HLA-G 또는 MDA-MB-231-HLA-G 타깃 세포주를 공배양한 경우에만 인터페론 감마의 분비가 유의적으로 증가함을 확인하였다(도 7).
실시예 6: 생체 외( in vitro )에서 T 세포 배양 조건에 따른 항-HLA-G CAR 발현 T 세포의 항암 효능 비교
앞서 실시예 4-2에서 언급한 방식으로 항-HLA-G CAR(항체단편 2 CAR) 발현 T 세포를 제작하였다. 이 때, T 세포의 성장을 위해 배양액에 인간 IL-2(R&D systems, USA)를 100 U/mL로 첨가하거나 또는 IL-7 (Miltenyi Biotec, Germany) 및 IL-15 (Miltenyi Biotec, Germany)를 각각 12.5 ng/mL로 첨가하여 배양하였다.
항-HLA-G CAR 발현 T 세포의 세포 표면에서 항-HLA-G CAR가 발현되는지 확인한 결과, 배양액에 IL-2를 넣어 배양한 항-HLA-G CAR 발현 T 세포의 표면에서는 항-HLA-G CAR가 약 48.3% 발현되고 있었으며, 배양액에 IL-7과 IL-15를 넣어 배양한 항-HLA-G CAR 발현 T 세포의 표면에서는 항-HLA-G CAR가 약 47.9% 발현되고 있음을 확인하였다(도 8).
항-HLA-G CAR 발현 T 세포와 타깃 세포를 공배양하여 항암 효능을 확인한 결과, HLA-G를 과발현하는 SK-OV-3-HLA-G 세포주에 대한 항-HLA-G CAR 발현 T 세포(IL-2)와 항-HLA-G CAR 발현 T 세포 (IL-7/IL-15)의 항암 효능은 유사하게 우수하였다. 반면, HLA-G를 발현하지 않는 SK-OV-3 세포주에 대해서는 살상능이 상당히 낮아 2종의 항-HLA-G CAR 발현 T 세포 간에 살상능의 차이가 없었다(도 9).
항-HLA-G CAR 발현 T 세포가 타깃 세포와 E:T 비율 1:1로 처리된 실험군에서 세포 상층액을 수확하여 Human IFN-gamma Quantikine ELISA Kit (R&D systems, USA)로 인터페론 감마의 농도를 측정하였다. 그 결과, 항-HLA-G CAR 발현 T 세포 (IL-2) 또는 항-HLA-G CAR 발현 T 세포 (IL-7/IL-15)와 HLA-G를 과발현하는 SK-OV-3-HLA-G 타깃 세포주를 공배양 했을 경우에만 인터페론 감마의 분비가 유의적으로 증가하였고, 2종 항-HLA-G CAR 발현 T 세포 간에 차이가 거의 없음을 확인하였다(도 10).
상기 결과들을 통해 T 세포의 성장을 위해 배양액에 첨가하는 사이토카인(IL-2 또는 IL-7/IL-15)의 종류에 관계없이 항-HLA-G CAR 발현 T 세포가 유사한 수준의 CAR 발현을 보이고, 생체 외(in vitro)에서 2종 항-HLA-G CAR 발현 T 세포 모두 좋은 항암 효능을 나타내는 것을 확인하였다.
실시예 7: 항-HLA-G CAR-NK 세포의 제작 및 항암 효능 확인
7-1. 항-HLA-G CAR 발현 NK 세포 제작 및 배양
공여자를 모집하여 백혈구성분채혈 (leukapheresis)을 통해 백혈구를 얻었다. 얻은 백혈구로부터 SepMateTM-50 (STEMCELL technology, Canada)과 Ficoll-Paque PLUS (GE healthcare, Sweden)를 이용하여 말초혈 단핵세포 (peripheral blood mononuclear cell, PBMC)를 획득하였다. 그 후 NK cell isolation kit (Miltenyi Biotec, Germany)를 이용하여 음성 선택(negative selection) 방법으로 인간 NK(natural killer, 자연 살해) 세포를 분리하였다. 인간 NK 세포는 NK MACS® Medium (Miltenyi Biotec, Germany)을 배양액으로 사용하였다. NK 세포의 효율적인 성장을 위해 배양액에 GemCellTM Human Serum AB (GeminiBio, USA)를 5%, 인간 IL-2 (R&D systems, USA)와 IL-15 (Miltenyi Biotec, Germany)를 각각 500 U/mL, 140 U/mL 농도로 첨가하여 배양하였다.
