WO2023147019A2 - Compositions and methods for treating mesothelin positive cancers - Google Patents
Compositions and methods for treating mesothelin positive cancers Download PDFInfo
- Publication number
- WO2023147019A2 WO2023147019A2 PCT/US2023/011698 US2023011698W WO2023147019A2 WO 2023147019 A2 WO2023147019 A2 WO 2023147019A2 US 2023011698 W US2023011698 W US 2023011698W WO 2023147019 A2 WO2023147019 A2 WO 2023147019A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- receptor
- seq
- cell
- hla
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4254—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K40/4255—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/248—IL-6
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/22—Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- immune cells are engineered to express specific receptors, for example chimeric antigen receptors (CARs) or T cell receptors (TCRs), which direct the activity of the immune cells to cellular targets via interaction of the receptor with a ligand expressed by the target cell.
- CARs chimeric antigen receptors
- TCRs T cell receptors
- compositions and methods related to treatment of MSLN(+) cancers are compositions and methods related to treatment of MSLN(+) cancers.
- the compositions and methods disclosed herein may exploit loss of heterozygosity (LOH) to address MSLN(+) cancer.
- LH heterozygosity
- the compositions and methods disclosed herein may, in some cases, avoid systemic toxicity to normal tissues by pairing a MSLN-targeted activator receptor with a blocker receptor. Without being bound by theory, the difference in blocker antigen expression in tumor versus.
- the disclosure provides immune cells comprising: (a) a first receptor, comprising an extracellular ligand binding domain specific to Mesothelin (MSLN); and (b) a second receptor, comprising an extracellular ligand binding domain specific to HLA-A*03, wherein the first receptor is an activator receptor responsive to MSLN; and wherein the second receptor is an inhibitory receptor responsive to HLA-A*03.
- MSLN Mesothelin
- the HLA-A*03 is lost in the MSLN+ cancer cell through loss of heterozygosity.
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of Table 6 or Table 7.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 of: (i) SEQ ID NOS: 638, 645, 650, 657, 676, and 693; (ii) SEQ ID NOS: 638, 645, 650, 658, 677, and 694; (iii) SEQ ID NOS: 638, 645, 650, 659, 678, and 695; (iv) SEQ ID NOS: 638, 645, 650, 660, 678, and 696; (v) SEQ ID NOS: 638, 645, 650, 661, 679, and 697; (vi) SEQ ID NOS: 639, 646, 651, 657, 676, and 698; (vii) SEQ ID NOS: 638, 645, 650, 657, 676,
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 of (i) SEQ ID NOS: 638, 645, 650, 657, 676, and 693; (ii) SEQ ID NOS: 638, 645, 650, 658, 677, and 694; (iii) SEQ ID NOS: 638, 645, 650, 659, 678, and 695; (iv) SEQ ID NOS: 638, 645, 650, 660, 678, and 696; (v) SEQ ID NOS: 638, 645, 650, 661, 679, and 697; (vi) SEQ ID NOS: 639, 646, 651, 657, 676, and 698; (vii) SEQ ID NOS: 638, 645, 650, 657, 676, and
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 of SEQ ID NOS: 1260-1265.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises a polypeptide sequence selected from the polypeptide sequence disclosed in Table 5; or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the extracellular ligand binding domain of the second receptor comprises any one of SEQ ID NOS: 615-628 or SEQ ID NO: 1259, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the extracellular ligand binding domain of the second receptor comprises any one of SEQ ID NOS: 615-628.
- the extracellular ligand binding domain of the second receptor comprises SEQ ID NO: 1259.
- the first receptor is a chimeric antigen receptor (CAR).
- the extracellular ligand binding domain of the first receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 2; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the CDRs of Table 2.
- the extracellular ligand binding domain of the first receptor comprises a variable heavy (VH) portion comprising a sequence set forth in Table 3 and a variable light (VL) portion comprising a sequence set forth in Table 4; or a sequence having at least 80%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the extracellular ligand binding domain of the first receptor comprises a variable heavy (VH) portion comprising SEQ ID NO: 233 or a sequence having at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% identity thereto, and a variable light (VL) portion comprising SEQ ID NO: 279 or a sequence having 85%, at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- VH variable heavy
- VL variable light
- the extracellular ligand binding domain of the first receptor comprises a sequence selected from the group consisting of SEQ ID NOS: 3-6, 80 and 154-215, or a sequence having at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the extracellular ligand binding domain of the first receptor comprises an scFv sequence of SEQ ID NO: 171; or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the first receptor comprises a hinge domain, a transmembrane domain and an intracellular domain.
- the hinge domain comprises a CD8 ⁇ hinge domain.
- the CD8 ⁇ hinge domain comprises a sequence of SEQ ID NO: 7, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the transmembrane domain comprises a CD28 transmembrane domain.
- the CD28 transmembrane domain comprises a sequence of SEQ ID NO: 11, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the intracellular domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, and a CD3 ⁇ activation domain.
- the intracellular domain comprises a sequence of SEQ ID NO: 285, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the first receptor comprises a sequence of SEQ ID NO: 303, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the second receptor comprises a LILRB1 intracellular domain or a functional variant thereof.
- the LILRB1 intracellular domain comprises a sequence at least 90%, at least 95%, at least 97%, at least 99%, or is identical to SEQ ID NO: 70.
- the second receptor comprises a LILRB1 transmembrane domain or a functional variant thereof.
- the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 90%, at least 95%, at least 97%, at least 99% or is identical to SEQ ID NO: 74.
- the second receptor comprises a LILRB1 hinge domain or functional variant thereof.
- the LILRB1 hinge domain comprises a sequence at least 90%, at least 95%, at least 97%, at least 99% or is identical to SEQ ID NO: 73.
- the second receptor comprises a LILRB1 intracellular domain, a LILRB1 transmembrane domain, a LILRB1 hinge domain, a functional variant of any of these, or combinations thereof.
- the LILRB1 hinge domain, LILRB1 intracellular domain and LILRB1 transmembrane domain comprises SEQ ID NO: 71 or a sequence at least 90%, at least 95%, at least 97%, at least 99% or is identical to SEQ ID NO: 71.
- the second receptor comprises a sequence of SEQ ID NO: 1268, or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cancer cell, a colorectal cancer cell, an esophageal cancer cell, a head and neck cancer cell, a kidney cancer cell, an uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell, a lung cancer cell, a colorectal cancer cell or a cholangiocarcinoma cell, or any cancer cell expressing MSLN.
- the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cell, a uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell or a lung adenocarcinoma cell.
- the MSLN+ cancer cell is an epithelial cancer cell. Epithelial cancers are cancers that originate in the epithelial cells. In some embodiments, the MSLN+ epithelial cancer is a carcinoma.
- the MSLN+ cancer cell is a MSLN+/HLA-A*03– cancer cell that does not express HLA-A*03.
- the MSLN+/HLA-A*03– cancer cell is derived from a MSLN+/HLA- A*03+ cell by loss of heterozygosity at HLA-A leading to loss of HLA-A*03.
- the first receptor and the second receptor together specifically activate the immune cell in the presence of the MSLN+/HLA-A*03- cancer cell having loss of heterozygosity.
- the first receptor and the second receptor together do not specifically activate the immune cell in the presence of an MSLN+ cell that has not lost HLA-A*03 by loss of heterozygosity.
- the immune cell is a T cell.
- the T cell is a CD8+ CD4- T cell or a CD8– CD4+ T cell.
- expression and/or function of a MHC Class I gene has been reduced or eliminated.
- the MHC Class I gene is beta-2-microglobulin (B2M).
- the immune cells further comprise an interfering RNA, the interfering RNA comprising a sequence complementary to a sequence of a B2M mRNA.
- the interfering RNA comprises a sequence selected from the group of sequences set forth in Table 13, or a sequence having at most 1, 2, 3, or 4 substitutions, insertions or deletions relative thereto.
- the interfering RNA is capable of inducing RNAi-mediated degradation of the B2M mRNA.
- the interfering RNA is a short hairpin RNA (shRNA).
- shRNA comprises: (a) a first sequence, having from 5’ end to 3’ end a sequence complementary to a sequence of the B2M mRNA; and (b) a second sequence, having from 5’ end to 3’ end a sequence complementary to the first sequence, wherein the first sequence and the second sequence form the shRNA.
- the shRNA is encoded by a sequence comprising a sequence of (SEQ ID NO: 350), or a sequence having at least 80%, at least 90%, or at least 95% identity thereto.
- expression and/or function of a MHC Class I gene has been reduced or eliminated.
- the MHC Class I gene is beta-2-microglobulin (B2M).
- the immune cells comprise one or more modifications to a sequence encoding B2M, wherein the one or more modifications reduce the expression and/or eliminate the function of B2M.
- the one or more modifications comprise one or more inactivating mutations of the endogenous gene encoding B2M.
- the one or more inactivating mutations comprise a deletion, an insertion, a substitution, or a frameshift mutation.
- the one or more inactivating mutations are introduced with a nucleic acid guided endonuclease in a complex with at least one guide.
- the at least one guide is a guide nucleic acid (gNA) that specifically targets a sequence of the endogenous gene encoding B2M.
- the gNA comprises a sequence selected from the group of sequences set forth in Table 12, or a sequence having at most 1, 2, 3, or 4 substitutions, insertions or deletions relative thereto.
- the immune cells of the disclosure expression and/or function of a MHC Class I gene has been reduced or eliminated.
- the MHC Class I gene is HLA-A*03.
- the immune cells comprise a polynucleotide comprising an interfering RNA, comprising a sequence complementary to a sequence of an HLA-A*03 mRNA.
- the interfering RNA is capable of inducing RNA interference (RNAi)-mediated degradation of the HLA-A*03 mRNA.
- the interfering RNA is a short hairpin RNA (shRNA) comprising: (a) a first sequence, having from 5’ end to 3’ end a sequence complementary to a sequence of the HLA-A*03 mRNA; and (b) a second sequence, having from 5’ end to 3’ end a sequence complementary to the first sequence, wherein the first sequence and the second sequence form the shRNA.
- shRNA comprises a sequence set forth in 14.
- the immune cells comprise one or more modifications to a sequence of an endogenous gene encoding HLA-A*03, wherein the one or modifications reduce the expression and/or eliminate the function of HLA-A*03.
- the one or more modifications comprise one or more inactivating mutations of the endogenous gene encoding HLA-A*03.
- the one or more inactivating mutations are introduced with a nucleic acid guided endonuclease in a complex with at least one guide nucleic acid (gNA) that specifically targets a sequence of the endogenous gene encoding HLA-A*03.
- the gNA comprises a sequence set forth in Table 11.
- the first receptor comprises a sequence of SEQ ID NO: 164
- the second receptor comprises a sequence of SEQ ID NO: 1259, or sequences having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cells comprise an shRNA encoded by a sequence comprising (SEQ ID NO: 350) or a sequence having at least 80%, at least 90%, or at least 95% identity thereto.
- the first receptor and second receptor are encoded by a single polynucleotide, and wherein the sequences encoding the first and second receptors are separated by a sequence encoding a self-cleaving polypeptide.
- the self-cleaving polypeptide comprises a T2A self-cleaving polypeptide comprising a sequence of GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 351).
- the immune cells are autologous.
- the immune cells are allogeneic.
- the disclosure provides a pharmaceutical composition, comprising a therapeutically effective amount of the immune cells of the disclosure.
- the pharmaceutical composition further comprises a pharmaceutically acceptable carrier, diluent or excipient.
- the disclosure provides a pharmaceutical composition, comprising a therapeutically effective amount of the immune cells of the disclosure for use as a medicament in the treatment of MSLN+ cancer.
- the disclosure provides a polynucleotide or polynucleotide system, comprising one or more polynucleotides comprising polynucleotide sequences encoding: (a) a first receptor, comprising an extracellular ligand binding domain specific to Mesothelin (MSLN); and (b) a second receptor, comprising an extracellular ligand binding domain specific to HLA-A*03, wherein the first receptor is an activator receptor responsive to MSLN on the MSLN+ cancer cell; and wherein the second receptor is an inhibitory receptor responsive to HLA-A*03.
- MSLN Mesothelin
- the polynucleotide or polynucleotide system comprises one or more polynucleotides comprising polynucleotide sequences encoding the first receptor and the second receptor for use in generating the immune cells of the disclosure.
- the polynucleotide or polynucleotide system comprises a sequence encoding an shRNA specific to B2M.
- the sequences encoding the first receptor, the second receptor and the shRNA specific to B2M are encoded by the same polynucleotide.
- the sequence encoding the shRNA specific to B2M comprises (SEQ ID NO: 350) or a sequence having at least 80%, at least 90%, or at least 95% identity thereto;
- the sequence encoding the first receptor comprises a sequence encoding a polypeptide of SEQ ID NO: 303, or a sequence having at least 80%, at least 90%, or at least 95% identity thereto;
- the sequence encoding the second receptor comprises a sequence encoding a polypeptide of SEQ ID NO: 1268, or a sequence having at least 80%, at least 90%, or at least 95% identity thereto.
- the disclosure provides methods of killing a MSLN+ cancer cell having loss of heterozygosity at an HLA-A*03 locus, comprising administering to the subject an effective amount of the immune cells or pharmaceutical composition of the disclosure.
- the disclosure provides methods of treating MSLN+ cancer in a subject having a MSLN+ tumor having loss of heterozygosity at an HLA-A*03 locus, comprising administering to the subject an effective amount of the immune cells or pharmaceutical composition of the disclosure.
- the disclosure provides methods of treating a cancer in a subject comprising: (a) determining HLA-A genotype or expression of normal cells and a plurality of cancer cells of the subject; (b) optionally, determining the expression of MSLN in a plurality of cancer cells of the subject; and (c) administering to the subject an effective amount of the immune cells or pharmaceutical composition of the disclosure if the normal cells express HLA- A*03 and the plurality of cancer cells do not express HLA-A*03, and the plurality of cancer cells are MSLN-positive.
- the subject is a heterozygous HLA-A*03 patient with a malignancy that expresses MSLN (MSLN+) and has lost HLA- A*03 expression.
- the subject is a heterozygous HLA-A*03 patient with recurrent unresectable or metastatic solid tumors that express MSLN and have lost HLA-A*03 expression.
- the cancer comprises mesothelioma, ovarian cancer, cervical cancer, colorectal cancer, esophageal cancer, head and neck cancer, kidney cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancer, colorectal cancer, or cholangiocarcinoma.
- the cancer comprises mesothelioma, ovarian cancer, cervical cancer, uterine cancer, gastric cancer, pancreatic cancer or lung adenocarcinoma.
- the cancer has relapsed in a subject.
- the cancer is refractory to one or more prior administered anticancer therapies.
- the cancer is metastatic.
- the cancer cells comprise MSLN+/HLA-A*03– cancer cells that do not express HLA-A*03.
- the MSLN+/HLA-A*03– cancer cells are derived from a MSLN+/HLA-A*03+ cell by loss of heterozygosity at HLA-A leading to loss of HLA-A*03.
- the first receptor and the second receptor together specifically activate the immune cell in the presence of the MSLN+/HLA-A*03- cancer cells.
- the first receptor and the second receptor together do not specifically activate the immune cell in the presence of a MSLN+ cell that has not lost HLA-A*03.
- administration of the immune cells or pharmaceutical composition reduces the size of a tumor in the subject.
- the tumor is reduced by about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 100%. In some embodiments, the tumor is eliminated. [0033] In some embodiments of the methods of the disclosure, administration of the immune cells or pharmaceutical composition arrests the growth of a tumor in the subject. [0034] In some embodiments of the methods of the disclosure, administration of the immune cells or pharmaceutical composition reduces the number of tumors in the subject.
- administering results in selective killing of a cancer cell but not a normal cell in the subject.
- at least about 60% of the cells killed are cancer cells, about 65% of the cells killed are cancer cells, about 70% of the cells killed are cancer cells, about 75% of the cells killed are cancer cells, about 80% of the cells killed are cancer cells, about 85% of the cells killed are cancer cells, about 90% of the cells killed are cancer cells, about 95% of the cells killed are cancer cells, or about 100% of the cells killed are cancer cells.
- administration of the immune cell or pharmaceutical composition results in the killing of at least about 40%, about 50%, about 60%, about 70%, about 80%, about 90% or all of the cancer cells of the subject.
- administration of the immune cell or the pharmaceutical composition results in fewer side effects for the subject than administration of an otherwise equivalent immune cell comprising the first activator receptor but no second inhibitory receptor.
- the disclosure provides methods making a plurality of immune cells, comprising: (a) providing a plurality of immune cells, and (b) transforming the plurality of immune cells with the polynucleotide, polynucleotide system or vector of the disclosure.
- the disclosure provides kits comprising the immune cells or pharmaceutical composition of the disclosure.
- kits further comprise instructions for use.
- FIG.1 is a table showing expression of blocker candidate genes from the TCGA database. (*) indicates genes previously identified as being expressed in the mesothelium.
- FIG.2 is a plot showing Mesothelin (MSLN) expression in normal tissues.
- FIG.3 is a plot showing the expression of MSLN across TCGA cancers (with tumor and normal samples.) Abbreviations: BLCA (Bladder cancer), BRCA (Breast Cancer), CESC (Cervical squamous cell carcinoma and endocervical adenocarcinoma), CHOL Cholangiocarcinoma), COAD (Colon adenocarcinoma), ESCA (Esophageal carcinoma), GBM (Glioblastoma multiforme), HNSC (Head and Neck squamous cell carcinoma), KICH (Kidney Chromophobe), KIRP (Kidney renal papillary cell carcinoma), LIHC (Liver hepatocellular carcinoma), LUAD (Lung adenocarcinoma), LUSC (Lung squamous cell carcinoma), PAAD (Pancreatic adenocarcinoma), PRAD (Prostate adenocarcinoma), PCPG (Phe
- FIG.4 is a plot showing MSLN expression in CCLE cell lines.
- FIG.5 is a plot showing LRRN4 expression in normal tissues.
- FIG.6 is a plot showing the expression of LRRN4 across TCGA cancers (with tumor and normal samples).
- FIG.7 is a plot showing the expression of LRRN4 across TCGA tumors.
- FIG.8 is a plot showing expression of LRRN4 in CCLE cell lines.
- FIG.9 is a plot showing the distribution of 10 leucine rich repeat (LRR) and Fibronectin Type III domains relative to the transmembrane domain of LRRN4. Most of these domains are likely located on the cell surface.
- LRR leucine rich repeat
- Fibronectin Type III domains are likely located on the cell surface.
- FIG.10A shows that a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor can inhibit activation of Jurkat cells in cis in a cell-free bead-based assay.
- FIG.10B that a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor can inhibit activation of Jurkat cells by a MSLN scFv CAR using the leukemia cell line K562 as target cells.
- FIG.11 is a diagram (left) and a chart (right) showing that a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor can inhibit activation of Jurkat cells, as measured by fold induction of IFN ⁇ , by a MSLN scFv CAR using a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor and HLA-A*02+ HeLa and SiHa cells as target cells.
- FIG.12 shows that a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor inhibits killing by MSLN CAR activators using HLA-A*02+ SiHa cells but not HLA- A*02- SiHa cells.
- FIG.13 is a diagram of the bioinformatics pipeline used to identify potential inhibitory receptor targets that are lost in cancer cells due to loss of heterozygosity.
- FIG.14 is a of the bioinformatics pipeline used to identify potential inhibitory receptor targets that are not expressed in cancer cells.
- FIG.15A is a pair of plots showing that the HLA-A*02 blocker inhibits MSLN CAR activators directed at MSLN, a high-density antigen.
- FIG.15B is a pair of plots showing that the HLA-A*02 blocker inhibits MSLN CAR activators directed at MSLN, a high-density antigen. Killing of endogenous MSLN+ HeLa cells by MSLN LBD1-CAR T cells is blocked in the presence of HLA-A*02 with the A2-LIR-1 blocker.
- FIG.15C is a pair of plots showing that the HLA-A*02 blocker inhibits MSLN CAR activators directed at MSLN, a high-density antigen. Killing of endogenous MSLN+ HeLa cells by MSLN LBD2-CAR T cells is shown.
- FIG.16 is a series of plots showing that HLA-A*02 LIR1 inhibitory receptors (PA2.1, mouse and humanized) effectively block killing by T cells expressing MSLN Generation 3 CAR in the presence of HeLa cells that express MSLN and HLA-A*02. Top row: MSLN + HLA-A*02+ HeLa target cells; bottom row: MSLN+ HLA-A*02- HeLa cells (control).