NK 세포에 렌티바이러스를 효율적으로 전달하기 위하여 RetroNectin®(Takara, Japan)과 BX-795 (Sigma-aldrich, USA)를 사용하였다. MOI 10 정도의 렌티바이러스를 RetroNectin이 코팅된 24 웰 플레이트에 넣고, 제조사의 프로토콜에 따라 렌티바이러스를 흡착시켰다. 배양 10일차의 NK 세포 5x105개에 2.5 uM의 BX-795를 넣어 30분간 처리하였다. 이후 렌티바이러스가 흡착된 플레이트에 BX-795가 처리된 NK 세포를 넣고 1,000 xg로 15분간 원심분리하여 NK 세포에 렌티바이러스를 전달하였다. 그 후 NK 세포를 24시간 동안 정치 배양 후 새로운 배지로 교체하였다. 형질도입된 인간 NK 세포는 3~4일 간격으로 적절히 계대 배양하였다.
7-2. 항-HLA-G CAR 발현 NK 세포에서의 CAR 발현 확인
우선 항-HLA-G CAR 발현 NK 세포가 제대로 배양됐는지 확인하였다. 1Х105개의 세포를 수확한 후 100 uL D-PBS에 부유시켜 세포 부유액을 준비하였다. VioBlue가 접합된 CD3 항체 (Miltenyi Biotec, Germany)와 FITC가 접합된 CD56 항체 (Miltenyi Biotec, Germany)를 상기 세포 부유액에 첨가하고 4℃에서 30분 동안 반응시켰다. 반응 후 세포를 D-PBS로 2회 세척한 후, 유세포분석법으로 CD3와 CD56의 발현 수준을 확인하였다.
그 결과, CD3-CD56+인 NK 세포의 비율이 대조군 NK 세포에서 99.1%, 항-HLA-G CAR(항체단편 1 CAR) 유전자를 전달한 NK 세포에서 99.1%, 항-HLA-G CAR(항체단편 2 CAR) 유전자를 전달한 NK 세포에서 98.9%, 항-HLA-G CAR(항체단편 3 CAR) 유전자를 전달한 NK 세포에서 99.1%로 나타나 거의 모든 세포가 CD3-CD56+ NK 세포임을 확인하였다 (도 11).
그 다음으로 각 세포의 표면에서 항-HLA-G CAR가 발현하는지 확인하였다. 1Х105개의 세포를 수확한 후 100 uL D-PBS에 부유시켜 세포 부유액을 준비하였다. PE conjugation kit (Abcam, USA)를 사용하여 항-HLA-G 항체 제작에 사용한 B2M-HLA-G 항원에 PE 형광을 접합시켰다. 상기 B2M-HLA-G 항원-PE 접합체를 세포 부유액에 첨가하여 4℃에서 30분 동안 반응시켰다. 반응 종료 후 세포를 D-PBS로 2회 세척하고, 유세포분석법으로 항-HLA-G CAR의 발현을 확인하였다.
그 결과, 항-HLA-G CAR (항체단편 1 CAR) 유전자를 전달한 NK 세포의 표면에서 항-HLA-G CAR가 약 18.8%, 항-HLA-G CAR (항체단편 2 CAR) 유전자를 전달한 NK 세포의 표면에서 항-HLA-G CAR가 약 25.5%, 항-HLA-G CAR (항체단편 3 CAR) 유전자를 전달한 NK 세포의 표면에서 항-HLA-G CAR가 약 22.4% 발현되고 있음을 확인하였다(도 12).
7-3. 생체 외( in vitro )에서의 항-HLA-G CAR 발현 NK 세포의 항암 효능 확인
실시예 5와 같은 방법으로 항-HLA-G CAR 발현 NK 세포의 항암 효능을 확인하였다.
그 결과, HLA-G를 과발현하는 SK-OV-3-HLA-G 세포주에 대한 3종의 항-HLA-G CAR (항체단편 1 CAR), 항-HLA-G CAR (항체단편 2 CAR), 항-HLA-G CAR (항체단편 3 CAR) 발현 NK 세포의 항암 효능은 항-HLA-G CAR를 발현하지 않는 대조군 NK 세포에 비해 상당히 높았다. 그러나 SK-OV-3 세포주에서는 항-HLA-G CAR 발현 NK 세포와 대조군 NK 세포의 살상능 차이가 없었다 (도 13).

Claims (22)

  1. HLA-G (human leukocyte antigen-G)에 특이적으로 결합하는 항원 결합 도메인;
    막관통 도메인; 및
    세포내 신호전달 도메인;을 포함하고,
    상기 HLA-G에 특이적으로 결합하는 항원 결합 도메인은 하기에서 선택되는 서열을 포함하는, 항-HLA-G 키메라 항원 수용체(chimeric antigen receptor, CAR):
    (a) 서열번호 31의 아미노산 서열을 갖는 중쇄 상보성 결정 부위 1 (complementarity determining region 1, CDR1), 서열번호 32의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 33의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
    서열번호 34의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 35의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 36의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역;
    (b) 서열번호 37의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 38의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 39의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
    서열번호 40의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 41의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 42의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역; 또는
    (c) 서열번호 43의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 44의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 45의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄 가변 영역; 및
    서열번호 46의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 47의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 48의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄 가변 영역.
  2. 제1항에 있어서, 상기 HLA-G에 특이적으로 결합하는 항원 결합 도메인은 항체 또는 항원 결합 단편인, 항-HLA-G 키메라 항원 수용체.
  3. 제2항에 있어서, 상기 항원 결합 단편은 scFv인, 항-HLA-G 키메라 항원 수용체.
  4. 제1항에 있어서, 상기 키메라 항원 수용체는 신호 서열을 추가로 포함하는, 항-HLA-G 키메라 항원 수용체.
  5. 제4항에 있어서, 상기 신호 서열은 CD8 알파, 인간 면역글로불린 중쇄 또는 hGM-CSF 수용체 알파-사슬 유래 신호 서열인, 항-HLA-G 키메라 항원 수용체.
  6. 제5항에 있어서, 상기 CD8 알파 유래 신호 서열은 서열번호 8의 아미노산 서열을 포함하는 것인, 항-HLA-G 키메라 항원 수용체.
  7. 제1항에 있어서, 상기 HLA-G에 특이적으로 결합하는 항원 결합 도메인은 힌지에 의해 막관통 도메인과 연결되는, 항-HLA-G 키메라 항원 수용체.
  8. 제7항에 있어서, 상기 힌지는 CD8 알파의 힌지, IgG1의 힌지, IgG4의 힌지, IgD의 힌지, IgG1 CH3, CD28의 세포외 도메인 또는 이들의 조합으로 이루어진 군에서 선택되는, 항-HLA-G 키메라 항원 수용체.
  9. 제8항에 있어서, 상기 CD8 알파의 힌지는 서열번호 10의 아미노산 서열을 포함하는, 항-HLA-G 키메라 항원 수용체.
  10. 제1항에 있어서, 상기 막관통 도메인은 CD8 알파, T 세포 수용체, CD28, CD3 엡실론(epsilon), CD45, CD4, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD99, CD134, CD137 및 CD154의 알파(α), 베타(β) 또는 제타(ζ)로 이루어진 군으로부터 선택되는 단백질의 막관통 도메인인, 항-HLA-G 키메라 항원 수용체.
  11. 제10항에 있어서, 상기 CD8 알파의 막관통 도메인은 서열번호 12의 아미노산 서열을 포함하는, 항-HLA-G 키메라 항원 수용체.
  12. 제1항에 있어서, 상기 세포내 신호전달 도메인은 CD3 제타(ζ), FcγR, ICOS (Inducible T-cell costimulator, CD278), 4-1BB (CD137, TNFRSF9), OX40 (CD134), CD27, CD28, IL-2Rβ, IL-15R-α, CD40, MyD88, DAP10 (DNAX-activating protein 10), DAP12, MHC 클래스 I 분자, TNF 수용체 (tumor necrosis factor receptor) 단백질, 면역글로불린-유사 단백질, 사이토카인 수용체, 인테그린, SLAM (Signaling lymphocytic activation molecule) 단백질, 활성화 NK 세포 수용체, BTLA (B and T Lymphocyte Attenuator), Toll 리간드 수용체 (Toll-like receptors, TLRs), CD2, CD7, CD30, CD99, CDS, ICAM-1 (Intercellular adhesion molecule-1), B7-H3 (CD276), GITR (Glucocorticoid-induced TNFR-related protein), BAFFR (BAFF (B-cell activating factor)-receptor), LIGHT, HVEM (LIGHTR), KIRDS2 (killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 2), SLAMF7 (SLAM Family Member 7), NKp80 (KLRF1 (killer cell lectin-like receptor subfamily F, member 1)), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, IL2Rγ, IL7Rα, ITGA4, VLA1, CD49a, IA4, CD49D, ITGA6 (integrin Subunit Alpha 6), VLA-6, CD49f, ITGAD (integrin subunit alpha D), CD11d, ITGAE (integrin subunit alpha E), CD103, ITGAL (integrin subunit alpha L), CD11a, LFA-1 (lymphocyte function-associated antigen-1; CD11a/CD18), ITGAM (integrin subunit alpha M), CD11b, ITGAX (integrin subunit alpha X), CD11c, ITGB1 (integrin beta-1), CD29, ITGB2 (integrin beta-2), CD18, ITGB7 (integrin beta-7), NKG2D (KLRK1 (killer cell lectin like receptor K1), NKG2C (KLRC2 (Killer Cell Lectin Like Receptor C2)), TNFR2 (Tumor necrosis factor receptor 2), TRANCE (receptor activator of NF-kappa B ligand; RANKL (receptor activator of nuclear factors κB ligand)), DNAM1 (DNAX accessory molecule-1, CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1 (carcinoembryonic antigen-related cell adhesion molecule 1), CRTAM (cytotoxic and regulatory T cell molecule), Ly9 (CD229), CD160 (BY55), PSGL1 (P-selectin glycoprotein Ligand 1, CD162), CD100 (SEMA4D (Semaphorin 4D)), CD69, SLAMF6 (NTB-A (NK-T-B-antigen)), Ly108), SLAMF1 (CD150, IPO-3), BLAME (SLAMF8), LTBR (lymphotoxin-beta receptor), LAT (Linker For Activation Of T Cells), GADS (glutamate decarboxylase), SLP-76 (Src homology 2 (SH2) domain-containing leukocyte phosphoprotein of 76-kDa), PAG/Cbp, CD19a 및 CD83 특이적 리간드로 이루어진 군에서 선택되는 단백질에서 유래되는, 항-HLA-G 키메라 항원 수용체.
  13. 제12항에 있어서, 상기 CD3 제타(ζ) 유래 세포내 신호전달 도메인은 서열번호 16의 아미노산 서열을 포함하는, 항-HLA-G 키메라 항원 수용체.
  14. 제1항에 있어서, 상기 세포내 신호전달 도메인은 OX40, CD2, CD27, CD28, CD99, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 단백질의 신호전달 도메인을 공동자극 도메인으로 추가적으로 포함하는, 항-HLA-G 키메라 항원 수용체.
  15. 제14항에 있어서, 상기 4-1BB 유래 공동자극 도메인은 서열번호 14의 아미노산 서열을 포함하는, 항-HLA-G 키메라 항원 수용체.
  16. 제1항 내지 제15항 중 어느 한 항에 따른 항-HLA-G 키메라 항원 수용체를 암호화하는 뉴클레오티드 서열을 포함하는 단리된 핵산.
  17. 제16항의 단리된 핵산을 포함하는 벡터.
  18. 제1항 내지 제15항 중 어느 한 항에 따른 항-HLA-G 키메라 항원 수용체를 표면에 발현하는, 면역세포.
  19. 제18항에 있어서, 상기 면역세포는 자연 살해 세포 (natural killer cell), T 세포, 자연 살해 T 세포, B 세포, 대식세포, 수지상 세포, 자연 살해 수지상 세포, 비만세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것인, 면역세포.
  20. 제18항 또는 제19항의 면역세포 및 약학적으로 허용되는 담체를 포함하는 암의 예방 또는 치료에서의 사용을 위한 약학적 조성물.
  21. 제20항에 있어서, 상기 암은 췌장암, 유방암, 난소암, 신경교종, 자궁경부암, 자궁내막암, 식도암, 위암, 간암, 폐암, 대장암, 비인두암, 구강암, 갑상선암, 전립선암, 신장암, 담낭암, 담관암, 혈액암 및 흑색종으로 이루어진 군으로부터 선택되는, 약학적 조성물.
  22. 제18항 또는 제19항의 면역세포, 또는 제20항의 약학적 조성물을 이를 필요로 하는 대상체에 투여하는 것을 포함하는 암의 예방 또는 치료 방법.
PCT/KR2023/003960 2022-03-25 2023-03-24 항-hla-g 키메라 항원 수용체 및 이의 용도 WO2023182861A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0037684 2022-03-25
KR20220037684 2022-03-25