- HLA-A*02 LIR1 inhibitory receptors PA2.1, mouse and humanized
- FIG.17 is a series of plots showing that HLA-A*02 LIR1 inhibitory receptors (PA2.1, mouse and humanized) effectively block killing by T cells expressing MSLN Generation 3 CAR in the presence of MSLN+ HLA-A*02+ Capan-2 cells.
- HLA-A*02 LIR1 inhibitory receptors PA2.1, mouse and humanized
- FIG.18 is a pair of plots that shows that killing of MSLN + HLA-A*02+ HeLa cells (left) or HCT116 wild type (WT) cells that are natively MSLN + HLA-A*02+ by T cells expressing a 2nd generation CAR with a murine SS1 scFv is effectively blocked by an HLA-A*02 scFv LIR1 inhibitory receptor.
- FIG.19 is a series of fluorescence activated cell sorting (FACS) plots showing the expression of murine SS1 second generation CARs by T cells, with and without co- transduction of an HLA-A*02 scFv LIR-1 blocker.
- FACS fluorescence activated cell sorting
- FIG.20A is a plot showing the effect of LIR-1 hinge on the ability of an HLA- A*02 inhibitory receptor to block activation of Jurkat cells by a KRAS TCR.
- H hinge
- T transmembrane domain
- ICD intracellular domain
- s short.
- LIR-1 constructs are described in more detail in FIG.20B. Humanized PA2.1 and humanized BB7.2 with shorter LIR-1 hinge block similarly to original, longer hinge.
- FIG.20B is a plot and a table showing EC50 shift (+/- HLA-A*02 target cells) for Jurkat cells expressing a KRAS TCR activator and the HLA-A*02 scFv LIR-1 inhibitory receptors shown in the table at bottom (SEQ ID NOs: 352-356).
- FIG.21A is a plot showing the effect of LIR-1 hinge on the ability of an HLA- A*02 inhibitory receptor to block activation of Jurkat cells by a KRAS TCR.
- H hinge
- TM transmembrane domain
- ICD intracellular domain
- s short
- tr truncated.
- LIR-1 constructs are described in more detail in FIG. 21B.
- FIG.21B is a plot and a pair of tables showing EC50 shift (+/- HLA-A*02 target cells) for Jurkat cells expressing a KRAS TCR activator and the HLA-A*02 scFv LIR-1 inhibitory receptors shown in the table at bottom (SEQ ID NOs: 357-361), with lengths shown in the table at left.
- FIG.22A and FIG.22B show the Tmod approach to achieve selective cytotoxicity with two targets (Tmod refers to immune cells expressing the combination of activator and inhibitory receptors).
- FIG.22A shows the lung (and other vital organs) are surrounded by the MSLN(+) mesothelial lining, creating high risk of on-target, off-tumor toxicity for MSLN-targeted medicines.
- FIG.22B shows the molecular composition of MSLN-targeted Tmod constructs (Tmod refers to the paired activator and inhibitory receptors).
- FIG.23A, FIG.23B, FIG. 23C, and FIG.23D show the isolation and characterization of selective MSLN binders.
- On-target probe was labeled soluble MSLN (Acro Bio); off-target probe used for counterselection was a mixture of soluble CEA and EGFR proteins.
- FIG.23A shows enrichment of IgG library.
- FIG.23B shows enrichment of scFv library.
- FIG.23C shows surface expression of MSLN CARs (Gen3) in Jurkat cells.
- FIG.23D shows the characterization of MSLN binders in solid-state Jurkat cell assays with MSLN protein attached to the surface (see Hamburger et al., 2020).62 CAR constructs (Gen3) bearing different scFvs were transiently transfected in Jurkat cells to express CARs and a functional response to surface-bound recombinant human sMSLN (Acro Bio) was assessed after 6 hours. Most resulted in some degree of response. [0067] FIG.24A shows the sensitivity of MSLN CARs vs. benchmark CARs M5, SS1 and m912. All constructs were Gen3 except SS1 (Gen2).
- Jurkat cell dose-response was measured to assess the sensitivity in a 6 hour co-culture assay: (1) Titrated MSLN- encoding mRNA was used to transfect HEK293 cells; (2) QIFIKIT (quantitative analysis kit, Agilent) was used to convert flow-cytometry based surface expression to MSLN molecules/cell; and, (3) The molecule/cell sensitivities (EC50) of 6 novel and three benchmark CARs were calculated from fitting the dose-response curves. For those CARs with sensitivities below the limit of detection of the assay, EC50 was reported as ⁇ 3000 MSLN molecules/cell. Maximum signal (Emax) for each construct was also noted.
- Emax maximum signal
- FIG.24B shows CAR3 selectivity.
- FIG.25A shows expression of MSLN in human cell lines assessed by staining with MSLN mAb and flow cytometry.
- FIG.25B shows plotted levels of MSLN and A*02 mRNA (CCLE) and protein (QIFIKIT) show correlation. Conversions between protein and mRNA levels were calculated using the standard curves (see Methods for Example 8, infra).
- FIG.26A shows a summary of cell lines used in this study. Quantification of surface densities of MSLN and A*02 in various cancer cell lines, and corresponding reported mRNA levels in normal lung tissue (GTEx).
- FIG.26B shows quantification of MSLN molecules/cell using QIFIKIT.
- Anti- human MSLN mouse antibody clone 618923 R&D Systems
- Anti-mouse IgG F(ab’)2 secondary antibody Invitrogen A21237
- FIG.27A shows the characterization of MSLN CAR Tmod constructs in Jurkat cell functional assays.
- CAR1-6 HuTARG-derived MSLN activators
- A*02 blocker closed circles
- empty vector control open circles
- Jurkat NFAT luciferase cells expressing the CAR +/- blocker were co-cultured with wild-type, endogenous MSLN(+) HeLa cells transfected with a titration of A*02:01 mRNA.
- the functional response was assessed after a 6 hour co-culture. Titrated antigen molecules on the surface were quantified using the QIFIKIT. IC50 (molecules/cell) values are indicated in the figure.
- CAR1-6 are Gen3
- CAR M5 and SS1 are Gen2.
- FIG.27B shows a 2-dimensional titration of MSLN and A*02 mRNA in MSLN(-) HeLa target cells to establish EC50 for the MSLN CAR3 Tmod construct in Jurkat cells.
- MSLN(-) HeLa target cells were transfected with serially diluted MSLN mRNA and constant A*02 mRNA and Jurkat cells were transiently transfected to express MSLN CAR3 and A*02 blocker.
- the functional response (RLU) was assessed after a 6 hour co- culture.
- FIG.27C shows a transfection of MSLN(-) HeLa target cells with serially diluted A*02 mRNA and constant MSLN mRNA to establish IC50 for the MSLN CAR3 Tmod construct in Jurkat cells.
- FIG.28A shows plotted levels of MSLN and A*02 mRNA and protein. EC50 and IC50 of construct in relation to MSLN and HLA-A expression levels in normal (GTEx database) and tumor tissues and cell lines (TCGA, CCLE databases). Conversions between protein and mRNA levels were calculated using the standard curves shown in FIG.25B; Methods).
- FIG.28B shows MSLN CARs and CAR3 Tmod cytotoxicity in primary T cells.
- E:T effector:target
- A*02:MSLN (B:A) target antigen ratios ranged from 2-27:1.
- M5 was a Gen2 CAR; all others Gen3.
- FIG.29A shows a comparison of lead CAR3 receptor paired with A*02 blocker to benchmark CARs in cytotoxicity assays.
- SS1 CAR is a Gen2 construct; others are Gen3.
- Primary T cells transduced with various CARs +/- A*02 blocker using 2 separate lentiviral vectors were cultured with endogenous MSLN(+) A*02(-) tumor or MSLN(+)A*02(+) normal HeLa cells to assess cytotoxicity.
- Transduced primary T cells were normalized to a constant activator or activator-blocker double-positive population percentage [15% A(+) or A(+)B(+)] cells by dilution with untransduced T cells for a final effective effector:target (E:T) ratios of 0.6:1 or 0.3:1. Both E:T ratios resulted in selective killing in the presence of A*02 antigen when T cells also expressed A*02 blocker.
- FIG.29C shows T cell activation assessed by forward-scatter shift measured 48 hours after co-culture of transduced T cells with tumor or “normal” target cells.
- FIG.30A shows MSLN CAR3 Tmod cells selectively kill RFP(+) tumor cells and spare GFP(+) normal cells in mixed tumor and normal cell co-cultures. Due to the adherent nature of the HeLa cell line, killed targets tend to remain as clusters on the surface. White arrows point to some examples of killed RFP(+) tumor cells.
- Example of E:T 0.6:1 and normal:tumor 1:1.
- Primary T cells transduced with CAR3 or CAR3 Tmod construct were co-cultured with HeLa target cells for 48 hours and imaged using GFP and RFP expressed in MSLN(+)A*02(+) normal and MSLN(+)A*02(-) tumor cell lines, respectively.
- FIG.31A shows MSLN CAR3 Tmod cells selectively kill RFP(+) tumor cells in mixed tumor and normal cell co-cultures.
- FIG.32A shows the MSLN CAR3 Tmod construct mediates selective, persistent and reversible cytotoxicity.
- FIG.32B shows MSLN CAR3 Tmod construct selectivity in a Jurkat cell functional assay on a subset of MSLN(+) and MSLN(-) control target cells showed no off- target activity (see Methods for Example 8, infra). Bar height corresponds to the average from technical replicates.
- FIG.33A shows a schematic of RACA (repeat-antigen challenge assay) and reversibility assay.
- FIG.33B shows soluble circulating MSLN (sMSLN) does not affect CAR-T activity. Acute cytotoxicity of tumor or normal target cells by M5 benchmark CAR or CAR3 were not affected by the presence of 500ng/mL sMSLN (Acro Bio).
- FIG.33C shows the staining of transiently-transfected CAR(+) Jurkat cells with labeled sMSLN monomer or tetramer analyzed by flow cytometry shows that the sMSLN is structurally intact and able to bind the receptors.
- FIG.34A, FIG.34B, and FIG.34C show the Tmod construct mediates selective killing of tumor cells in a xenograft model.
- FIG.34A shows a schematic diagram of the dual-flank tumor and normal MS751 xenograft model.
- FIG.34B shows bioluminescence values are to the right of the color scale in flux units of photons/sec/cm2/sr.
- FIG. 34C shows graft sizes assessed by caliper measurement (see Results for Example 8, infra).
- FIG.35A, FIG.35B, and FIG.35C show MSLN CAR Tmod selectively kill tumors in xenograft model
- M5 was a Gen2 CAR; all others Gen3.
- FIG.35B shows individual mouse xenograft growth curves for data shown in FIG 34C.
- FIG.35C shows BLI quantification of normal and tumor cells post T cell injection.
- FIG.36 shows cis binding of A*02 blocker in A*02(+) or (-) T cells abrogates function. Binding of the blocker in A*02(+) Jurkat cells and primary T cells by A*02 tetramer was significantly reduced due to cis-binding of autologous A*02. Reduced binding (due to reduced availability of the blocker) correlated with reduced blocker activity.
- FIG.37A, FIG.37B, and FIG.37C show the MSLN Tmod system can be extended to autologous T cells.
- FIG. 37A shows cis-binding of autologous A*02 in an A*02(+) donor eliminates binding to A*02 tetramer B2M knockout (KO) by CRISPR restores blocker availability as demonstrated by binding to A*02 tetramer, similar to observed levels in an A*02(-) donor.
- FIG. 37B shows a cytotoxicity assay showing activator-only and MSLN SS1 CAR Tmod primary T cells cultured with tumor (solid) or normal (open) target cells.
- MSLN SS1 CAR Tmod construct kills MSLN(+) A*02(-) tumor HeLa target cells but no longer blocks in the presence of autologous A*02 as a result of cis-binding.
- A*02(+) donor blocking is only achieved through B2M CRISPR KO.
- E:T 1.2:1.
- FIG. 37C shows representative images at 48h.
- FIG.37D shows, similar to SS1 Tmod, CAR3 Tmod has reduced binding to A*02 tetramer in A*02(+) T cells.
- B2M knockdown (KD) with shRNA restores blocker availability.
- FIG.37E shows B2M shRNA also restores blocking of cytotoxicity on MSLN(+)A*02(+) “normal” HeLa cells.
- FIG.37F shows CAR3 paired with a humanized A*02 blocker retains the ability to block killing of “normal” cells in A*02(+) donor T cells, even in the absence of B2M KO or KD.
- FIG.38A shows enrichment of anti-HLA-A*11 binders through multiple rounds of cell sorting from scFv library. On-target probe was labeled HLA-A*11 tetramer; off-target proteins were a mixture of unrelated MHC tetramers.
- FIG.38B shows Jurkat cell activation in an mRNA titration assay: HeLa target cells were transfected with serially diluted HLA-A*11 mRNA and Jurkat cells were transiently transfected to express HLA-A*11 CAR4. The functional response (RLU) was assessed after a 6 hour co-culture. PE, phycoerythrin.
- FIG.39A shows Jurkat cells expressing MSLN CAR3 and A*03, A*11 or B*07 blocker constructs were blocked in the presence of increasing blocker antigen on endogenous MSLN(+) HeLa target cells.
- FIG.39B and FIG.39C show primary T cell cytotoxicity assay of MSLN CAR3 + A*11 blocker.
- Primary T cells transduced with CAR3 and A*11:01-directed blocker efficiently blocks HeLa target cells with A*11:01 and kills wildtype HeLa cells as effectively as CAR-only cells.
- FIG.39C shows representative co-culture images at 48 hours for FIG.39B.
- FIG.40 shows MSLN CAR3 Tmod killing of tumor target cells and blocking of “normal” target cells is not affected by the presence of PD-L1 induced by overnight treatment of HeLa target cells with 50 ng/mL IFN- ⁇ . Blockade with anti-PD-1 antibody similarly has no effect on CAR3 Tmod.
- FIG.42 shows the functional characterization of MSLN CAR A*03 Tmod constructs in primary T cells from 5 different donors on MS751 target cells.
- FIG.43 shows the functional characterization of MSLN CAR A*03 Tmod constructs in primary T cells from 5 different donors on HeLa target cells.
- mBAsh (GAP- A3) construct with mouse blocker and activator (plus ⁇ 2M shRNA).
- FIG.44A and FIG.44B show the Tmod construct mediates selective killing of tumor cells in a xenograft model.
- FIG. 44A shows a schematic diagram of the dual-flank tumor and normal MS751 xenograft model.
- FIG.44B shows xenograft sizes assessed by caliper measurements.
- compositions and methods for treating cancers using immune cells comprising a two receptor system responsive to differences in gene expression of a ligand between cancer and normal (i.e. healthy or wild type) cells. These differences in expression can be due to loss of heterozygosity in the cancer cells. Alternatively, the differences in expression can be because the gene is not expressed in cancer cells, or is expressed in cancer cells at a lower level than normal cells.
- the two-receptor system is expressed in immune cells, for example immune cells used in adoptive cell therapy, and targets activity of these immune cells to cancer cells exhibiting loss of heterozygosity or expression differences.
- the first receptor an activator receptor, sometimes referred to herein as an A module
- the second receptor an inhibitory receptor, sometimes referred to herein as a blocker, inhibitor receptor, or B module
- Each receptor contains a ligand-binding domain (LBD) that binds a specific ligand. Signals from the two receptors upon ligand binding are integrated by the immune cell.
- LOH heterozygosity
- LOH provides the means to discriminate tumor from normal tissue in a definitive way because tumors can be found in which all malignant cells lack certain germline alleles.
- One locus that undergoes LOH is the human leukocyte antigen (HLA) locus, which encodes polymorphic, abundant, ubiquitous surface antigens.
- HLA human leukocyte antigen
- the two- receptor system described herein employs one receptor to activate T cells exposed to tumor-antigen-positive tumor cells (sometimes referred to as an “activator module”), and a second receptor to prevent activation of the immune cells in the presence of a surface blocker antigen such as HLA-A*02 or HLA-A*03 protein.
- immune cells comprising the two receptor system described herein are used to treat Mesothelin (MSLN) positive cancers.
- MSLN Mesothelin
- the cancer has relapsed in a subject. In some embodiments, the cancer is refractory to one or more prior administered anticancer therapies. In some embodiments, the cancer is metastatic.
- the target antigen of the activator receptor is MSLN, or a peptide antigen thereof, in a complex with a major histocompatibility complex class I (MHC-I). MSLN is expressed in normal adipose, fallopian tube, lung and salivary gland tissues, among others (FIG.2). Because of its expression in certain tumors, MSLN is an attractive tumor- specific antigen that could mediate selective killing of MSLN+ tumors if these cancer cells could be specifically targeted with an appropriate therapeutic.
- MHC-I major histocompatibility complex class I
- the ligand for the activator is a MSLN peptide complexed with MHC class I.
- this MSLN targeted activator receptor is paired with an inhibitory receptor, which increases the safety window of the activator by blocking its cytolytic effect on normal MSLN-positive tissues.
- the activator receptor still directs the targeted killing of tumor cells by immune cells comprising the two-receptor system, as the tumor cells do not express the ligand for the inhibitor, or blocker, receptor.
- the target for the second, inhibitory receptor is expressed by MSLN positive tissues such as lung, mesothelium and adipose tissues, but not in cancer cells, and the inhibitory receptor recognizes this “non-target antigen” as an inhibitory stimulus.
- An exemplary target for the second inhibitory receptor is expressed by lung tissue, and is lost from MSLN positive cancer cells due to loss of heterozygosity (LOH) or other mechanisms, leaving a single allelic form in cancer cells that can be distinguished from other alleles via an allele-specific ligand binding domain on the inhibitory receptor.
- LHO heterozygosity
- Exemplary targets of the inhibitory receptor include, but are not limited to, Major Histocompatibility Complex (MHC) proteins such as human leukocyte antigen A (HLA- A). HLA-B, HLA-C, and other HLAs. HLAs are encoding by variant genes, such as HLA- A*01, HLA-A*02, HLA-A*03, HLA-C*07, and others, which can be lost from MSLN positive cancer cells through loss of heterozygosity.
- MHC Major Histocompatibility Complex
- HLA- A human leukocyte antigen A
- HLA-B human leukocyte antigen A
- HLA-C human leukocyte antigen A
- HLAs are encoding by variant genes, such as HLA- A*01, HLA-A*02, HLA-A*03, HLA-C*07, and others, which can be lost from MSLN positive cancer cells through loss of heterozygosity.
- further exemplary targets of the inhibitory receptor include, but are
- compositions and methods of the disclosure can reduce or eliminate dose- limiting toxicity (DLT) caused by expression of MSLN on normal tissue.
- DLT dose- limiting toxicity
- the disclosure provides methods of targeting MSLN in cancer cells to treat MSLN positive cancers using adoptive cell therapies by adding a second inhibitory receptor that blocks activation of the adoptive immune cells in the presence of a second ligand (a ligand other than MSLN, termed the non-target antigen or alternatively, blocker antigen).
- a second ligand a ligand other than MSLN, termed the non-target antigen or alternatively, blocker antigen.
- tumor cells that express MSLN are attacked by the adoptive cells, such as immune cells, expressing the two receptors because these tumor cells express only the activator ligand, MSLN.
- normal cells that express MSLN plus the non-target antigen are protected from the adoptive immune cells.
- the inhibitory receptor response to the non-target antigen on normal cells prevents activation of immune cells by the MSLN-targeted activator receptor.
- This dual-targeting approach creates the therapeutic window that will allow a MSLN-directed cell therapy to be dosed safely and effectively in MSLN-positive cancer patients.
- the disclosure provides methods and compositions that allow the use of potent MSLN CAR and TCRs that induce on-target toxicity, and renders these MSLN targeted receptors useful as a therapeutic by mitigating their toxicity.
- compositions and methods described herein may be used to kill target cells and/or treat subjects in which expression of the non-target antigen is partially or completely decreased by causes other than loss of heterozygosity, including but not limited to partial gene deletion, epigenetic silencing, and point mutations or truncating mutations in the sequence encoding the non-target antigen.
- the methods and compositions described in U.S. Patent Application Publication No.2022/0370497, are incorporated herein by reference in their entirety. Definitions [0111] Prior to setting forth this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms to be used herein.
- the term “about” or “approximately” refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
- the term “about” or “approximately” refers a range of quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length ⁇ 15%, ⁇ 10%, ⁇ 9%, ⁇ 8%, ⁇ 7%, ⁇ 6%, ⁇ 5%, ⁇ 4%, ⁇ 3%, ⁇ 2%, or ⁇ 1% about a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.
- isolated means material that is substantially or essentially free from components that normally accompany it in its native state.
- the term “obtained” or “derived” is used synonymously with isolated.
- subject refers to a vertebrate, preferably a mammal, more preferably a human. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.
- treatment includes any beneficial or desirable effect, and may include even minimal improvement in symptoms. “Treatment” does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof.
- prevention indicates an approach for preventing, inhibiting, or reducing the likelihood of a symptom of disease. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease.
- prevention and similar words also includes reducing the intensity, effect, symptoms and/or burden of disease prior to onset or recurrence.
- the term “amount” refers to “an amount effective” or “an effective amount” of a virus to achieve a beneficial or desired prophylactic or therapeutic result, including clinical results.
- a “therapeutically effective amount” of a virus or cell may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the virus or cell to elicit a desired response in the individual.
- a therapeutically effective amount is also one in which any toxic or detrimental effects of the virus or cell are outweighed by the therapeutically beneficial effects.
- the term “therapeutically effective amount” includes an amount that is effective to “treat” a subject (e.g., a patient).
- An “increased” or “enhanced” amount of a physiological response is typically a “statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7.1.8, etc.) the level of activity in an untreated cell.
- a “decreased” or “reduced” amount of a physiological response is typically a “statistically significant” amount, and may include an decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7.1.8, etc.) the level of activity in an untreated cell.
- sequence identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively.
- techniques for determining sequence identity include determining the nucleotide sequence of a polynucleotide and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Two or more sequences (polynucleotide or amino acid) can be compared by determining their “percent identity.” The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. Percent identity may also be determined, for example, by comparing sequence information using the advanced BLAST computer program, including version 2.2.9, available from the National Institutes of Health.
- the BLAST program is based on the alignment method of Karlin and Altschul, Proc. Natl. Acad. Sci. USA 87:2264-2268 (1990) and as discussed in Altschul, et al., J. Mol. Biol. 215:403-410 (1990); Karlin And Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5877 (1993); and Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997). Briefly, the BLAST program defines identity as the number of identical aligned symbols (generally nucleotides or amino acids), divided by the total number of symbols in the shorter of the two sequences.
- the program may be used to determine percent identity over the entire length of the proteins being compared. Default parameters are provided to optimize searches with short query sequences in, for example, with the blastp program.
- the program also allows use of an SEG filter to mask-off segments of the query sequences as determined by the SEG program of Wootton and Federhen, Computers and Chemistry 17:149-163 (1993). Ranges of desired degrees of sequence identity are approximately 80% to 100% and integer values therebetween.
- the percent identities between a disclosed sequence and a claimed sequence are at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%.
- a “polynucleotide system” refers to one or more polynucleotides.
- the one or more polynucleotides may be designed to work in concert for a particular application, or to produce a desired transformed cell.
- exogenous is used herein to refer to any molecule, including nucleic acids, protein or peptides, small molecular compounds, and the like that originate from outside the organism.
- endogenous refers to any molecule that originates from inside the organism (i.e., naturally produced by the organism).
- MOI is used herein to refer to multiplicity of infection, which is the ratio of agents (e.g. viral particles) to infection targets (e.g. cells).
- any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
- a “target cell” refers to cell that is targeted by an adoptive cell therapy.
- a target cell can be cancer cell, which can be killed by the transplanted T cells of the adoptive cell therapy.
- Target cells of the disclosure express a target antigen, as described herein, and do not express a non-target antigen.
- a “non-target cell” refers to cell that is not targeted by an adoptive cell therapy.
- normal, healthy, non- cancerous cells are non-target cells.
- Some, or all, non-target cells in a subject may express both the target antigen and the non-target antigen.
- Non-target cells in a subject may express the non-target antigen irrespective of whether or not these cells also express the target antigen.
- a “non-target allelic variant” refers to an allele of a gene whose product is expressed by non-target cells, but is not expressed by target cells.
- a non-target allelic variant is an allele of a gene that is expressed by normal, non-cancer cells of subject, but not expressed by cancer cells of the subject.
- the expression of the non-target allelic variant can be lost in the cancer cells by any mechanism, including, but not limited to, loss of heterozygosity, mutation, or epigenetic modification of the gene encoding the non-target allelic variant.
- “specific to” or “specifically binds to” when used with respect to a ligand binding domain, such as an antigen binding domain refers to a ligand binding domain that has a high specificity for a named target.
- Antibody specificity can be viewed as a measure of the goodness of fit between the ligand binding domain and the corresponding ligand, or the ability of the ligand binding domain to discriminate between similar or even dissimilar ligands.
- affinity is a measure of the strength of the binding between the ligand binding domain and ligand, such that a low- affinity ligand binding domain binds weakly and high-affinity ligand binding domain binds firmly.
- a ligand binding domain that is specific to a target allele is one that can discriminate between different alleles of a gene.
- a ligand binding domain that is specific to HLA-A*02 will not bind, or bind only weakly to, other HLA-A alleles such as HLA-A*01 or HLA-A*03.
- a ligand binding domain can be said to be specific to a particular target, and yet still have low levels of binding to one or more additional targets that do not affect its function in the receptor systems described herein.
- a “target antigen,” whether referred to using the term antigen or the name of a specific antigen refers to an antigen expressed by a target cell, such as a cancer cell. Expression of target antigen is not limited to target cells.
- Target antigens may be expressed by both cancer cells and normal, non-cancer cells in a subject.
- a “non-target antigen” (or “blocker antigen”) whether referred to using the term antigen or the name of a specific antigen, refers to an antigen that is expressed by normal, non-cancer cells and is not expressed in cancer cells. This difference in expression allows the inhibitory receptor to inhibit immune cell activation in the presence of non-target cells, but not in the presence of target cells.
- Polymorphism refers to the presence of two or more variants of a nucleotide sequence in a population. A polymorphism may comprise one or more base changes, an insertion, a repeat, or a deletion.
- a polymorphism includes e.g., a simple sequence repeat (SSR) and a single nucleotide polymorphism (SNP), which is a variation, occurring when a single nucleotide of adenine (A), thymine (T), cytosine (C) or guanine (G) is altered.
- SSR simple sequence repeat
- SNP single nucleotide polymorphism
- A thymine
- C cytosine
- G guanine
- affinity refers to strength of binding of a ligand to a single ligand binding site on a receptor, for example an antigen for the antigen binding domain of any of the receptors described herein.
- Ligand binding domains can have a weaker interaction (low affinity) with their ligand, or a stronger interaction (high affinity).
- Kd dissociation constant
- dissociation constant is a type of equilibrium constant that measures the propensity of a larger object to separate reversibly into smaller components, such as, for example, when a macromolecular complex comprising receptor and its cognate ligand separates into the ligand and the receptor.
- Kd is high, it means that a high concentration of ligand is needed to occupy the receptor, and the affinity of the receptor for the ligand is low.
- a low Kd means that the ligand has a high affinity for the receptor.
- a receptor that is “responsive” or “responsive to” refers to a receptor comprising an intracellular domain, that when bound by a ligand (i.e.
- an activator receptor bound to a target antigen can generate a signal that causes activation of an immune cell expressing the activator receptor.
- An inhibitory receptor bound to a non- target antigen can generate an inhibitory signal that prevents or reduces an activation of an immune cell expressing the activator receptor. Responsiveness of receptors, and their ability to activate or inhibit immune cells expressing the receptors, can be assayed by any means known in the art and described herein, including, but not limited to, reporter assays and cytotoxicity assays.
- activation of an immune cell or an immune cell that is “activated” refers to an immune cell that can carry out one or more functions characteristic of an immune response. These functions include proliferation, release of cytokines, and cytotoxicity, i.e. killing of a target cell.
- Activated immune cells express markers that will be apparent to persons of skill in the art. For example, activated T cells can express one or more of CD69, CD71, CD25 and HLA-DR.
- An immune cell expressing an activator receptor e.g. a MSLN CAR
- an activator receptor can be activated by the activator receptor when it becomes responsive to the binding of the receptor to a target antigen (e.g. MSLN) expressed by the target cell.
- a “target antigen” can also be referred to an “activator antigen” and may be isolated or expressed by a target cell. Activation of an immune cell expressing an inhibitory receptor can be prevented when the inhibitory receptor becomes responsive to a non-target antigen (e.g. HLA-A*02), even when the activator receptor is bound to the target activator ligand.
- a “non-target antigen” can also be referred to as an “inhibitory ligand” or a “blocker”, and may be isolated or expressed by a target cell.
- Receptor expression on an immune cell can be verified by assays that report the presence of the activator receptors and inhibitory receptors described herein.
- a population of immune cells can be stained with a labeled molecule (e.g. a fluorophore labeled receptor-specific antibody or a fluorophore-labeled receptor-specific ligand), and quantified using fluorescence activated cell sorting (FACS) flow cytometry.
- FACS fluorescence activated cell sorting
- This method allows a percentage of immune cells in a population of immune cells to be characterized as expressing an activator receptor, an inhibitory receptor, or both receptors.
- the ratio of activator receptor and inhibitory receptors expressed by the immune cells described herein can be determined by, for example, digital droplet PCR.
- a suitable percentage of immune cells expressing both an activator receptor and an inhibitory receptor is determined specifically for the methods described herein.
- a suitable percentage of immune cells expressing both an activator receptor and in inhibitory receptor can be at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, or at least 95%.
- a suitable ratio of activator receptor and inhibitory receptor in an immune cell can be about 5:1, about 4:1, about 3:1, about 2:1, about 1:1, about 1:2, about 1:3, about 1:4, or about 1:5. It is understood that purification, enrichment, and/or depletion steps can be used on populations of immune cells to meet suitable values for the immune cells, pharmaceutical compositions, and kits described herein.
- a responsive receptor expressed by the immune cells described herein can be verified by assays that measure the generation of a signal expected to be generated by the intracellular domain of the receptor.
- Reporter cell lines such as Jurkat-Luciferase NFAT cells (Jurkat cells) can be used to characterize a responsive receptor.
- Jurkat cells are derived from T cells and comprise a stably integrated nuclear factor of activated T-cells (NFAT)-inducible luciferase reporter system.
- NFAT is a family of transcription factors required for immune cell activation, whose activation can be used as a signaling marker for T cell activation.
- Jurkat cells can be transduced or transfected with the activator receptors and/or inhibitory receptors described herein.
- the activator receptor is responsive to the binding of a ligand if the Jurkat cell expresses a luciferase reporter gene, and the level of responsiveness can be determined by the level of reporter gene expression.
- the presence of luciferase can be determined using any known luciferase detection reagent, such as luciferin.
- An inhibitory receptor is responsive to the binding of a ligand if, when co-expressed with an activator receptor in Jurkat cells, it prevents a normally responsive immune cell from expressing luciferase in response to the activator receptor.
- the responsiveness of an inhibitory receptor can be determined and quantified in a Jurkat cell expressing both an activator and an inhibitor by observing the following: 1) the Jurkat cell expresses luciferase in the presence of activator receptor ligand and absence of inhibitory receptor ligand; and 2) luciferase expression in the Jurkat cell is reduced or eliminated in the presence of both an activator receptor ligand and an inhibitory receptor ligand.
- This approach can be used to determine the sensitivity, potency, and selectivity of activator receptors and specific pairs of activator receptors and inhibitory receptors.
- the sensitivity, potency, and selectivity can be quantified by EC50 or IC50 values using dose- response experiments, where an activator receptor ligand and/or inhibitory receptor ligand is titrated into a culture of Jurkat cells expressing an activator receptor or a specific pair of activator and inhibitory receptors.
- the EC50 and IC50 values can be determined in a co-culture of immune cells (e.g. Jurkat cells or primary immune cells) expressing an activator receptor or a specific pair of activator and inhibitory receptors and target cells expressing an increasing amount of an activator ligand or inhibitor ligand.
- An increasing amount of activator ligand or inhibitor ligand can be accomplished in the target cell by, for example, titration of activator ligand or inhibitor ligand encoding mRNA into target cells, or use of target cells that naturally express different levels of the target ligands.
- Exemplary suitable EC50 and IC50 values for the activator and inhibitory receptors as determined used target cells expressing varying amounts of the target and non-target ligands include an EC50 of 10 transcripts per million (TPM) or less for the activator receptor, for example an EC50 of between 2-10 TPM, and an IC50 of 25 TPM or less for the inhibitory receptor, for example an IC50 of 5-21 TPM.
- Activation of the immune cells described herein that express an activator receptor or specific pairs of activator and inhibitory receptors can be further determined by assays that measure the viability of a target cell following co-incubation with said immune cells.
- the immune cells sometimes referred to as effector cells, are co-incubated with target cells that express an activator receptor ligand, an inhibitory receptor ligand, or both an activator and inhibitory receptor ligand.
- viability of the target cell is measured using any method to measure viability in a cell culture. For example, viability can be determined using a mitochondrial function assay that uses a tetrazolium salt substrate to measure active mitochondrial enzymes. Viability can also be determined using imaging based methods.
- Target cells can express a fluorescent protein, such as green fluorescent protein or red fluorescent protein. Reduction in total cell fluorescence indicates a reduction in viability of the target cell. A reduction in viability of the target cell following incubation with immune cells expressing an activator receptor or a specific pair of activator and inhibitory receptors is interpreted as target cell-mediated activation of the immune cell. A measure of the selectivity of the immune cells can also be determined using this approach.
- the immune cell expressing a pair of activator and inhibitory receptors is selective if the following is observed: 1) viability is reduced in target cells expressing the activator receptor ligand but not the inhibitory receptor ligand; 2) viability is not reduced in target cells expressing both an activator receptor ligand and an inhibitory receptor ligand.
- a “specific killing” value can be derived that quantifies the percentage of immune cell activation based on the reduction in viability of target cell as a percentage of a negative control (immune cells that do not express an activator receptor).
- a “selectivity ratio” value can be derived that represents the ratio of the specific killing observed in target cells expressing an activator receptor ligand in the absence of inhibitory receptor ligand to the specific killing observed in target cells expressing both an activator receptor ligand and an inhibitory receptor ligand. This approach can be used to characterize the population of cells for the production and manufacturing of the immune cells, pharmaceutical compositions, and kits described herein.
- a suitable specific killing value for the immune cells, pharmaceutical compositions, and kits can be, for example, the following criteria: 1) at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97% or at least 99% specific killing following a 48 hour co-incubation of immune cells and target cells expressing activator receptor ligand in the absence of inhibitory receptor ligand; and 2) less than or equal to 40%, less than or equal to 35%, less than or equal to 30%, less than or equal to 25%, less than or equal to 20%, less than or equal to 15%, less than or equal to 10%, less than or equal to 5%, less than or equal to 3% or less than or equal to 1% specific killing of target cell expressing both an activator receptor ligand and an inhibitory receptor ligand.
- a suitable specific killing value for the immune cells, pharmaceutical compositions and kits can be the following criteria: 1) between 30% and 99%, between 40% and 99%, between 50% and 99%, between 55% and 95%, between 60% and 95%, between 60% and 90%, between 50% and 80%, between 50% and 70% or between 50% and 60% of target cells expressing the activator ligand but not the inhibitor ligand are killed; and 2), between 1% and 40%, between 3% and 40%, between 5% and 40%, between 5% and 30%, between 10% and 30%, between 15% and 30% or between 5% and 20% of target cells expressing the activator ligand and the inhibitor ligand are killed.
- a suitable specific killing value for the immune cells, pharmaceutical compositions, and kits can be, for example, the following criteria: 1) at least 50% specific killing following a 48 hour co-incubation of immune cells and target cells expressing activator receptor ligand in the absence of inhibitory receptor ligand; and 2) less than or equal to 20% specific killing of target cell expressing both an activator receptor ligand and an inhibitory receptor ligand.
- the immune cells are capable of killing at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 97% or at least 99% of target cells expressing the activator ligand and not the inhibitor ligand over a period of 6 hours, 12 hours, 18 hours, 24 hours, 30 hours, 36 hours, 42 hours, 48 hours, 54 hours, or 60 hours, while killing less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, less than 3% or less than 1% of target cells expressing the activator and inhibitor ligands over the same time period.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at least FIG. 44about 50% to at least about 95%.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95%.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at most about 50%, at most about 55%, at most about 60%, at most about 65%, at most about 70%, at most about 75%, at most about 80%, at most about 85%, at most about 90%, or at most about 95%.
- a suitable specific killing value of target cells expressing both an activator receptor ligand and an inhibitory receptor ligand for the immune cells, pharmaceutical compositions, and kits can be less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less than about 5%.
- the suitable specific killing value for the immune cells, pharmaceutical compositions, and kits can be determined following about 6 hours, about 12 hours, about 18 hours, about 24, about 30 hours, about 36 hours, about 42 hours, about 48 hours, about 54 hours, about 60 hours, about 66 hours, or about 72 hours of co-incubation of immune cells with target cells.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at least about 50% to at least about 95%.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95%.
- a suitable specific killing value of the target cell expressing an activator ligand in the absence of an inhibitory ligand value for the immune cells, pharmaceutical compositions, and kits can be, for example, at most about 50%, at most about 55%, at most about 60%, at most about 65%, at most about 70%, at most about 75%, at most about 80%, at most about 85%, at most about 90%, or at most about 95%.
- a suitable specific killing value of target cells expressing both an activator receptor ligand and an inhibitory receptor ligand for the immune cells, pharmaceutical compositions, and kits can be can be less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less than about 5%.
- the suitable specific killing value for the immune cells, pharmaceutical compositions, and kits can be determined following about 6 hours, about 12 hours, about 18 hours, about 24, about 30 hours, about 36 hours, about 42 hours, about 48 hours, about 54 hours, about 60 hours, about 66 hours, or about 72 hours of co-incubation of immune cells with target cells.
- the term “functional variant” refers to a protein that has one or more amino-acid substitutions, insertions, or deletions as compared to a parental protein, and which retains one or more desired activities of the parental protein.
- a functional variant may be a fragment of the protein (i.e. a variant having N- and/or C-terminal deletions) that retain the one or more desired activities of the parental protein.
- the disclosure provides a first receptor, comprising a first extracellular ligand binding domain specific to a target antigen comprising a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I).
- the first receptor is an activator receptor, and mediates activation of an immune cell expressing the first receptor upon binding of the target antigen by the extracellular ligand binding domain of the first receptor.
- the first receptor is responsive to a target antigen (i.e. activator ligand).
- a target antigen i.e. activator ligand
- the first receptor is responsive and activates an immune cell expressing the first receptor upon binding of the target antigen by the extracellular ligand binding domain of the first receptor.
- the first receptor is a chimeric antigen receptor (CAR).
- the first receptor is a T cell receptor (TCR).
- the first receptor is humanized.
- humanized refers to the replacement of a sequence or a subsequence in a transgene that has been isolated or derived from a non-human species with a homologous, or functionally equivalent, human sequence.
- a humanized antibody can be created by grafting mouse CDRs into human framework sequences, followed by back substitution of certain human framework residues for the corresponding mouse residues from the source antibody.
- Activator Targets [0149]
- the target antigen for the first receptor is a cancer cell specific antigen. Any cell surface molecule expressed by the target cancer cells may be a suitable target antigen for the first receptor ligand binding domain.
- a cell adhesion molecule for example, a cell adhesion molecule, a cell-cell signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane, a receptor for a neurotransmitter or a voltage gated ion channel can be used as a target antigen.
- the target antigen is a peptide antigen of a cancer cell- specific antigen in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- any molecule expressed by the target cancer cells and presented by the major histocompatibility complex class I (MHC-I) on the cancer cell surface as a peptide antigen (pMHC) may be a suitable target antigen for the first receptor extracellular ligand binding domain.
- the cancer cell-specific antigen is Mesothelin (MSLN), or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I).
- MSLN Mesothelin
- MHC-I Major histocompatibility complex class I
- the major histocompatibility complex class I (MHC-I) is a protein complex that displays antigens to cells of the immune system, triggering an immune response.