Publications (1)

Publication Number Publication Date
WO2023182861A1 true WO2023182861A1 (ko) 2023-09-28

Family

ID=88101898

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2023/003960 WO2023182861A1 (ko) 2022-03-25 2023-03-24 항-hla-g 키메라 항원 수용체 및 이의 용도

Country Status (2)

Country Link
KR (1) KR20230141534A (ko)
WO (1) WO2023182861A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20200097749A (ko) * 2017-12-08 2020-08-19 페이트 세러퓨틱스, 인코포레이티드 향상된 iPSC 유래된 효과기 세포를 사용하는 면역요법
KR20210005080A (ko) * 2018-04-18 2021-01-13 에프. 호프만-라 로슈 아게 항-hla-g 항체 및 이의 용도
KR20210075117A (ko) * 2018-10-05 2021-06-22 세인트 안나 킨더크렙스포르슝 키메라 항원 수용체(car) 그룹

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20200097749A (ko) * 2017-12-08 2020-08-19 페이트 세러퓨틱스, 인코포레이티드 향상된 iPSC 유래된 효과기 세포를 사용하는 면역요법
KR20210005080A (ko) * 2018-04-18 2021-01-13 에프. 호프만-라 로슈 아게 항-hla-g 항체 및 이의 용도
KR20210075117A (ko) * 2018-10-05 2021-06-22 세인트 안나 킨더크렙스포르슝 키메라 항원 수용체(car) 그룹

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE PROTEIN ANONYMOUS : "Sequence 54 from patent US 11111302", XP093095895, retrieved from NCBI *
KRIJGSMAN DANIËLLE, ROELANDS JESSICA, HENDRICKX WOUTER, BEDOGNETTI DAVIDE, KUPPEN PETER J. K.: "HLA-G: A New Immune Checkpoint in Cancer?", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 21, no. 12, pages 4528, XP093039278, DOI: 10.3390/ijms21124528 *

Also Published As

Publication number Publication date
KR20230141534A (ko) 2023-10-10

Similar Documents

Publication Publication Date Title
EP3382009B1 (en) Chimeric antigen receptor-modified immune effector cell carrying pd-l1 blocking agent
WO2018124766A2 (ko) 키메라 항원 수용체 및 이를 발현하는 자연 살해 세포
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
US11760806B2 (en) CD-38 directed chimeric antigen receptor constructs
US20220096544A1 (en) Chemokine expressing cell and use thereof
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
WO2022242700A1 (en) Genetically modified nk cells and uses thereof
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
EP4112721A1 (en) Engineered immune cell expressing nk inhibitory molecule and use thereof
WO2021066420A1 (ko) Cd138에 특이적으로 결합하는 키메릭 항원 수용체, 이를 발현하는 면역세포 및 이의 항암 용도
WO2022025638A1 (ko) 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포
WO2021060914A1 (ko) 항-클라우딘-3 키메라 항원 수용체
WO2018128485A1 (ko) 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
WO2023182861A1 (ko) 항-hla-g 키메라 항원 수용체 및 이의 용도
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021182929A1 (ko) Bcma에 특이적인 항체 및 키메라 항원 수용체
WO2023191526A1 (ko) Cd30 유래의 세포내 신호전달 도메인을 포함하는 키메라 항원 수용체, 이를 발현하는 면역세포 및 이들의 용도
WO2023027471A1 (ko) 기능이 강화된 신규 키메라 항원 수용체(car)
WO2018128486A1 (ko) Ceacam6에 특이적으로 결합하는 항-ceacam6 키메릭 항원 수용체
WO2023249463A1 (ko) 면역관문 제어 인자를 발현하는 면역세포 및 이의 용도
WO2023200267A1 (ko) 키메릭 항원 수용체 및 hgf 결합 억제 물질의 조합 요법
WO2021225399A1 (ko) 암 치료를 위한 키메라 항원 수용체
WO2024010119A1 (ko) 돌연변이 egfr 및 epha2를 동시 타겟하는 키메라 항원 수용체

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23775356

Country of ref document: EP

Kind code of ref document: A1