- HLAs Human Leukocyte Antigens
- HLA-A Human Leukocyte Antigens
- HLA-B Human Leukocyte Antigens
- HLA-C Human Leukocyte Antigens
- HLA-E Human Leukocyte Antigens
- HLA-G Cancer cell-specific pMHC antigens comprising any of HLA-A, HLA-B, HLA-C, HLA-E, HLA-F or HLA-G are envisaged as within the scope of the disclosure.
- the cancer cell-specific antigen comprises HLA-A.
- HLA-A receptors are heterodimers comprising a heavy ⁇ chain and smaller ⁇ chain. The ⁇ chain is encoded by a variant of HLA-A, while the ⁇ chain ( ⁇ 2-microglobulin) is an invariant.
- the MHC-I comprises a human leukocyte antigen A*02 allele (HLA-A*02).
- the cancer cell-specific antigen comprises HLA-B. Hundreds of versions (alleles) of the HLA-B gene are known, each of which is given a particular number (such as HLA-B*27).
- the cancer cell-specific antigen comprises HLA-C.
- HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin).
- the cancer cell-specific antigen is an ovarian cancer antigen, a pancreatic cancer antigen, a lung cancer antigen, a colorectal cancer antigen or a mesothelioma antigen. In some embodiments, the cancer cell-specific antigen is a colorectal cancer antigen. In some embodiments, the cancer cell-specific antigen is MSLN or a peptide antigen thereof. [0157] In some embodiments, the cancer cell-specific antigen is MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- MSLN is a 40 KDa protein that is normally expressed in mesothelial cells, as well as lung, fallopian tube, salivary gland and adipose tissues (FIG.2). MSLN is expressed in multiple human tumor types, including mesothelioma cancer, ovarian cancer, cervical cancer, colorectal cancer, esophageal cancer, head and neck cancer, kidney cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancer, colorectal cancer, or cholangiocarcinoma.
- the cancer has relapsed in a subject.
- the cancer is refractory to one or more prior administered anticancer therapies.
- the cancer is metastatic.
- MSLN isoform 1 preprotein is described in NCBI record number NP_005814.2, the contents of which are incorporated by reference herein.
- MSLN comprises an amino acid sequence of: [0159]
- MSLN comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 1.
- MSLN isoform 2 preprotein is described in NCBI record number NP_037536.2, the contents of which are incorporated by reference herein.
- MSLN comprises an amino acid sequence of: [0161] In some embodiments, MSLN comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 2. In some embodiments, the cancer cell-specific antigen is a peptide antigen derived from MSLN. In some embodiments, the peptide antigen comprises a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to a subsequence of SEQ ID NO: 1 and/or SEQ ID NO: 2.
- the peptide antigen comprises a sequence identical to a subsequence of SEQ ID NO: 1 and/or SEQ ID NO: 2.
- Extracellular Ligand Binding Domain [0162] The disclosure provides a first receptor, comprising a first extracellular ligand binding domain specific to a target antigen.
- the target antigen comprises a cancer cell-specific antigen.
- the cancer cell-specific antigen is MSLN or a MSLN- derived peptide antigen complexed with MHC-I, and the ligand binding domain of the first receptor recognizes and binds to the MSLN antigen.
- the ligand binding domain is an antigen binding domain.
- antigen binding domains include, inter alia, scFv, SdAb, V ⁇ -only domains, and TCR antigen binding domains derived from the TCR ⁇ and ⁇ chain variable domains.
- Any type of antigen binding domain is envisaged as within the scope of the instant disclosure.
- the first extracellular ligand binding domain may be part of a contiguous polypeptide chain including, for example, a V ⁇ -only domain, a single domain antibody fragment (sdAb) or heavy chain antibodies HCAb, a single chain antibody (scFv) derived from a murine, humanized or human antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, N.Y.; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci.
- sdAb single domain antibody fragment
- HCAb heavy chain antibodies
- scFv single chain antibody
- the first extracellular ligand binding domain comprises an antigen binding domain that comprises an antibody fragment.
- the first extracellular ligand binding domain comprises an antibody fragment that comprises a scFv or an sdAb.
- antibody refers to a protein, or polypeptide sequences derived from an immunoglobulin molecule, which specifically binds to an antigen. Antibodies can be intact immunoglobulins of polyclonal or monoclonal origin, or fragments thereof and can be derived from natural or from recombinant sources.
- antibody fragment refers to at least one portion of an antibody, or recombinant variants thereof, that contains the antigen binding domain, i.e., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen and its defined epitope.
- antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments, single-chain (sc)Fv (“scFv”) antibody fragments, linear antibodies, single domain antibodies (abbreviated “sdAb”) (either VL or VH), camelid VHH domains, and multi-specific antibodies formed from antibody fragments.
- scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.
- “Heavy chain variable region” or “VH” refers to the fragment of the heavy chain that contains three CDRs interposed between flanking stretches known as framework regions, these framework regions are generally more highly conserved than the CDRs and form a scaffold to support the CDRs.
- a scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.
- the antigen binding domain of the activator and/or inhibitory receptor comprises an scFv.
- the scFv comprises a VL and VH region joined by a linker.
- the linker comprises a glycine serine linker, for example GGGGSGGGGSGGGGSGG (SEQ ID NO: 152).
- the scFv further comprises a signal sequence at the N terminus of the scFv.
- Exemplary signal sequences include MDMRVPAQLLGLLLLWLRGARC (SEQ ID NO: 362), which is encoded by [0173]
- antibody light chain refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa (“ ⁇ ”) and lambda (“ ⁇ ”) light chains refer to the two major antibody light chain isotypes.
- recombinant antibody refers to an antibody that is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system.
- V ⁇ domain refers to an antigen binding domain that consists essentially of a single T Cell Receptor (TCR) beta variable domain that specifically binds to an antigen in the absence of a second TCR variable domain.
- the V ⁇ -only domain engages antigen using complementarity-determining regions (CDRs).
- CDRs complementarity-determining regions
- Each V ⁇ -only domain contains three complement determining regions (CDR1, CDR2, and CDR3). Additional elements may be combined provided that the V ⁇ domain is configured to bind the epitope in the absence of a second TCR variable domain.
- the extracellular ligand binding domain of the first receptor comprises an antibody fragment, a single chain Fv antibody fragment (scFv), or a ⁇ chain variable domain (V ⁇ ).
- the extracellular ligand binding domain of the first receptor comprises a TCR ⁇ chain variable domain and a TCR ⁇ chain variable domain.
- the extracellular ligand binding domain of the first receptor comprises an scFv antigen binding domain.
- Exemplary MSLN scFv are shown in Table 1 below. Table 1: Exemplary MSLN scFv domains
- the extracellular ligand binding domain of the first receptor is an scFv.
- the scFv domain binds to MSLN.
- the scFv is the ligand binding domain of a CAR. Exemplary scFv domains specific to MSLN are shown in Table 1, supra. In Table 1, underlining indicates CDR sequences.
- the extracellular ligand binding domain of the first receptor comprises an antigen binding domain having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity or at least 99% identity to a sequence of SEQ ID NOS: 3-6, 80 or 154-215, or a sequence as set forth in Table 1.
- the extracellular ligand binding domain of the first receptor comprises an antigen binding domain comprising a sequence of SEQ ID NOS: 3-6, 80 or 154-215, as set forth in Table 1.
- the extracellular ligand binding domain of the first receptor comprises an binding domain having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity or at least 99% identity to a sequence of SEQ ID NO: 171.
- the extracellular ligand binding domain of the first receptor comprises a binding domain comprising a sequence of SEQ ID NO: 171.
- the extracellular ligand binding domain of the first receptor comprises an scFv antigen binding domain having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 97% identity or at least 99% identity to any one of SEQ ID NOs: 3-6.
- the extracellular ligand binding domain of the first receptor comprises an scFv antigen binding domain comprising a sequence of any one of SEQ ID NOs: 3-6 or 80. In some embodiments, the extracellular ligand binding domain of the first receptor consists essentially of a sequence selected from the group consisting of SEQ ID NOs: 3-6 or 80. Table 2: Sequences of MSLN complementary determining regions (CDRs)
- the extracellular ligand binding domain of the first receptor comprises the HC CDR1, the HC CDR2, and the HC CDR3 set forth in Table 2 (e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc. of Table 2) or sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of Table 2.
- the extracellular ligand binding domain of the first receptor comprises the LC CDR1, the LC CDR2, and the LC CDR3 set forth in Table 2 (e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line A, line B, or line C of Table 2) or sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of Table 2.
- the extracellular ligand binding domain of the first receptor comprises the HC CDR1, the HC CDR2, and the HC CDR3 set forth in Table 2 (e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc. of Table 2).
- the extracellular ligand binding domain of the first receptor comprises the LC CDR1, the LC CDR2, and the LC CDR3 set forth in Table 2 (e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line A, line B, or line C of Table 2).
- the extracellular ligand binding domain of the first receptor comprises the HC CDR1, HC CDR2, HC CDR3, LC CDR1, the LC CDR2, and the LC CDR3 set forth in Table 2 (e.g., the HC CDR1, HC CDR2 and HC CDR3 set forth in line 1, and the LC CDR 1, the LC CDR2, and the LC CDR 3 in line A)
- the extracellular ligand binding domain of the first receptor comprises the HC CDR1, the HC CDR2, and the HC CDR3 set forth in Table 2 (e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc.
- the extracellular ligand binding domain of the first receptor comprises the LC CDR1, the LC CDR2, and the LC CDR3 set forth in Table 2 (e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line A, line B, or line C of Table 2) or sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of Table 2.
- an extracellular ligand binding domain of the first receptor comprises one or more HC CDRs set forth in Table 2 and one or more LC CDRs set forth in Table 2.
- the extracellular ligand binding domain of the first receptor comprises (i) the HC CDR1, the HC CDR2, and the HC CDR3 set forth in one line of Table 2 (e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc. of Table 2) and (ii) the LC CDR1, the LC CDR2, and the LC CDR3 set forth in one line of Table 2 (e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line A, line B, or line C of Table 2).
- Table 2 e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc. of Table 2
- the LC CDR1, the LC CDR2, and the LC CDR3 set forth in one line of Table 2 e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line
- the HC CDRs may be paired with any of the LC CDRs, as the heavy chains and light chains share similarity, with routine testing to confirm desired expression and binding activity; however, preferred pairing between heavy and light chains of some embodiments are indicated in the right hand column of Table 2.
- the extracellular ligand binding domain of the first receptor comprises a HC CDR1 comprising a sequence of SGDYYWS (SEQ ID NO: 438), a HC CDR2 comprising a sequence of YIYYSGSTYYNPSLKS (SEQ ID NO: 454), and HC CDR3 comprising a sequence of CAREDVVKGAFDIW (SEQ ID NO: 533), or CDR sequences having at most 1, 2 or 3 amino acid substitutions, insertions or deletions relative thereto.
- the extracellular ligand binding domain of the first receptor comprises a HC CDR1 comprising a sequence of SGDYYWS (SEQ ID NO: 438), a HC CDR2 comprising a sequence of YIYYSGSTYYNPSLKS (SEQ ID NO: 454), and HC CDR3 comprising a sequence of CAREDVVKGAFDIW (SEQ ID NO: 533).
- the extracellular ligand binding domain of the first receptor comprises a LC CDR1 comprising a sequence of RASQSISSYLN (SEQ ID NO: 535), a LC CDR2 comprising a sequence of AASSLQS (SEQ ID NO: 539), and a LC CDR3 comprising a sequence of QQSYSTPLT (SEQ ID NO: 542), or CDR sequences having at most 1, 2 or 3 amino acid substitutions, insertions or deletions relative thereto.
- the extracellular ligand binding domain of the first receptor comprises a LC CDR1 comprising a sequence of RASQSISSYLN (SEQ ID NO: 535), a LC CDR2 comprising a sequence of AASSLQS (SEQ ID NO: 539), and a LC CDR3 comprising a sequence of QQSYSTPLT (SEQ ID NO: 542).
- the extracellular ligand binding domain of the first receptor comprises a HC CDR1 comprising a sequence of SGDYYWS (SEQ ID NO: 438), a HC CDR2 comprising a sequence of YIYYSGSTYYNPSLKS (SEQ ID NO: 454), HC CDR3 comprising a sequence of CAREDVVKGAFDIW (SEQ ID NO: 533), a LC CDR1 comprising a sequence of RASQSISSYLN (SEQ ID NO: 535), a LC CDR2 comprising a sequence of AASSLQS (SEQ ID NO: 539), and a LC CDR3 comprising a sequence of QQSYSTPLT (SEQ ID NO: 542), or CDR sequences having at most 1, 2 or 3 amino acid substitutions, insertions or deletions relative thereto.
- the extracellular ligand binding domain of the first receptor comprises a HC CDR1 comprising a sequence of SGDYYWS (SEQ ID NO: 438), a HC CDR2 comprising a sequence of YIYYSGSTYYNPSLKS (SEQ ID NO: 454), HC CDR3 comprising a sequence of CAREDVVKGAFDIW (SEQ ID NO: 533), a LC CDR1 comprising a sequence of RASQSISSYLN (SEQ ID NO: 535), a LC CDR2 comprising a sequence of AASSLQS (SEQ ID NO: 539), and a LC CDR3 comprising a sequence of QQSYSTPLT (SEQ ID NO: 542).
- the extracellular ligand binding domain of the first receptor comprises an scFv.
- the scFv comprises a heavy chain comprising CDRs selected from the sequences of GYTMN (SEQ ID NO: 448), LITPYNGASSYNQKFRG (SEQ ID NO: 470) and GGYDGRGFDY (SEQ ID NO: 534).
- the heavy chain comprises sequences of GYTMN (SEQ ID NO: 448), LITPYNGASSYNQKFRG (SEQ ID NO: 470) and GGYDGRGFDY (SEQ ID NO: 534).
- the scFv comprising a light chain comprising CDRs selected from the sequences of SASSSVSYMH (SEQ ID NO: 538), DTSKLAS (SEQ ID NO: 541) and QQWSGYPLT (SEQ ID NO: 545).
- the light chain comprises sequences of SASSSVSYMH (SEQ ID NO: 538), DTSKLAS (SEQ ID NO: 541) and QQWSGYPLT (SEQ ID NO: 545).
- the extracellular ligand binding domain of the first receptor comprises a variable heavy region (VH) sequence set forth in Table 3.
- VH variable heavy region
- the extracellular ligand binding domain of the first receptor comprises a VH sequence that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a VH set forth in Table 3.
- the extracellular ligand binding domain of the first receptor comprises a variable light region (VL) sequence set forth in Table 4.
- the extracellular ligand binding domain of the first receptor comprises a VL sequence that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a VL set forth set forth in Table 4.
- the extracellular ligand binding domain of the first receptor comprises a VH that (i) comprises the HC CDR1, the HC CDR2, and the HC CDR3 sequences set forth in Table 2 (e.g., the HC CDR 1, the HC CDR2, and the HC CDR 3 of line #1, line #2, line #3, etc.
- extracellular ligand binding domain of the first receptor comprises the LC CDR1, the LC CDR2, and the LC CDR3 sequences set forth in one line Table 2 (e.g., the LC CDR 1, the LC CDR2, and the LC CDR 3 of line A, line B, or line C of Table 2) and a VL sequence set forth in Table 4 and (ii) has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a VL set forth set forth in Table 4.
- the extracellular ligand binding domain of the first receptor comprises (i) a VH sequence set forth in Table 3 or a VH sequence that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a VH set forth in Table 3, and (ii) a VL sequence set forth in Table 4 or a VL that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to a VL set forth set forth in Table 4.
- the VH may be paired with any of the VLs, as the heavy chains and light chains share similarity, with routine testing to confirm desired expression and binding activity; however, the preferred pairing between Table 3 and Table 4 is indicated in the “LC” column of Table 3, corresponding to the # column of Table 4.
- the extracellular ligand binding domain of the first receptor comprises a VH sequence of SEQ ID NO: 233, or a sequence that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity thereto.
- the extracellular ligand binding domain of the first receptor comprises a VH sequence of SEQ ID NO: 233.
- the extracellular ligand binding domain of the first receptor comprises a VL sequence of SEQ ID NO: 279, or a sequence that has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity thereto.
- the extracellular ligand binding domain of the first receptor comprises a VL sequence of SEQ ID NO: 279.
- the extracellular ligand binding domain of the first receptor comprises a VH sequence of SEQ ID NO: 233, and a VL sequence of SEQ ID NO: 279, or sequences that have at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity thereto.
- the VH and VL are separated for a linker, for example a linker comprising a sequence of GGGGSGGGGSGGGGSGG (SEQ ID NO: 152).
- the VH and VL can be in any orientation, for example VH, linker, VL; or alternatively, VL, linker VH.
- one or more (e.g., 1, 2, 3, 4, 5, or 6) amino acid residues in a CDR of the antigen binding domains provided herein are substituted with another amino acid.
- the substitution may be “conservative” in the sense of being a substitution within the same family of amino acids.
- amino acids with basic side chains lysine, arginine, histidine
- amino acids with acidic side chains aspartic acid, glutamic acid
- amino acids with uncharged polar side chains asparagine, glutamine, serine, threonine, tyrosine
- amino acids with nonpolar side chains glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, cysteine.
- Chimeric Antigen Receptors [0195] The disclosure provides a first, activator receptor and immune cells comprising same. In some embodiments, the first receptor is a chimeric antigen receptor. [0196] The term “chimeric antigen receptors (CARs)” as used herein, may refer to artificial receptors derived from T-cell receptors and encompasses engineered receptors that graft an artificial specificity onto a particular immune effector cell.
- CARs may be employed to impart the specificity of a monoclonal antibody onto a T cell, thereby allowing a large number of specific T cells to be generated, for example, for use in adoptive cell therapy.
- CARs direct specificity of the cell to a tumor associated antigen, for example.
- Exemplary CARs comprise an intracellular activation domain, a transmembrane domain, and an extracellular domain comprising a tumor associated antigen binding region.
- CARs further comprise a hinge domain.
- CARs comprise fusions of single-chain variable fragments (scFv) derived from monoclonal antibodies, fused to a CD3 transmembrane domain and endodomain.
- CARs may be derived from ligands of receptors (e.g., peptides).
- CARs comprise domains for additional co-stimulatory signaling, such as CD3, 4-1BB, FcR, CD27, CD28, CD137, DAP10, and/or OX40.
- molecules can be co-expressed with the CAR, including co-stimulatory molecules, reporter genes for imaging, gene products that conditionally ablate the T cells upon addition of a pro-drug, homing receptors, cytokines, and cytokine receptors.
- the extracellular ligand binding domain of the first receptor is fused to the extracellular domain of a CAR.
- the CARs of the present disclosure comprise an extracellular hinge region. Incorporation of a hinge region can affect cytokine production from CAR-T cells and improve expansion of CAR-T cells in vivo.
- Exemplary hinges can be isolated or derived from IgD and CD8 domains, for example IgG1. In some embodiments, the hinge is isolated or derived from CD8 ⁇ or CD28. [0199] In some embodiments, the hinge is isolated or derived from CD8 ⁇ or CD28.
- the CD8 ⁇ hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of Q ( Q )
- the CD8 ⁇ hinge comprises SEQ ID NO: 7.
- the CD8 ⁇ hinge consists essentially of SEQ ID NO: 7.
- the CD8 ⁇ hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of NO: 8).
- the CD8 ⁇ hinge is encoded by SEQ ID NO: 8.
- the CD28 hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of CTIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 9).
- the CD28 hinge comprises or consists essentially of SEQ ID NO: 9.
- the CD28 hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of CCC (SEQ ID NO: 10) .
- the CD28 hinge is encoded by SEQ ID NO: 10.
- the CARs of the present disclosure can be designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR.
- the transmembrane domain that naturally is associated with one of the domains in the CAR is used.
- a CAR comprising a CD28 co-stimulatory domain might also use a CD28 transmembrane domain.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source.
- the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions may be isolated or derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, or from an immunoglobulin such as IgG4.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
- a glycine-serine doublet provides a particularly suitable linker.
- the CARs comprise a CD28 transmembrane domain.
- the CD28 transmembrane domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 11).
- the CD28 transmembrane domain comprises or consists essentially of SEQ ID NO: 11.
- the CD28 transmembrane domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of
- the CD28 transmembrane domain is encoded by SEQ ID NO: 12.
- the CARs comprise an IL- 2Rbeta transmembrane domain.
- the IL-2Rbeta transmembrane domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of IPWLGHLLVGLSGAFGFIILVYLLI (SEQ ID NO: 13).
- the IL- 2Rbeta transmembrane domain comprises or consists essentially of SEQ ID NO: 13.
- the IL-2Rbeta transmembrane domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of ( ) In some embodiments, the IL-2Rbeta transmembrane domain is encoded by SEQ ID NO: 14. [0205]
- the cytoplasmic domain or otherwise the intracellular signaling domain of the CARs of the instant disclosure is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed.
- effector function refers to a specialized function of a cell.
- intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. In some cases, multiple intracellular domains can be combined to achieve the desired functions of the CAR-T cells of the instant disclosure.
- intracellular signaling domain is thus meant to include any truncated portion of one or more intracellular signaling domains sufficient to transduce the effector function signal.
- the intracellular domain of CARs of the instant disclosure comprises at least one cytoplasmic activation domain.
- the intracellular activation domain ensures that there is T-cell receptor (TCR) signaling necessary to activate the effector functions of the CAR T-cell.
- the at least one cytoplasmic activation is a CD247 molecule (CD3 ⁇ ) activation domain, a stimulatory killer immunoglobulin-like receptor (KIR) KIR2DS2 activation domain, or a DNAX- activating protein of 12 kDa (DAP12) activation domain.
- CD3 ⁇ activation domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of [0209]
- the CD3 ⁇ activation domain comprises or consists essentially of SEQ ID NO: 15.
- the CD3 ⁇ activation domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of embodiments, the CD3 ⁇ activation domain is encoded by SEQ ID NO: 16).
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen- independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).
- Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs, which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- the ITAM contains a tyrosine separated from a leucine or an isoleucine by any two other amino acids (YxxL/I (SEQ ID NO: 546)).
- the cytoplasmic domain contains 1, 2, 3, 4 or 5 ITAMs.
- An exemplary ITAM containing cytoplasmic domain is the CD3 ⁇ activation domain.
- Further examples of ITAM containing primary cytoplasmic signaling sequences that can be used in the CARs of the instant disclosure include those derived from TCR ⁇ , FcR ⁇ , FcR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD5, CD22, CD79a, CD79b, and CD66d.
- the CD3 ⁇ activation domain comprising a single ITAM comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 17).
- the CD3 ⁇ activation domain comprises SEQ ID NO: 17.
- the CD3 ⁇ activation domain comprising a single ITAM consists essentially of an amino acid sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 17).
- the CD3 ⁇ activation domain comprising a single ITAM is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of A T (SEQ ID NO 18) In some embodiments, the CD3 ⁇ activation domain is encoded by SEQ ID NO: 18.
- the cytoplasmic domain of the CAR can be designed to comprise the CD3 ⁇ signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the instant disclosure.
- the cytoplasmic domain of the CAR can comprise a CD3 ⁇ chain portion and a co-stimulatory domain.
- the co-stimulatory domain refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- Examples of such molecules include the co-stimulatory domain is selected from the group consisting of IL- 2R ⁇ , Fc Receptor gamma (FcR ⁇ ), Fc Receptor beta (FcR ⁇ ), CD3g molecule gamma (CD3 ⁇ ), CD3 ⁇ , CD3 ⁇ , CD5 molecule (CD5), CD22 molecule (CD22), CD79a molecule (CD79a), CD79b molecule (CD79b), carcinoembryonic antigen related cell adhesion molecule 3 (CD66d), CD27 molecule (CD27), CD28 molecule (CD28), TNF receptor superfamily member 9 (4-1BB), TNF receptor superfamily member 4 (OX40), TNF receptor superfamily member 8 (CD30), CD40 molecule (CD40), programmed cell death 1 (PD-1), inducible T cell costimulatory (ICOS), lymphocyte function-associated antigen- 1 (LFA-1), CD2 molecule (CD2), CD7 molecule (CD7), TNF superfamily member 14 (LIGHT), killer
- the intracellular domains of CARs of the instant disclosure comprise at least one co- stimulatory domain.
- the co-stimulatory domain is isolated or derived from CD28.
- the intracellular domains of CARs of the instant disclosure comprise at least one co-stimulatory domain.
- the co-stimulatory domain is isolated or derived from CD28.
- the CD28 co-stimulatory domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 19).
- the CD28 co-stimulatory domain comprises or consists essentially of SEQ ID NO: 19.
- the CD28 co-stimulatory domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of AGGAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCCCC GGAGGCCTGGCCCCACCCGGAAGCACTACCAGCCCTACGCCCCTCCCAGGGAT TTCGCCGCCTACCGGAGC (SEQ ID NO: 20).
- the CD28 co- stimulatory domain is encoded by SEQ ID NO: 20.
- the co-stimulatory domain is isolated or derived from 4- 1BB.
- the 4-1BB co-stimulatory domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 283).
- the 4-1BB co-stimulatory domain comprises or consists essentially of KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 283).
- the 4-1BB co-stimulatory domain s encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGGC CAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGA AGAAGAAGGAGGATGTGAACTG (SEQ ID NO: 284).
- the intracellular domain of the CAR comprises a CD28 co- stimulatory domain, a 4-1BB costimulatory domain, and a CD3 ⁇ activation domain.
- the intracellular domain of the CAR comprises a sequence of RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQP FMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNL GRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGE RRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 285), or a sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity thereto.
- the cytoplasmic domains within the cytoplasmic signaling portion of the CARs of the instant disclosure may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet provides an example of a suitable linker.
- An exemplary linker comprises a sequence of GGGGSGGGGSGGGGSGG (SEQ ID NO: 152).
- the cytoplasmic domains within the cytoplasmic signaling portion of the CARs of the instant disclosure may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet provides an example of a suitable linker.
- Exemplary full length activator receptors of the disclosure are described in Table 20.
- the first activator receptor comprises a sequence of SEQ ID NOS: 286-347, as set forth in Table 20, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the first activator receptor comprises a sequence of SEQ ID NOS: 286-347, as set forth in Table 20.
- the first activator receptor comprises a sequence of SEQ ID NO: 288, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 297, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 301, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the first activator receptor comprises a sequence of SEQ ID NO: 302, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 303, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 314, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the first activator receptor comprises a sequence of SEQ ID NO: 335, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 340, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto. In some embodiments, the first activator receptor comprises a sequence of SEQ ID NO: 344, or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the cytoplasmic domains within the cytoplasmic signaling portion of the CARs of the instant disclosure may be linked to each other in a random or specified order.
- a short oligo- or polypeptide linker for example between 2 and 10 amino acids in length may form the linkage.
- a glycine-serine doublet provides an example of a suitable linker.
- T Cell Receptors TCRs
- the disclosure provides a first, activator receptor and immune cells comprising same.
- the first receptor is a T cell receptor (TCR).
- a “TCR”, sometimes also called a “TCR complex” or “TCR/CD3 complex” refers to a protein complex comprising a TCR alpha chain, a TCR beta chain, and one or more of the invariant CD3 chains (zeta, gamma, delta and epsilon), sometimes referred to as subunits.
- the TCR alpha and beta chains can be disulfide-linked to function as a heterodimer to bind to peptide-MHC complexes.
- TCR alpha/beta heterodimer engages peptide-MHC, conformational changes in the TCR complex in the associated invariant CD3 subunits are induced, which leads to their phosphorylation and association with downstream proteins, thereby transducing a primary stimulatory signal.
- the TCR alpha and TCR beta polypeptides form a heterodimer
- CD3 epsilon and CD3 delta form a heterodimer
- two CD3 zeta form a homodimer.
- any suitable ligand binding domain may be fused to an extracellular domain, hinge domain or transmembrane of the TCRs described herein.
- the ligand binding domain can be an antigen binding domain of an antibody or TCR, or comprise an antibody fragment, a V ⁇ only domain, a linear antibody, a single-chain variable fragment (scFv), or a single domain antibody (sdAb).
- the ligand binding domain is fused to one or more extracellular domains or transmembrane domains of one or more TCR subunits.
- the TCR subunit can be TCR alpha, TCR beta, CD3 delta, CD3 epsilon, CD3 gamma or CD3 zeta.
- the ligand binding domain can be fused to TCR alpha, or TCR beta, or portions of the ligand binding can be fused to two subunits, for example portions of the ligand binding domain can be fused to both TCR alpha and TCR beta.
- TCR subunits include TCR alpha, TCR beta, CD3 zeta, CD3 delta, CD3 gamma and CD3 epsilon.
- TCR transmembrane domains isolated or derived from any source are envisaged as within the scope of the disclosure.
- the transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the TCR complex has bound to a target.
- a transmembrane domain of particular use in this disclosure may include at least the transmembrane region(s) of e.g., the alpha, beta or zeta chain of the TCR, CD3 delta, CD3 epsilon or CD3 gamma, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
- the transmembrane domain can be attached to the extracellular region of a polypeptide of the TCR, e.g., the antigen binding domain of the TCR alpha or beta chain, via a hinge, e.g., a hinge from a human protein.
- the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, or a CD8a hinge.
- the hinge is isolated or derived from CD8 ⁇ or CD28.
- the extracellular ligand binding domain is attached to one or more transmembrane domains of the TCR.
- the transmembrane domain comprises a TCR alpha transmembrane domain, a TCR beta transmembrane domain, or both. In some embodiments, the transmembrane comprises a CD3 zeta transmembrane domain.
- a transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the intracellular region).
- one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the extracellular region
- additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the intracellular region
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be a natural TCR transmembrane domain, a natural transmembrane domain from a heterologous membrane protein, or an artificial transmembrane domain.
- the transmembrane domain may be a membrane anchor domain.
- a natural or artificial transmembrane domain may comprise a hydrophobic a-helix of about 20 amino acids, often with positive charges flanking the transmembrane segment.
- the transmembrane domain may have one transmembrane segment or more than one transmembrane segment. Prediction of transmembrane domains/segments may be made using publicly available prediction tools (e.g. TMHMM, Krogh et al. Journal of Molecular Biology 2001; 305(3):567-580; or TMpred, Hofmann & Stoffel Biol. Chem. Hoppe-Seyler 1993; 347: 166).
- membrane anchor systems include platelet derived growth factor receptor (PDGFR) transmembrane domain, glycosylphosphatidylinositol (GPI) anchor (added post- translationally to a signal sequence) and the like.
- the transmembrane domain comprises a TCR alpha transmembrane domain.
- the TCR alpha transmembrane domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: VIGFRILLLKVAGFNLLMTLRLW (SEQ ID NO: 21).
- the TCR alpha transmembrane domain comprises, or consists essentially of, SEQ ID NO: 21.
- the TCR alpha transmembrane domain is encoded by a sequence of GTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCTCATG ACGCTGCGGCTGTGG (SEQ ID NO: 22).
- the transmembrane domain comprises a TCR beta transmembrane domain.
- the TCR beta transmembrane domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: TILYEILLGKATLYAVLVSALVL (SEQ ID NO: 23).
- the TCR beta transmembrane domain comprises, or consists essentially of, SEQ ID NO: 23. In some embodiments, the TCR beta transmembrane domain is encoded by a sequence of ACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCTGGT CAGTGCCCTCGTGCTG (SEQ ID NO: 24).
- TCRs of the disclosure can comprise one or more intracellular domains. Exemplary TCRs comprising intracellular domains for use in the instant disclosure are described in PCT/US2020/045250 filed on September 6, 2020, the contents of which are incorporated herein by reference.
- the intracellular domain comprises one or more domains capable of providing a stimulatory signal to a transmembrane domain. In some embodiments, the intracellular domain comprises a first intracellular domain capable of providing a stimulatory signal and a second intracellular domain capable of providing a stimulatory signal. In other embodiments, the intracellular domain comprises a first, second and third intracellular domain capable of providing a stimulatory signal.
- the intracellular domains capable of providing a stimulatory signal are selected from the group consisting of a CD28 molecule (CD28) domain, a LCK proto- oncogene, Src family tyrosine kinase (Lck) domain, a TNF receptor superfamily member 9 (4-1BB) domain, a TNF receptor superfamily member 18 (GITR) domain, a CD4 molecule (CD4) domain, a CD8a molecule (CD8a) domain, a FYN proto-oncogene, Src family tyrosine kinase (Fyn) domain, a zeta chain of T cell receptor associated protein kinase 70 (ZAP70) domain, a linker for activation of T cells (LAT) domain, lymphocyte cytosolic protein 2 (SLP76) domain, (TCR) alpha, TCR beta, CD3 delta, CD3 gamma and CD3 epsilon intracellular domains.
- CD28 CD28
- LCK S
- an intracellular domain comprises at least one intracellular signaling domain.
- An intracellular signaling domain generates a signal that promotes a function a cell, for example an immune effector function of a TCR containing cell, e.g., a TCR-expressing T-cell.
- the intracellular domain of the first receptor of the disclosure includes at least one intracellular signaling domain.
- the intracellular domains of CD3 gamma, delta or epsilon comprise signaling domains.
- the extracellular domain, transmembrane domain and intracellular domain are isolated or derived from the same protein, for example T-cell receptor (TCR) alpha, TCR beta, CD3 delta, CD3 gamma, CD3 epsilon or CD3 zeta.
- TCR T-cell receptor
- Examples of intracellular domains for use in activator receptors of the disclosure include the cytoplasmic sequences of the TCR alpha, TCR beta, CD3 zeta, and 4-1BB, and the intracellular signaling co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.
- the intracellular signaling domain comprises a primary intracellular signaling domain.
- Exemplary primary intracellular signaling domains include those derived from the proteins responsible for primary stimulation, or antigen dependent stimulation.
- the intracellular domain comprises a CD3 delta intracellular domain, a CD3 epsilon intracellular domain, a CD3 gamma intracellular domain, a CD3 zeta intracellular domain, a TCR alpha intracellular domain or a TCR beta intracellular domain.
- the intracellular domain comprises a TCR alpha intracellular domain.
- a TCR alpha intracellular domain comprises Ser-Ser.
- a TCR alpha intracellular domain is encoded by a sequence of TCCAGC.
- the intracellular domain comprises a TCR beta intracellular domain.
- the TCR beta intracellular domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, or is identical to a sequence of: MAMVKRKDSR (SEQ ID NO: 25).
- the TCR beta intracellular domain comprises, or consists essentially of SEQ ID NO: 25.
- the TCR beta intracellular domain is encoded by a sequence of ATGGCCATGGTCAAGAGAAAGGATTCCAGA (SEQ ID NO: 26).
- the intracellular signaling domain comprises at least one stimulatory intracellular domain.
- the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma and CD3 epsilon intracellular domain, and one additional stimulatory intracellular domain, for example a co-stimulatory domain.
- the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma and CD3 epsilon intracellular domain, and two additional stimulatory intracellular domains.
- Exemplary co-stimulatory intracellular signaling domains include those derived from proteins responsible for co-stimulatory signals, or antigen independent stimulation.
- Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA, a Toll ligand receptor, as well as DAP10, DAP12, CD30, LIGHT, OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a/CD18) 4-1BB (CD137, TNF receptor superfamily member 9), and CD28 molecule (CD28).
- a co-stimulatory protein can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors.
- co-stimulatory domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional variant thereof.
- the stimulatory domain comprises a co-stimulatory domain.
- the co-stimulatory domain comprises a CD28 or 4-1BB co- stimulatory domain.
- CD28 and 4-1BB are well characterized co-stimulatory molecules required for full T cell activation and known to enhance T cell effector function.
- CD28 and 4-1BB have been utilized in chimeric antigen receptors (CARs) to boost cytokine release, cytolytic function, and persistence over the first-generation CAR containing only the CD3 zeta signaling domain.
- CARs chimeric antigen receptors
- inclusion of co-stimulatory domains, for example CD28 and 4-1BB domains, in TCRs can increase T cell effector function and specifically allow co-stimulation in the absence of co-stimulatory ligand, which is typically down-regulated on the surface of tumor cells.
- the stimulatory domain comprises a CD28 intracellular domain or a 4-1BB intracellular domain.
- Inhibitory Receptors [0245] The disclosure provides a second receptor, comprising an extracellular ligand binding domain specific to a non-target antigen that has been lost in a cancer cell, such as an allelic variant of a gene.
- the non-target allelic variant can be lost in the cancer cell through any mechanism, such as, without limitation, epigenetic changes that effect non-target allelic variant expression, mutations to the gene encoding the non-target allelic variant, disruption of cellular signaling that regulates expression of the non-target allelic variant, chromosome loss, partial or complete deletion of the genomic locus, gene silencing through modification of nucleic acids or heterochromatin, or loss of expression through other mechanisms.
- the cells or subject treated may exhibit a loss of expression of the non-target allelic variant because of non-genetic changes.
- the disclosure provides compositions and methods for killing cells and/or treating subject lacking expression of the non-target antigen from any cause, including but not limited to, loss of heterozygosity.
- the non-target antigen can be a protein, or an antigen peptide thereof in a complex with a major histocompatibility complex class I (MHC-I), where the non-target antigen comprises a polymorphism. Because the non-target antigen is polymorphic, loss of a single copy of the gene encoding the non-target antigen, which may occur through loss of heterozygosity in a cancer cell, yields a cancer cell that retains the other polymorphic variant of gene, but has lost the non-target antigen.
- MHC-I major histocompatibility complex class I
- a subject having HLA- A*02 and HLA-A*01 alleles at the HLA locus may have a cancer in which only the HLA- A*02 allele is lost.
- a subject having HLA-A*03 and HLA-A*01 alleles at the HLA locus may have a cancer in which only the HLA-A*03 allele is lost.
- the HLA-A*01 protein remains present, but is not recognized by the inhibitory receptor of immune cells encountering the cancer cell, because the inhibitor receptor is designed to be specific to the HLA-A*02, HLA-A*03, or other non-target antigen.
- the HLA-A*02, HLA-A*03, or other non-target antigen is present and inhibits activation of the engineered immune cell.
- the HLA-A*02, HLA-A*03, or other allelic variant is lost.
- Immune cells engineered to express the inhibitory receptor do not receive an inhibitory signal from the inhibitory receptor, as the inhibitory receptor only responds to the HLA- A*02, HLA-A*03, or other non-target antigen, which is absent on cancer cells.
- the immune cell is selectively activated, and selectively kills, cancer cells expressing MSLN but having lost HLA-A*02 (or another non-target antigen) due to loss- of-heterozygosity.
- HLA-A is used here as an example. Similar polymorphic variation occurs in the population at other MHC genes and in other non-MHC genes as well.
- the disclosure provides a second receptor, comprising an extracellular ligand binding domain specific to a non-target antigen selected from intercellular adhesion molecule 1 (ICAM1), catechol-O-methyltransferase (COMT), C-X-C motif chemokine ligand 16 (CXCL16), leucine rich repeat neuronal 4 (LRRN4) and uroplakin 3B (UPK3B), or an antigen peptide thereof in a complex with a major histocompatibility complex class I (MHC-I), wherein the non-target antigen may comprise a nonsynonymous, extracellular- domain polymorphism (e.g., in an extracellular domain of ICAM1, COMT, CXCL16), and immune cells comprising same.
- a non-target antigen selected from intercellular adhesion molecule 1 (ICAM1), catechol-O-methyltransferase (COMT), C-X-C motif chemokine ligand 16 (CXCL16), leucine rich
- the second receptor is an inhibitory chimeric antigen receptor.
- the non-target antigen may comprise a protein whose expression is lost in tumors, but present in key MSLN-expression normal tissues (e.g., LRRN4, UPK3B).
- Exemplary inhibitory receptors are described in PCT/US2020/045228 filed on September 6, 2020, PCT/US2020/064607, filed on December 11, 2020, PCT/US2021/029907, filed on April 29, 2021 and PCT/US2020/059856 filed on November 10, 2020, the contents of each of which are incorporated herein by reference.
- the second receptor is humanized.
- the disclosure provides a second receptor, which is an inhibitory receptor, comprising an extracellular ligand binding that can discriminate between single amino- acid variant alleles of a non-target antigen.
- This ability to discriminate between allelic variants of a non-target antigen allows the second receptor to inhibit activation of immune cells comprising the second receptor in the presence of non-target cells that express that the allele recognized by the ligand binding domain.
- activation of immune cells is not inhibited in the presence of target cells that have lost the allele, for example cancer cells that have lost one allele of a gene through loss of heterozygosity.
- the disclosure provides a second receptor, which is an inhibitory receptor, comprising an extracellular ligand binding that can discriminate between different levels of expression of a non-target antigen.
- This allows the second receptor to inhibit activation of immune cells comprising the second receptor in the presence of non-target cells that express the ligand for the second receptor, but to allow activation of immune cells in the presence of cancer cells that express low levels, or have no expression, of the ligand for the second receptor.
- Inhibitor Ligands [0251]
- the non-target antigen is not expressed by the target cells, and is expressed by non-target cells.
- the non-target antigen is expressed by healthy cells, i.e. cells that are not cancer cells.
- the target cells are a plurality of cancer cells that have lost expression of the non-target antigen through loss of heterozygosity (LOH).
- the non-target cells are a plurality of healthy cells (i.e., non-cancer cells), that express both the target and the non- target antigen.
- Any cell surface molecule expressed by the non-target cells that is not expressed by target cells may be a suitable non-target antigen for the second receptor extracellular ligand binding domain.
- a cell adhesion molecule, a cell-cell signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane, a receptor for a neurotransmitter or a voltage gated ion channel can be used as a non-target antigen.
- the target antigen is a peptide antigen of a cancer cell-specific antigen in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- the non-target antigen is lost in the cancer cells due to loss of heterozygosity.
- non-target antigens lost in cancer cells due to loss of heterozygosity include ICAM1, COMT and CXCL16.
- the non-target antigen is selected from the group consisting of a polymorphic variant of ICAM1, COMT and CXCL16.
- the non-target antigen is an antigen peptide comprising a polymorphic residue of ICAM1, COMT or CXCL16 in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- Non-target major histocompatibility complex class I MHC-I (or pMHC-I) antigens comprising any of HLA-A, HLA-B, HLA-C or HLA-E are envisaged as within the scope of the disclosure.
- the non-target antigen comprises a Major Histocompatibility Complex (MHC) protein.
- MHC Major Histocompatibility Complex
- the MHC is MHC class I.
- the MHC class I protein comprises a human leukocyte antigen (HLA) protein.
- the non-target antigen comprises an allele of an HLA Class I protein selected from the group consisting of HLA-A, HLA-B, HLA-C, or HLA-E.
- the HLA-A allele comprises HLA-A*01, HLA-A*02, HLA-A*03 or HLA-A*11.
- the HLA-B allele comprises HLA- B*07.
- the HLA-C allele comprises HLA-C*07.
- the non-target antigen comprises HLA-A.
- the non-target antigen comprises an allele of HLA-A.
- the allele of HLA-A comprises HLA-A*01, HLA-A*02, HLA-A*03 or HLA-A*11.
- the non-target antigen comprises HLA-A*69.
- the non-target antigen comprises a human leukocyte antigen A*02 allele (HLA-A*02). In some embodiments, the non-target antigen comprises a human leukocyte antigen A*03 allele (HLA-A*03). In some embodiments, the non-target antigen comprises a human leukocyte antigen A*11 allele (HLA-A*11). [0256] In some embodiments, the non-target antigen comprises an allele of HLA-B. In some embodiments, the allele of HLA-B comprises HLA-B*07. [0257] In some embodiments, the non-target antigen comprises HLA-C. In some embodiments, the HLA-C allele comprises HLA-C*07.
- the non-target antigen comprises ICAM1 or an antigen peptide thereof in a complex with MHC-I.
- Human ICAM1 is frequently lost through LOH in cancer cells.
- a wild type Human ICAM1 is described in NCBI record number NP_000192.2the contents of which are incorporated by reference herein in their entirety.
- ICAM1 comprises an amino acid sequence of: 1 MAPSSPRPAL PALLVLLGAL FPGPGNAQTS VSPSKVILPR GGSVLVTCST SCDQPKLLGI 61 ETPLPKKELL LPGNNRKVYE LSNVQEDSQP MCYSNCPDGQ STAKTFLTVY WTPERVELAP 121 LPSWQPVGKN LTLRCQVEGG APRANLTVVL LRGEKELKRE PAVGEPAEVT TTVLVRRDHH 181 GANFSCRTEL DLRPQGLELF ENTSAPYQLQ TFVLPATPPQ LVSPRVLEVD TQGTVVCSLD 241 GLFPVSEAQV HLALGDQRLN PTVTYGNDSF SAKASVSVTA EDEGTQRLTC AVILGNQSQE 301 TLQTVTIYSF PAPNVILTKP EVSEGTEVTV KCEAHPRAKV TLNGVPAQPL GPRAQLLLKA 3
- ICAM1 comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 27.
- Polymorphic residues of ICAM1 are marked as bold and underlined in SEQ ID NO: 27.
- rs5498 is a polymorphism at position 469 of SEQ ID NO: 27, which can be a K or an E.
- the non-target antigen comprises a polymorphism of ICAM1.
- the non-target antigen comprises a peptide derived from ICAM1 comprising a polymorphic residue of ICAM1.
- Polymorphic residues of ICAM1 include amino acid residue 469 of SEQ ID NO: 27.
- the non-target antigen comprises a peptide of ICAM1 comprising amino acid 469 of SEQ ID NO: 27.
- the non-target antigen comprises a K at position 469 of SEQ ID NO: 27.
- the non-target antigen comprises an E at position 469 of SEQ ID NO: 27.
- the non-target antigen comprises an ICAM1 polymorphism with an K at position 469 of SEQ ID NO: 27, and the second receptor comprises a ligand binding domain with a higher affinity for an ICAM1 ligand with an K at position 469 of SEQ ID NO: 27 than for an ICAM1 ligand with an E at position 469 of SEQ ID NO: 27.
- the non-target antigen comprises an ICAM1 polymorphism with an E at position 469 of SEQ ID NO: 27, and the second receptor comprises a ligand binding domain with a higher affinity for an ICAM1 ligand with an E at position 469 of SEQ ID NO: 27 than for an ICAM1 ligand with a K at position 469 of SEQ ID NO: 27.
- the non-target antigen comprises COMT or an antigen peptide thereof in a complex with MHC-I. Human COMT is frequently lost through LOH in cancer cells. [0264] A wild type Human COMT is described in NCBI record number NP_000192.2, the contents of which are incorporated by reference herein in their entirety.
- COMT comprises an amino acid sequence of: 1 MPEAPPLLLA AVLLGLVLLV VLLLLLRHWG WGLCLIGWNE FILQPIHNLL MGDTKEQRIL 61 NHVLQHAEPG NAQSVLEAID TYCEQKEWAM NVGDKKGKIV DAVIQEHQPS VLLELGAYCG 121 YSAVRMARLL SPGARLITIE INPDCAAITQ RMVDFAGVKD KVTLVVGASQ DIIPQLKKKY 181 DVDTLDMVFL DHWKDRYLPD TLLLEECGLL RKGTVLLADN VICPGAPDFL AHVRGSSCFE 241 CTHYQSFLEY REVVDGLEKA IYKGPGSEAG P (SEQ ID NO: 28).
- COMT comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 28.
- Polymorphic residues of COMT are marked as bold and underlined in SEQ ID NO: 28.
- V158M is a polymorphism at position 158 of SEQ ID NO: 28, which can be a V or an M.
- the non-target antigen comprises a polymorphism of COMT.
- the non-target antigen comprises a peptide derived from COMT comprising a polymorphic residue of COMT.
- Polymorphic residues of COMT 1 include amino acid residue 158 of SEQ ID NO: 28.
- the non-target antigen comprises a peptide of COMT comprising amino acid 158 of SEQ ID NO: 28.
- the non-target antigen comprises a V at position 158 of SEQ ID NO: 28.
- the non-target antigen comprises an M at position 158 of SEQ ID NO: 28.
- the non-target antigen comprises a COMT polymorphism with a V at position 158 of SEQ ID NO: 28
- the second receptor comprises a ligand binding domain with a higher affinity for a COMT ligand with an V at position 158 of SEQ ID NO: 28 than for a COMT ligand with an M at position 158 of SEQ ID NO: 28.
- the non-target antigen comprises a COMT polymorphism with a M at position 158 of SEQ ID NO: 28, and the second receptor comprises a ligand binding domain with a higher affinity for a COMT ligand with an M at position 158 of SEQ ID NO: 28 than for a COMT ligand with a V at position 158 of SEQ ID NO: 28.
- the non-target antigen comprises C-X-C motif chemokine ligand 16 (CXCL16) or an antigen peptide thereof in a complex with MHC-I.
- CXCL16 precursor is described in NCBI record number NP_001094282.1, the contents of which are incorporated by reference herein in their entirety.
- CXCL16 comprises an amino acid sequence of: 1 MSGSQSEVAP SPQSPRSPEM GRDLRPGSRV LLLLLLLV YLTQPGNGNE GSVTGSCYCG 61 KRISSDSPPS VQFMNRLRKH LRAYHRCLYY TRFQLLSWSV CGGNKDPWVQ ELMSCLDLKE 121 CGHAYSGIVA HQKHLLPTSP PISQASEGAS SDIHTPAQML LSTLQSTQRP TLPVGSLSSD 181 KELTRPNETT IHTAGHSLAA GPEAGENQKQ PEKNAGPTAR TSATVPVLCL LAIIFILTAA 241 LSYVLCKRRR GQSPQSSPDL PVHYIPVAPD SNT (SEQ ID NO: 29).
- the non-target antigen comprises a polymorphism of CXCL16.
- the non-target antigen comprises a peptide derived from CXCL16 comprising a polymorphic residue of CXCL16.
- Polymorphic residues of CXCL16 include positions 142 and 200 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising amino acid 142 or 200 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising an A at amino acid 200 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising a V at amino acid 200 of SEQ ID NO: 29. In some embodiments, the non-target antigen comprises a peptide of CXCL16 comprising an I at amino acid 142 of SEQ ID NO: 29. In some embodiments, the non-target antigen comprises a peptide of CXCL16 comprising a T at amino acid 142 of SEQ ID NO: 29. [0270] In some embodiments, the non-target antigen comprises a polymorphism of CXCL16.
- the non-target antigen comprises a peptide of CXCL16 comprising an A at amino acid 200 of SEQ ID NO: 29, and the second receptor comprises a ligand binding domain with a higher affinity for a CXCL16 ligand with an A at position 200 of SEQ ID NO: 29 than for a CXCL16 ligand with a V at position 200 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising a V at amino acid 200 of SEQ ID NO: 29, and the second receptor comprises a ligand binding domain with a higher affinity for a CXCL16 ligand with a V at position 200 of SEQ ID NO: 29 than for a CXCL16 ligand with an A at position 200 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising an I at amino acid 142 of SEQ ID NO: 29, and the second receptor comprises a ligand binding domain with a higher affinity for a CXCL16 ligand with an I at position 142 of SEQ ID NO: 29 than for a CXCL16 ligand with a T at position 142 of SEQ ID NO: 29.
- the non-target antigen comprises a peptide of CXCL16 comprising a T at amino acid 142 of SEQ ID NO: 29, and the second receptor comprises a ligand binding domain with a higher affinity for a CXCL16 ligand with a T at position 142 of SEQ ID NO: 29 than for a CXCL16 ligand with an I at position 142 of SEQ ID NO: 29.
- the non-target antigen comprises HLA-A*01, HLA- A*02, HLA-A*03, HLA-A*11, HLA-B*07 or HLA-C*07.
- Table 5 HLA scFv binding domains
- the ligand binding domain of the second, inhibitory receptor comprises an scFv.
- the scFv binds to HLA-A*01, HLA- A*02, HLA-A*03, HLA-A*11, HLA-B*07 or HLA-C*07, and comprises a sequence selected from the group of sequences set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the scFv binds to HLA-A*01, HLA-A*02, HLA-A*03, HLA- A*11, HLA-B*07 or HLA-C*07, and comprises a sequence selected from the group of sequences set forth in Table 5.
- the non-target antigen comprises HLA-A*01
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-A*01 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*02
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-A*02 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*03
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-A*03 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*11
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-A*11 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-B*07
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-B*07 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-C*07
- the non-target extracellular ligand binding domain of the second receptor comprises an HLA-C*07 scFv sequence set forth in Table 5, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- Exemplary heavy chain and light chain CDRs (CDR-H1, CDR-H2 and CDR-H3, or CDR-L1, CDR-L2 and CDR-L3, respectively) for HLA-A*01, HLA-A*02, HLA- A*03, HLA-A*11, HLA-B*07 and HLA-C*07 ligand binding domains are shown in Table 6 below.
- Table 6 CDRs corresponding to HLA antigen binding domains
- the non-target antigen comprises HLA-A.
- the ligand binding domain of the second, inhibitory receptor comprises an HLA-A*01, HLA-A*02, HLA-A*03 or HLA-A*11 ligand binding domain comprising CDR sequences as set forth in Table 6 or Table 7.
- the non-target antigen comprises HLA-B.
- the ligand binding domain of the second, inhibitory receptors comprises an HLA-B*07 ligand binding domain comprising CDR sequences as set forth in Table 6.
- the non-target antigen comprises HLA-C.
- the ligand binding domain of the second, inhibitory receptors comprises an HLA-C*07 ligand binding domain comprising CDR sequences as set forth in Table 6.
- the extracellular ligand binding domain of the second receptor specifically binds an allelic variant of an HLA-A, HLA-B, or HLA-C protein.
- the extracellular ligand binding domain of the second receptor specifically binds to HLA-A*01, HLA-A*02, HLA-A*03, HLA-A*11, HLA-B*07, or HLA-C*07.
- the extracellular ligand binding domain of the second receptor specifically binds to HLA-A*01.
- the extracellular ligand binding domain of the second receptor comprises HLA-A*01 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-A*01 CDRs of Table 6.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises HLA-A*02 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-A*02 CDRs of Table 6.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 of SEQ ID NOS: 103-108 or of SEQ ID NOS: 109-114; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of SEQ ID NOS: 103-108 or SEQ ID NOS: 109-114.
- the extracellular ligand binding domain of the second receptor specifically binds to HLA-A*03.
- the extracellular ligand binding domain of the second receptor comprises HLA-A*03 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-A*03 CDRs of Table 6.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises HLA-A*11 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR-H3 as disclosed Table 7; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-A*11 CDRs of Table 7.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises HLA-B*07 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-B*07 CDRs of Table 6.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises HLA-C*07 complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the HLA-C*07 CDRs of Table 6.
- each CDR sequence may have 1, 2, 3 or more substitutions, insertions, or deletions.
- CDR sequences may tolerate substitutions, deletions, or insertions.
- the non-target antigen comprising HLA-A*02, and the ligand binding domain of the second receptor comprises an HLA-A*02 ligand binding domain.
- the ligand binding domain binds HLA-A*02 independent of the peptide in a pMHC complex comprising HLA-A*02.
- the HLA-A*02 ligand binding domain comprises an scFv domain.
- the HLA-A*02 ligand binding domain comprises a sequence of any one of SEQ ID NOs: 30- 41. In some embodiments, the HLA-A*02 ligand binding domain comprises a sequence at least 90%, at least 95%, at least 97% or at least 99% identical to a sequence of any one of SEQ ID NOs: 30-41.
- the non-target antigen comprises HLA-A*02
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NO: 30, or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*02
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NO: 30.
- the non-target antigen comprises HLA-A*02
- the extracellular ligand binding domain of the second receptor comprises a VL comprising a sequence of DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKV SNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPRTSGGGTKLEIK (SEQ ID NO: 762), or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the extracellular ligand binding domain of the second receptor comprises a VH comprising a sequence of QVQLQQSGPELVKPGASVRISCKASGYTFTSYHIHWVKQRPGQGLEWIGWIYPGN VNTEYNEKFKGKATLTADKSSSTAYMHLSSLTSEDSAVYFCAREEITYAMDYWG QGTSVTVSS (SEQ ID NO: 763), or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the VH and VL are separated by a linker, for example GGGGSGGGGSGGGGSGG (SEQ ID NO: 152).
- the VH and VL are ordered, from N to C terminal, VH, linker and VL. In some embodiments, the VH and VL are ordered, from N to C terminal, VL, linker and VH.
- the HLA-A*02 scFv comprises the complementarity determined regions (CDRs) of any one of SEQ ID NOS: 42-53. In some embodiments, the scFv comprises a sequence at least 95% identical to any one of SEQ ID NOS: 42-53. In some embodiments, the scFv comprises a sequence identical to any one of SEQ ID NOS: 42-53.
- the heavy chain of the antigen binding domain comprises the heavy chain CDRs of any one of SEQ ID NOS: 42-53, and wherein the light chain of the antigen binding domain comprises the light chain CDRs of any one of SEQ ID NOS: 42-53.
- the HLA-A*02 antigen binding domain comprises a heavy chain and a light chain, and the heavy chain comprises CDRs selected from SEQ ID NOs: 45-47 and 51-53 and the light chain comprises CDRs selected from SEQ ID NOs: 42-44 and 48-50.
- the HLA-A*02 antigen binding domain comprises a heavy chain and a light chain
- the heavy chain comprises a sequence at least 95% identical to the heavy chain portion of any one of SEQ ID NOS: 30-41
- the light chain comprises a sequence at least 95% identical to the light chain portion of any one of SEQ ID NOS: 30-41.
- the heavy chain comprises a sequence identical to the heavy chain portion of any one of SEQ ID NOS: 30-41
- the light chain of comprises a sequence identical to the light chain portion of any one of SEQ ID NOS: 30- 41.
- the non-target antigen comprises HLA-A*01
- the extracellular ligand binding domain of the second receptor comprises an HLA-A*01 ligand binding domain.
- the HLA-A*01 ligand binding domain comprises an scFv domain comprising a sequence selected from the group of sequences set forth in Table 5, or a sequence at least 90%, at least 95% or at least 99% identical to thereto.
- the HLA-A*01 scFv comprises HLA-A*01 CDR sequences as set forth in Table 6.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises an HLA-A*03 ligand binding domain.
- the HLA-A*03 ligand binding domain comprises an scFv domain comprising a sequence selected from the group of sequences set forth in Table 5, or a sequence at least 90%, at least 95% or at least 99% identical to thereto.
- the HLA-A*03 scFv comprises HLA-A*03 CDR sequences as set forth in Table 6.
- the non-target antigen comprises HLA-A*03
- the ligand binding domain of the second receptor comprises an HLA-A*03 ligand binding domain.
- the ligand binding domain binds HLA-A*03 independent of the peptide in a pMHC complex comprising HLA-A*03.
- the HLA-A*03 ligand binding domain comprises an scFv domain.
- the HLA-A*03 ligand binding domain comprises a sequence of any one of SEQ ID NOs: 615- 628 or SEQ ID NO: 1259.
- the HLA-A*03 ligand binding domain comprises a sequence at least 90%, at least 95%, at least 97% or at least 99% identical to a sequence of any one of SEQ ID NOs: 615-628 or SEQ ID NO: 1259.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NOs: 615-628, or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NO: 615-628.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NOs: 1259, or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises a sequence of SEQ ID NO: 1259.
- the non-target antigen comprises HLA-A*03
- the extracellular ligand binding domain of the second receptor comprises a VL comprising a sequence of DIVMTQSHKFMSTSVGDRVSITCKASQDVSTTVAWYQQKPGQSPKLLIYSASYRY TGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSTPPTFGGGTKLEIK (SEQ ID NO: 1266), or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the extracellular ligand binding domain of the second receptor comprises a VH comprising a sequence of EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRL KSTNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTTLITPDYWG QGTTLTVSS (SEQ ID NO: 1267), or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the VH and VL are separated by a linker, for example GGGGSGGGGSGGGGSGG (SEQ ID NO: 152).
- the VH and VL are ordered, from N to C terminal, VH, linker and VL. In some embodiments, the VH and VL are ordered, from N to C terminal, VL, linker and VH. [0298] In some embodiments, the HLA-A*03 extracellular ligand binding domain comprises the complementarity determined regions (CDRs) of any one of SEQ ID NOS: 638-641, 645-648, 650-653, 657-664, 676-682, 693-706, or 1260-1265.
- CDRs complementarity determined regions
- the extracellular ligand binding domain comprises a sequence at least 95% identical to any one of SEQ ID NOS: 638-641, 645-648, 650-653, 657-664, 676-682, 693- 706, or 1260-1265. In some embodiments, the extracellular ligand binding domain comprises a sequence identical to any one of SEQ ID NOS: 638-641, 645-648, 650-653, 657-664, 676-682, 693-706, or 1260-1265.
- the heavy chain of the antigen binding domain comprises the heavy chain CDRs of any one of SEQ ID NOS: 638-641, 645-648, 650-653, 657-664, 676-682, 693-706, or 1260-1265
- the light chain of the antigen binding domain comprises the light chain CDRs of any one of SEQ ID NOS: 638-641, 645-648, 650-653, 657-664, 676-682, 693-706, or 1260-1265.
- the HLA-A*03 antigen binding domain comprises a heavy chain and a light chain
- the heavy chain comprises CDRs selected from SEQ ID NOs: 657-664, 676-682, 693-706, and 1263-1265
- the light chain comprises CDRs selected from SEQ ID NOs: 638-641, 645-648, 650-653, and 1260-1262.
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 of: (i) SEQ ID NOS: 638, 645, 650, 657, 676, and 693; (ii) SEQ ID NOS: 638, 645, 650, 658, 677, and 694; (iii) SEQ ID NOS: 638, 645, 650, 659, 678, and 695; (iv) SEQ ID NOS: 638, 645, 650, 660, 678, and 696; (v) SEQ ID NOS: 638, 645, 650, 661, 679, and 697; (vi) SEQ ID NOS: 639, 646, 651, 657, 676, and 698; (vii) SEQ ID NOS: 638, 645, 650, 657, 676,
- the HLA-A*03 antigen binding domain comprises a heavy chain and a light chain
- the heavy chain comprises a sequence at least 95% identical to the heavy chain portion of any one of SEQ ID NOS: 615-628 or 1259
- the light chain comprises a sequence at least 95% identical to the light chain portion of any one of SEQ ID NOS: 615-628 or 1259.
- the heavy chain comprises a sequence identical to the heavy chain portion of any one of SEQ ID NOS: 615-628 or 1259
- the light chain of comprises a sequence identical to the light chain portion of any one of SEQ ID NOS: 615- 629 or 1259.
- the non-target antigen comprises HLA-A*11
- the extracellular ligand binding domain of the second receptor comprises an HLA-A*11 ligand binding domain.
- the HLA-A*11 ligand binding domain comprises an scFv domain comprising a sequence selected from the group of sequences set forth in Table 5, or a sequence at least 90%, at least 95% or at least 99% identical to thereto.
- the HLA-A*11 scFv comprises HLA-A*11 CDR sequences as set forth in Table 7.
- the non-target antigen comprises HLA-B*07
- the extracellular ligand binding domain of the second receptor comprises an HLA-B*07 ligand binding domain.
- the HLA-B*07 ligand binding domain comprises an scFv domain comprising a sequence selected from the group of sequences set forth in Table 5, or a sequence at least 90%, at least 95% or at least 99% identical to thereto.
- the HLA-B*07 scFv comprises HLA-B*07 CDR sequences as set forth in Table 6.
- the non-target antigen comprises HLA-C*07
- the extracellular ligand binding domain of the second receptor comprises an HLA-C*07 ligand binding domain.
- the HLA-C*07 ligand binding domain comprises an scFv domain comprising a sequence selected from the group of sequences set forth in Table 5, or a sequence at least 90%, at least 95% or at least 99% identical to thereto.
- the HLA-C*07 scFv comprises HLA-C*07 CDR sequences as set forth in Table 6.
- the non-target antigen comprises HLA-A*11.
- scFvs include, for example and without limitation, the following mouse and humanized scFv antibodies that bind HLA- A*11 in a peptide-independent way shown in Table 5 supra.
- Exemplary heavy chain and light chain CDRs CDR-H1, CDR-H2 and CDR-H3, or CDR-L1, CDR-L2 and CDR-L3, respectively
- Table 7 Exemplary anti-HLA-A*11 CDR Sequences
- the non-target antigen comprising HLA-A*11, and the ligand binding domain of the second receptor comprises an HLA-A*11 ligand binding domain.
- the ligand binding domain binds HLA-A*11 independent of the peptide in a pMHC complex comprising HLA-A*11.
- the HLA-A*11 ligand binding domain comprises an scFv domain.
- the HLA-A*11 ligand binding domain comprises a sequence of any one of SEQ ID NOs: 114- 122.
- the HLA-A*11 ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to a sequence of any one of SEQ ID NOs: 114-122.
- the HLA-A*11 scFv comprises the complementarity determined regions (CDRs) of any one of SEQ ID NOS: 114-122.
- the scFv comprises a sequence at least 95% identical to any one of SEQ ID NOS: 114-122.
- the scFv comprises a sequence identical to any one of SEQ ID NOS: 114-122.
- the heavy chain of the antigen binding domain comprises the heavy chain CDRs of any one of SEQ ID NOS: 132-140, and wherein the light chain of the antigen binding domain comprises the light chain CDRs of SEQ ID NO: 141.
- the HLA-A*11 antigen binding domain comprises a heavy chain and a light chain, and the heavy chain comprises one, two, or three CDRs selected from SEQ ID NOs: 92-110 and the light chain comprises one, two or three CDRs selected from SEQ ID NOs: 111-113.
- Exemplary heavy and light chain sequences for HLA-A*11 antigen binding domains are provided in Table 8, below.
- the HLA-A*11 antigen binding domain comprises a heavy chain and a light chain
- the heavy chain comprises a sequence at least 95% identical to the heavy chain portion of any one of SEQ ID NOS: 132-140
- the light chain comprises a sequence at least 95% identical to the light chain portion of SEQ ID NO: 141.
- the heavy chain comprises a sequence identical to the heavy chain portion of any one of SEQ ID NOS: 114-122
- the light chain of comprises a sequence identical to the light chain portion of any one of SEQ ID NOS: 114- 122.
- inhibitor ligands that are differentially expressed between cancer cells and normal cells.
- Activation of the inhibitory receptor is mediated by the presence of the non-target antigen on the surface of a cell.
- a cell that expresses the non-target antigen will activate the inhibitory receptor based on the level of expression of the non-target antigen.
- the non-target antigen is expressed by both target and non-target cells.
- the non-target antigen is expressed by non-target cells at a higher level than the target cells.
- non-target antigen expressed by the non-target cells activate the inhibitory receptor, thereby preventing activation of the immune cell.
- the lower levels of non-target antigen expressed by the target are not sufficient to activate the inhibitory receptor, leading to activation of the immune cell.
- the non-target antigen is expressed by non-target cells but not by target cells. In the absence of expression of the non-target antigen, the target cells activate the target receptor, thereby activating the immune cells.
- Differential expression can be determined by any techniques known in the art used to measure expression. These include, inter alia, techniques for measuring mRNA and/or protein levels of a target gene in a cell.
- Methods of measuring protein levels in samples include immunohistochemistry, enzyme-linked immunosorbent assays (ELISA), and analytical methods such as liquid chromatography-mass spectrometry (LC-MS).
- Methods of measuring mRNA levels include real time quantitative reverse transcription PCR (qRT- PCR), as well as high throughput sequencing. Expression differences can be observed between, for example, a normal cell and a diseased cell, for example a cancer cell.
- Activation of the inhibitory receptor by a non-target antigen can occur according to various modalities known in the art. Activation of the inhibitory receptor by a non-target antigen can be determined by methods known in the art.
- the level of downstream intracellular signaling in a cell expressing the inhibitory receptor can be measured through the use of a reporter gene.
- whether or not expression of a non-target antigen inhibits activation of an immune cell via activation of the inhibitory receptor can occur according to the ratio of the non-target antigen to the inhibitor receptor.
- the expression levels of the non-target antigen and the inhibitory receptor, and the ratio thereof, can be determined by methods known in the art, including, inter alia, immunohistochemistry and fluorescence activated cell sorting (FACS). Analysis of the expression levels of the non-target antigen on target and non-target cells can be used to predict selective targeting of the immune cells expressing the inhibitory receptor.
- Low or no expression of the non-target antigen on a target or non-target cell can indicate, for example, that the inhibitory receptor will not be activated in an immune cell of the disclosure.
- inhibition of immune cell activation by a non-target antigen via activation of the inhibitory receptor can depend on the affinity of the non-target antigen for the inhibitory receptor. Methods of measuring affinity are known in the art, and include, inter alia, enzyme-linked immunosorbent assay or radioimmunoassay methods.
- inhibition of immune cell activation by a non-target antigen via activation of the inhibitory receptor can occur according to cross talk between the inhibitory receptor and the activator receptor, leading to down-regulation of the activity of the activator receptor.
- activation of the inhibitory receptor by the non-target antigen can lead to reduced expression of the activator receptor on the surface of the immune cell.
- the non-target antigen is expressed at a lower level in a target cell than a normal cell.
- the non-target antigen is expressed by healthy cells, i.e. cells that are not cancer cells.
- the non-target antigen expression level is at least about 10 times less, at least about 30 times less, at least about 50 times less, at least about 70 times less, at least about 90 times less, at least about 100 times less, at least about 110 times less, at least about 150 times less, at least about 200 times less, at least about 250 times less, at least about 300 times less, at least about 350 times less, at least about 400 times less, at least about 450 times less, at least about 500 times less, at least about 600 times less, at least about 700 times less, at least about 800 times less, at least about 900 times less or at least about 1000 times less in the target cell than in the non-target cell.
- the non-target antigen expression level is about 10 times less, about 30 times less, about 50 times less, about 70 times less, about 90 times less, about 100 times less, or about 110 times less than the plurality of healthy cells. In some embodiments, the non-target antigen expression level is at least about 5 times less in the plurality of cancer cells than in the plurality of healthy cells. In some embodiments, the non-target antigen expression level is at least about 5 times less in a target cell than a non-target cell. In some embodiments, the target cells are a plurality of cancer cells that have low or no expression of the non-target antigen.
- Any cell surface molecule expressed by the non-target cells that is not expressed by target cells (or expressed at a low level) may be a suitable non-target antigen for the second receptor extracellular ligand binding domain.
- a cell adhesion molecule, a cell-cell signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane protein, a receptor for a neurotransmitter or a voltage gated ion channel can be used as a non-target antigen.
- the non-target antigen is selected from the group consisting of leucine rich repeat neuronal 4 (LRRN4) and uroplakin B3 (UPKB3), or a peptide antigen of any of these in a complex with a major histocompatibility complex class I (MHC-I).
- LRRN4 leucine rich repeat neuronal 4
- UPKB3 uroplakin B3
- MHC-I major histocompatibility complex class I
- the non-target antigen is LRRN4 or a peptide antigen thereof in a complex with MHC-I.
- the non-target antigen is UPKB3 or a peptide antigen thereof in a complex with MHC-I.
- the target antigen is a peptide antigen of a cancer cell- specific antigen in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- Non-target MHC-I (pMHC) antigens comprising any of HLA-A, HLA-B or HLA- C are envisaged as within the scope of the disclosure.
- the non- target antigen comprises HLA-A.
- the non-target antigen comprises HLA-B.
- the non-target antigen comprises HLA-C.
- Non-target antigens comprise proteins that have low or no expression in cancer cells, for example lung cancer cells, but are expressed in normal tissues, such as normal lung tissue.
- the non-target antigen comprises LRRN4 or an antigen peptide thereof in a complex with MHC-I.
- a human LRRN4 is described in NCBI record number NP_689824.2, the contents of which are incorporated by reference herein in their entirety.
- LRRN4 comprises an amino acid sequence of: 1 MRQTLPLLLL TVLRPSWADP PQEKVPLFRV TQQGPWGSSG SNATDSPCEG LPAADATALT 61 LANRNLERLP GCLPRTLRSL DASHNLLRAL STSELGHLEQ LQVLTLRHNR IAALRWGPGG 121 PAGLHTLDLS YNQLAALPPC TGPALSSLRA LALAGNPLRA LQPRAFACFP ALQLLNLSCT 181 ALGRGAQGGI AEAAFAGEDG APLVTLEVLD LSGTFLERVE SGWIRDLPKL TSLYLRKMPR 241 LTTLEGDIFK MTPNLQQLDC QDSPALASVA THIFQDTPHL QVLLFQNCNL SSFPPWTLDS 301 SQVLSINLFG NPLTCSCDLS WLLTDAKRTV LSRAADTMCA PAAGSSGPFS ASLSLSQLPG 361 VCQSDQSTTL GASHPPCF
- LRRN4 comprises a sequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to SEQ ID NO: 75. In some embodiments, LRRN4 comprises a sequence identical to SEQ ID NO: 75.
- the non-target antigen comprises UPK3B or an antigen peptide thereof in a complex with MHC-I. All isoforms of UPK3B are envisaged as within the scope of the instant disclosure. A human UPK3B isoform a precursor is described in NCBI record number NP_085047.1, the contents of which are incorporated by reference herein in their entirety.
- UPK3B isoform a precursor comprises an amino acid sequence of: 1 MGLPWGQPHL GLQMLLLALN CLRPSLSLGE WGSWMDASSQ TQGAGGPAGV IGPWAPAPLR 61 LGEAAPGTPT PVSVAHLLSP VATELVPYTP QITAWDLEGK VTATTFSLEQ PRCVFDGLAS 121 ASDTVWLVVA FSNASRGFQN PETLADIPAS PQLLTDGHYM TLPLSPDQLP CGDPMAGSGG 181 APVLRVGHDH GCHQQPFCNA PLPGPGPYRE DPRIHRHLAR AAKWQHDRHY LHPLFSGRPP 241 TLGLLGSLYH ALLQPVVAGG GPGAAADRLL HGQALHDPPH PTQRGRHTAG GLQAWPGPPP 301 QPQPLAWPLC MGLGEMGRRE (SEQ ID NO: 76).
- UPK3B isoform b precursor comprises an amino acid sequence of: 1 MGLPWGQPHL GLQMLLLALN CLRPSLSLEL VPYTPQITAW DLEGKVTATT FSLEQPRCVF 61 DGLASASDTV WLVVAFSNAS RGFQNPETLA DIPASPQLLT DGHYMTLPLS PDQLPCGDPM 121 AGSGGAPVLR VGHDHGCHQQ PFCNAPLPGP GPYRVKFLLM DTRGSPRAET KWSDPITLHQ 181 GKTPGSIDTW PGRRSGSMIV ITSILSSLAG LLLLAFLAAS TMRFSSLWWP EEAPEQLRIG 241 SFMGKRYMTH HIPPSEAATL PVGCKPGLDP LPSLSP (SEQ ID NO:
- UPK3B isoform c precursor comprises an amino acid sequence of: 1 MGLPWGQPHL GLQMLLLALN CLRPSLSLEL VPYTPQITAW DLEGKVTATT FSLEQPRCVF 61 DGLASASDTV WLVVAFSNAS RGFQNPETLA DIPASPQLLT DGHYMTLPLS PDQLPCGDPM 121 AGSGGAPVLR VGHDHGCHQQ PFCNAPLPGP GPYREDPRIH RHLARAAKWQ HDRHYLHPLF 181 SGRPPTLGLL GSLYHALLQP VVAGGGPGAA ADRLLHGQAL HDPPHPTQRG RHTAGGLQAW 241 PGPPPQPQPL AWPLCMGLGE MGRRE (SEQ ID NO: 78).
- UPK3B isoform d precursor comprises an amino acid sequence of: 1 MGLPWGQPHL GLQMLLLALN CLRPSLSLEL VPYTPQITAW DLEGKVTATT FSLEQPRCVF 61 DGLASASDTV WLVVAFSNAS RGFQNPETLA DIPASPQLLT DGHYMTLPLS PDQLPCGDPM 121 AGSGGAPVLR VGHDHGCHQQ PFCNAPLPGP GPYRVKFLLM DTRGSPRAET KWSDPITLHQ 181 GKTPGSIDTW PGRRSGSMIV ITSILSSLAG LLLLAFLAAS TMRFSSLWWP EEAPEQLRIG 241 SFMGKRYMTH HIPPREAATL PVGCKPGLDP LPSLSP (SEQ ID NO: 1 MGLPWGQPHL GLQMLLLALN CLRPSLEL VPYTPQITAW DLEGKVTATT FSLEQPRCVF 61 DGLASASDTV WLVVAFSNAS
- UPKB3 comprises a sequence or subsequence that shares at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID NOs: 76-79. In some embodiments, UPKB3 comprises a sequence or subsequence identical to SEQ ID NOs: 76-79.
- Inhibitory Chimeric Antigen Receptors [0330] The disclosure provides a second receptor that is an inhibitory chimeric antigen receptor.
- the inhibitory receptor may comprise an extracellular ligand binding domain that binds to and recognizes the non-target antigen or a peptide derivative thereof in a MHC-I complex.
- inhibitory receptor refers to a ligand-binding domain that is fused to an intracellular signaling domain capable of transducing an inhibitory signal that inhibits or suppresses the immune activity of an immune cell.
- Inhibitory receptors have immune cell inhibitory potential, and are distinct and distinguishable from CARs, which are receptors with immune cell activating potential.
- CARs are activating receptors as they include intracellular stimulatory and/or co-stimulatory domains.
- Inhibitory receptors are inhibiting receptors that contain intracellular inhibitory domains.
- inhibitory signal refers to signal transduction or changes in protein expression in an immune cell resulting in suppression of an immune response (e.g., decrease in cytokine production or reduction of immune cell activation). Inhibition or suppression of an immune cell can selective and/or reversible, or not selective and/or reversible.
- Inhibitory receptors of the disclosure may comprise an extracellular ligand binding domain. Any type of ligand binding domain that can regulate the activity of a receptor in a ligand dependent manner is envisaged as within the scope of the instant disclosure. Inhibitory receptors are responsive to non-target antigens (e.g. HLA-A*02). For example, when a non-target antigen (e.g.
- Inhibitory receptors of the disclosure may comprise an extracellular ligand binding domain. Any type of ligand binding domain that can regulate the activity of a receptor in a ligand dependent manner is envisaged as within the scope of the instant disclosure. [0335] In some embodiments, the ligand binding domain is an antigen binding domain.
- antigen binding domains include, inter alia, scFv, SdAb, V ⁇ -only domains, and TCR antigen binding domains derived from the TCR ⁇ and ⁇ chain variable domains.
- scFv single-chain antigen binding domain
- SdAb single-chain antigen binding domain
- V ⁇ -only domains V ⁇ -only domains
- TCR antigen binding domains derived from the TCR ⁇ and ⁇ chain variable domains.
- the extracellular ligand binding domain of the second receptor is an scFv.
- the extracellular ligand binding domain of the second receptor binds to and recognizes a polymorphic variant of intercellular adhesion molecule 1 (ICAM1), catechol-O-methyltransferase (COMT), C-X-C motif chemokine ligand 16 (CXCL16), leucine rich repeat neuronal 4 (LRRN4) and uroplakin 3B UPK3B, or an antigen peptide thereof in a complex with a major histocompatibility complex class I (MHC-I), or HLA-A*02.
- the extracellular ligand binding domain of the second receptor is an scFv.
- the extracellular ligand binding domain of the second receptor is fused to the extracellular domain of an inhibitory receptor.
- the inhibitory receptors of the present disclosure comprise an extracellular hinge region. Exemplary hinges can be isolated or derived from IgD and CD8 domains, for example IgG1. In some embodiments, the hinge is isolated or derived from CD8 ⁇ or CD28. [0341] The inhibitory receptors of the present disclosure can be designed to comprise a transmembrane domain that is fused to the extracellular domain of the inhibitory receptor.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions may be isolated or derived from (i.e.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the intracellular domain of the inhibitory receptor.
- a glycine-serine doublet provides a particularly suitable linker.
- the disclosure provides an inhibitory receptor comprising an intracellular domain.
- the intracellular domain of the inhibitory receptors of the instant disclosure is responsible for inhibiting activation of the immune cells comprising the inhibitory receptor, which would otherwise be activated in response to activation signals by the first receptor.
- the inhibitory intracellular domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM).
- the inhibitory intracellular domain comprising an ITIM can be isolated or derived from an immune checkpoint inhibitor such as CTLA-4 and PD-1.
- CTLA-4 and PD-1 are immune inhibitory receptors expressed on the surface of T cells, and play a pivotal role in attenuating or terminating T cell responses.
- an inhibitory intracellular domain is isolated from human tumor necrosis factor related apoptosis inducing ligand (TRAIL) receptor and CD200 receptor 1.
- TRAIL receptor comprises TR10A, TR10B or TR10D.
- an inhibitory intracellular domain is isolated from phosphoprotein membrane anchor with glycosphingolipid microdomains 1 (PAG1).
- an inhibitory intracellular domain is isolated from leukocyte immunoglobulin like receptor B1 (LILRB1).
- LILRB1 leukocyte immunoglobulin like receptor B1
- the inhibitory domain is isolated or derived from a human protein, for example a human TRAIL receptor, CTLA-4, PD-1, PAG1 or LILRB1 protein.
- the inhibitory domain comprises an intracellular domain, a transmembrane or a combination thereof.
- the inhibitory domain comprises an intracellular domain, a transmembrane domain, a hinge region or a combination thereof.
- the inhibitory domain is isolated or derived from killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2 (KIR3DL2), killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 (KIR3DL3), leukocyte immunoglobulin like receptor B1 (LIR1, also called LIR-1 and LILRB1), programmed cell death 1 (PD-1), Fc gamma receptor IIB (FcgRIIB), killer cell lectin like receptor K1 (NKG2D), CTLA-4, a domain containing a synthetic consensus ITIM, a ZAP70 SH2 domain (e.g., one or both of the N and C terminal SH2 domains), or ZAP70 KI_K369A (kinase inactive ZAP70).
- KIR3DL2 three Ig domains and long cytoplasmic tail 2
- KIR3DL3DL3 three Ig domains and long cytoplasmic tail 3
- LIR1 leukocyte immunoglobul
- the inhibitory domain is isolated or derived from a human protein.
- the second, inhibitory receptor comprises an inhibitory domain.
- the second, inhibitory receptor comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain.
- the inhibitory intracellular domain is fused to an intracellular domain of an inhibitory receptor.
- the inhibitory intracellular domain is fused to the transmembrane domain of an inhibitory receptor.
- the second, inhibitory receptor comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain or a portion thereof isolated or derived isolated or derived from the same protein, for example an ITIM containing protein.
- the second, inhibitory receptor comprises a hinge region isolated or derived from isolated or derived from the same protein as the intracellular domain and/or transmembrane domain, for example an ITIM containing protein.
- the second receptor is a TCR comprising an inhibitory domain (an inhibitory TCR).
- the inhibitory TCR comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain.
- the inhibitory intracellular domain is fused to the intracellular domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma or CD3 epsilon or a portion thereof a TCR. In some embodiments, the inhibitory intracellular domain is fused to the transmembrane domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma or CD3 epsilon.
- the second receptor is a TCR comprising an inhibitory domain (an inhibitory TCR). In some embodiments, the inhibitory domain is isolated or derived from LILRB1.
- the disclosure provides a second, inhibitory receptor comprising a LILRB1 inhibitory domain, and optionally, a LILRB1 transmembrane and/or hinge domain, or functional variants thereof.
- the inclusion of the LILRB1 transmembrane domain and/or the LILRB1 hinge domain in the inhibitory receptor may increase the inhibitory signal generated by the inhibitory receptor compared to a reference inhibitory receptor having another transmembrane domain or another hinge domains.
- the second, inhibitory receptor comprising the LILRB1 inhibitory domain may be a CAR or TCR, as described herein. Any suitable ligand binding domain, as described herein, may be fused to the LILRB1- based second, inhibitory receptors.
- LILRB1 Leukocyte immunoglobulin-like receptor subfamily B member 1
- Leukocyte immunoglobulin-like receptor B1 also known as Leukocyte immunoglobulin-like receptor B1, as well as ILT2, LIR1, MIR7, PIRB, CD85J, ILT-2 LIR-1, MIR-7 and PIR-B
- LIR leukocyte immunoglobulin-like receptor
- the LILRB1 protein belongs to the subfamily B class of LIR receptors. These receptors contain two to four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs).
- ITIMs cytoplasmic immunoreceptor tyrosine-based inhibitory motifs
- the LILRB1 receptor is expressed on immune cells, where it binds to MHC class I molecules on antigen- presenting cells and transduces a negative signal that inhibits stimulation of an immune response. LILRB1 is thought to regulate inflammatory responses, as well as cytotoxicity, and to play a role in limiting auto-reactivity. Multiple transcript variants encoding different isoforms of LILRB1 exist, all of which are contemplated as within the scope of the instant disclosure. [0355] In some embodiments of the inhibitory receptors described herein, the inhibitory receptor comprises one or more domains isolated or derived from LILRB1.
- the one or more domains of LILRB1 comprise an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 54. In some embodiments, the one or more domains of LILRB1 comprise an amino acid sequence that is identical to a sequence or subsequence of SEQ ID NO: 54.
- the one or more domains of LILRB1 consist of an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 54. In some embodiments, the one or more domains of LILRB1 consist of an amino acid sequence that is identical to a sequence or subsequence of SEQ ID NO: 54.
- the one or more domains of LILRB1 are encoded by a polynucleotide sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 55.
- the one or more domains of LILRB1 are encoded by a polynucleotide sequence that is identical to a sequence or subsequence of SEQ ID NO: 55.
- an inhibitory receptor comprising a polypeptide, wherein the polypeptide comprises one or more of: an LILRB1 hinge domain or functional variant thereof; an LILRB1 transmembrane domain or a functional variant thereof; and an LILRB1 intracellular domain or an intracellular domain comprising at least one, or at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- ITIMs immunoreceptor tyrosine-based inhibitory motifs
- an “immunoreceptor tyrosine-based inhibitory motif” or “ITIM” refers to a conserved sequence of amino acids with a consensus sequence of S/I/V/LxYxxI/V/L (SEQ ID NO: 547), or the like, that is found in the cytoplasmic tails of many inhibitory receptors of the immune system. After ITIM-possessing inhibitory receptors interact with their ligand, the ITIM motif is phosphorylated, allowing the inhibitory receptor to recruit other enzymes, such as the phosphotyrosine phosphatases SHP-1 and SHP-2, or the inositol-phosphatase called SHIP.
- the polypeptide comprises an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibitory motif (ITIM), at least two ITIMs, at least 3 ITIMs, at least 4 ITIMs, at least 5 ITIMs or at least 6 ITIMs. In some embodiments, the intracellular domain has 1, 2, 3, 4, 5, or 6 ITIMs. [0361] In some embodiments, the polypeptide comprises an intracellular domain comprising at least one ITIM selected from the group of ITIMs consisting of NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- ITIM immunoreceptor tyrosine-based inhibitory motif
- the polypeptide comprises an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- ITIMs immunoreceptor tyrosine-based inhibitory motifs
- the intracellular domain comprises both ITIMs NLYAAV (SEQ ID NO: 56) and VTYAEV (SEQ ID NO: 57).
- the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 60.
- the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 60.
- the intracellular domain comprises both ITIMs VTYAEV (SEQ ID NO: 57) and VTYAQL (SEQ ID NO: 58).
- the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 61.
- the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 61.
- the intracellular domain comprises both ITIMs VTYAQL (SEQ ID NO: 58) and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 62. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 62. [0366] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), and VTYAQL (SEQ ID NO: 58). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 63. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 63.
- the intracellular domain comprises the ITIMs VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 64. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 64. [0368] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 65. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 65. [0369] In some embodiments, the intracellular domain comprises a sequence at least 95% identical to the LILRB1 intracellular domain (SEQ ID NO: 70). In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to the LILRB1 intracellular domain (SEQ ID NO: 70). [0370] LILRB1 intracellular domains or functional variants thereof of the disclosure can have at least 1, at least 2, at least 4, at least 4, at least 5, at least 6, at least 7, or at least 8 ITIMs.
- the LILRB1 intracellular domain or functional variant thereof has 2, 3, 4, 5, or 6 ITIMs.
- the intracellular domain comprises two, three, four, five, or six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises at least three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises four immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises five immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the intracellular domain comprises at least seven immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the LILRB1 protein has four immunoglobulin (Ig) like domains termed D1, D2, D3 and D4.
- the LILRB1 hinge domain comprises an LILRB1 D3D4 domain or a functional variant thereof.
- the LILRB1 D3D4 domain comprises a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or identical to SEQ ID NO: 66.
- the LILRB1 D3D4 domain comprises or consists essentially of SEQ ID NO: 66.
- the polypeptide comprises the LILRB1 hinge domain or functional variant thereof.
- the LILRB1 hinge domain or functional variant thereof comprises a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical or identical to SEQ ID NO: 73, SEQ ID NO: 66, or SEQ ID NO: 67. In embodiments, the LILRB1 hinge domain or functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 73, SEQ ID NO: 66, or SEQ ID NO: 67. [0380] In some embodiments, the LILRB1 hinge domain comprises a sequence identical to SEQ ID NO: 73, SEQ ID NO: 66, or SEQ ID NO: 67.
- the LILRB1 hinge domain consists essentially of a sequence identical to SEQ ID NO: 73, SEQ ID NO: 66, or SEQ ID NO: 67.
- the transmembrane domain is a LILRB1 transmembrane domain or a functional variant thereof.
- the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical or at least 99% to SEQ ID NO: 74.
- the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 74.
- the LILRB1 transmembrane domain comprises a sequence identical to SEQ ID NO: 74. In embodiments, the LILRB1 transmembrane domain consists essentially of a sequence identical to SEQ ID NO: 74.
- the transmembrane domain can be attached to the extracellular region of the second, inhibitory receptor, e.g., the antigen binding domain or ligand binding domain, via a hinge, e.g., a hinge from a human protein.
- the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, a CD8a hinge or an LILRB1 hinge.
- the second, inhibitory receptor comprises an inhibitory domain.
- the second, inhibitory receptor comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain.
- the inhibitory domain is isolated or derived from LILR1B.
- Inhibitory Receptors Comprising Combinations of LILRB1 Domains [0385]
- the LILRB1-based inhibitory receptors of the disclosure comprise more than one LILRB1 domain or functional equivalent thereof.
- the inhibitory receptor comprises an LILRB1 transmembrane domain and intracellular domain, or an LILRB1 hinge domain, transmembrane domain and intracellular domain.
- the inhibitory receptor comprises an LILRB1 hinge domain or functional variant thereof, and the LILRB1 transmembrane domain or a functional variant thereof.
- the polypeptide comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to SEQ ID NO: 68.
- the polypeptide comprises a sequence at least 95% identical to SEQ ID NO: 68.
- the polypeptide comprises a sequence identical to SEQ ID NO: 68.
- the inhibitory receptor comprises: the LILRB1 transmembrane domain or a functional variant thereof, and an LILRB1 intracellular domain and/or an intracellular domain comprising at least one immunoreceptor tyrosine- based inhibitory motif (ITIM), wherein the ITIM is selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- ITIM immunoreceptor tyrosine- based inhibitory motif
- the polypeptide comprises the LILRB1 transmembrane domain or a functional variant thereof, and an LILRB1 intracellular domain and/or an intracellular domain comprising at least two ITIM, wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 56), VTYAEV (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- the inhibitory receptor comprises a LILRB1 transmembrane domain and intracellular domain.
- the polypeptide comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to SEQ ID NO: 69. In some embodiments, the polypeptide comprises a sequence at least 95% identical to SEQ ID NO: 69. In some embodiments, the polypeptide comprises a sequence identical to SEQ ID NO: 69.
- the inhibitory receptor comprises: an LILRB1 hinge domain or functional variant thereof; an LILRB1 transmembrane domain or a functional variant thereof; and an LILRB1 intracellular domain and/or an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from LYAAV (SEQ ID NO: 56), VTYAE (SEQ ID NO: 57), VTYAQL (SEQ ID NO: 58), and SIYATL (SEQ ID NO: 59).
- ITIMs immunoreceptor tyrosine-based inhibitory motifs
- the inhibitory receptor comprises a sequence at least 95% identical to SEQ ID NO: 71 or SEQ ID NO: 72, or at least 99% identical to SEQ ID NO: 71 or SEQ ID NO: 72, or identical to SEQ ID NO: 71 or SEQ ID NO: 72.
- the polypeptide comprises a sequence at least 99% identical to SEQ ID NO: 68, or at least 99% identical to SEQ ID NO: 68, or identical to SEQ ID NO: 68.
- the polypeptide comprises a sequence at least 99% identical to SEQ ID NO: 69, or at least 99% identical to SEQ ID NO: 69, or identical to SEQ ID NO: 69.
- Table 9 Polypeptide sequences for illustrative LILRB1-based inhibitory receptors
- Exemplary inhibitory receptors of the disclosure comprise the scFv specific to any of HLA-A, HLA-B or HLA-C non-target antigens, the sequences of which are set forth in Table 5, fused to the N terminus a LILRB1 hinge, transmembrane and intracellular domain.
- the LILRB1 hinge comprises a sequence of SEQ ID NO: 73
- the LILRB1 transmembrane domain comprises a sequence of SEQ ID NO: 74
- the LILRB1 intracellular domain comprises a sequence of SEQ ID NO: 70.
- the second, inhibitory receptor comprises an scFv sequence of Table 5 fused to the N terminus of SEQ ID NO: 71.
- the non-target antigen comprises HLA-A*02
- the second inhibitory receptor comprises a sequence of: D F R V T S A or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*02 and the second inhibitory receptor comprises a sequence of SEQ ID NO: 348.
- the non-target antigen comprises HLA-A*03
- the second inhibitory receptor comprises a sequence of: sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*03 and the second inhibitory receptor comprises a sequence of SEQ ID NO: 1268.
- the corresponding nucleotide sequence comprises:
- the non-target antigen comprises HLA-A*11
- the second inhibitory receptor comprises a sequence of: or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-A*11 and the second inhibitory receptor comprises a sequence of SEQ ID NO: 1269.
- the corresponding nucleotide sequence comprises:
- the non-target antigen comprises HLA-B*07
- the second inhibitory receptor comprises a sequence of: or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the non-target antigen comprises HLA-B*07
- the second inhibitory receptor comprises a sequence of SEQ ID NO: 1270.
- the corresponding nucleotide sequence comprises: Polynucleotides and Vectors [0401]
- the disclosure provides polynucleotides encoding the sequence(s) of the first and second receptors of the disclosure.
- the disclosure provides immune cells comprising the polynucleotides and vectors described herein.
- the sequence of the first and/or second receptor is operably linked to a promoter. In some embodiments, the sequence encoding the first receptor is operably linked to a first promoter, and the sequence encoding the second receptor is operably linked to a second promoter. [0403]
- the disclosure provides vectors comprising the polynucleotides described herein. [0404] In some embodiments, the first receptor is encoded by a first vector and the second receptor is encoded by a second vector. In some embodiments, both receptors are encoded by a single vector. In some embodiments, the first and/or second vector comprises an shRNA, for example a B2M shRNA.
- both receptors are encoded by a single vector.
- the vector comprises an shRNA, for example a B2M shRNA.
- the first and second receptors are encoded by a single vector.
- Exemplary self-cleaving peptides include T2A, P2A, E2A and F2A self-cleaving peptides.
- the T2A self-cleaving peptide comprises a sequence of EGRGSLLTCGDVEENPGP (SEQ ID NO: 764).
- the P2A self-cleaving peptide comprises a sequence of ATNFSLLKQAGDVEENPGP (SEQ ID NO: 765).
- the E2A self- cleaving peptide comprises a sequence of QCTNYALLKLAGDVESNPGP (SEQ ID NO: 766).
- the F2A self-cleaving peptide comprises a sequence of VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 767). In some embodiments, the T2A self-cleaving peptide comprises a sequence of EGRGSLLTCGDVEENPGP (SEQ ID NO: 764). Any of the foregoing can also include an N terminal GSG linker.
- a T2A self-cleaving peptide can also comprise a sequence of GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 351), which can be encoded by a sequence of GGATCCGGAGAGGGCAGAGGCAGCCTGCTGACATGTGGCGACGTGGAAGAGA ACCCTGGCCCC (SEQ ID NO: 768).
- the vector is an expression vector, i.e. for the expression of the first and/or second receptor in a suitable cell.
- Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells.
- Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.
- the expression of natural or synthetic nucleic acids encoding receptors is typically achieved by operably linking a nucleic acid encoding the receptor or portions thereof to a promoter, and incorporating the construct into an expression vector.
- the vectors can be suitable for replication and integration eukaryotes.
- Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
- the polynucleotides encoding the receptors can be cloned into a number of types of vectors.
- the polynucleotides can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid.
- Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
- the expression vector may be provided to cells, such as immune cells, in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al.
- Viruses which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses.
- a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No.6,326,193).
- selectable markers e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No.6,326,193
- retroviruses provide a convenient platform for gene delivery systems.
- a selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art.
- the recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.
- retroviral systems are known in the art.
- adenovirus vectors are used.
- a number of adenovirus vectors are known in the art.
- lentivirus vectors are used.
- Additional promoter elements e.g., enhancers, regulate the frequency of transcriptional initiation.
- promoters typically contain functional elements downstream of the start site as well.
- the spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.
- tk thymidine kinase
- the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline.
- individual elements can function either cooperatively or independently to activate transcription.
- CMV immediate early cytomegalovirus
- This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto.
- EF-1 ⁇ Elongation Growth Factor-1 ⁇
- other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, a U6 promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter.
- SV40 simian virus 40
- MMTV mouse mammary tumor virus
- HSV human immunodeficiency virus
- LTR long
- inducible promoters are also contemplated as part of the disclosure.
- the use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired.
- inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
- the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors.
- the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
- Reporter genes are used for identifying potentially transfected or transduced cells and for evaluating the functionality of regulatory sequences.
- a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells.
- Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82).
- Suitable expression systems are well known and may be prepared using known techniques or obtained commercially.
- the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter.
- Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
- Methods of introducing and expressing genes into a cell are known in the art.
- the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
- the expression vector can be transferred into a host cell by physical, chemical, or biological means.
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). One method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.
- Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
- Viral vectors and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos.5,350,674 and 5,585,362.
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
- a variety of assays may be performed.
- Such assays include, for example, “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; “biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
- Immune Cells [0422] The disclosure provides immune cells comprising the receptors, vectors and polynucleotides described herein.
- the immune cells comprise: (a) first receptor, comprising a first extracellular ligand binding domain specific to a target antigen selected from: (i) a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or (ii) MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and (b) a second receptor, comprising a second extracellular ligand binding specific to a non-target antigen selected from intercellular adhesion molecule 1 (ICAM1), catechol-O-methyltransferase (COMT), C-X-C motif chemokine ligand 16 (CXCL16), leucine rich repeat neuronal 4 (LRRN4) and uroplakin 3B UPK3B, or an antigen peptide thereof in a complex with a major histocompatibility complex class I (ICAM1), catechol-O
- the first receptor is a CAR or TCR.
- the second receptor is an inhibitory receptor, such as an inhibitory chimeric antigen receptor or TCR.
- the disclosure provides immune cells comprising a first receptor comprising a sequence of SEQ ID NO: 303, and second receptor comprising a sequence of SEQ ID NO: 348, or sequences having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cells comprise an shRNA encoded by a sequence comprising SEQ ID NO: 349 or 350, or a sequence having at least 80%, at least 90%, or at least 95% identity thereto.
- the immune cells comprise first receptor comprising a sequence of SEQ ID NO: 303, a second receptor comprising a sequence of SEQ ID NO: 348, and a sequence encoding an shRNA comprising a sequence of SEQ ID NO: 349 or 350.
- the first receptor and second receptor are encoded by a single polynucleotide, and wherein the sequences encoding the first and second receptors are separated by a sequence encoding a self-cleaving polypeptide.
- the self-cleaving polypeptide comprises a T2A self-cleaving polypeptide comprising a sequence of GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 351).
- the disclosure also provides immune cells comprising a first receptor comprising a sequence of SEQ ID NO: 303, and second receptor comprising a sequence of SEQ ID NO: 1268, or sequences having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cells comprise an shRNA encoded by a sequence comprising SEQ ID NO: 349 or 350, or a sequence having at least 80%, at least 90%, or at least 95% identity thereto.
- the immune cells comprise first receptor comprising a sequence of SEQ ID NO: 303, a second receptor comprising a sequence of SEQ ID NO: 1268, and a sequence encoding an shRNA comprising a sequence of SEQ ID NO: 349 or 350.
- the first receptor and second receptor are encoded by a single polynucleotide, and wherein the sequences encoding the first and second receptors are separated by a sequence encoding a self-cleaving polypeptide.
- the self-cleaving polypeptide comprises a T2A self- cleaving polypeptide comprising a sequence of GSGEGRGSLLTCGDVEENPGP (SEQ ID NO: 351).
- immune cell refers to a cell involved in the innate or adaptive (acquired) immune systems.
- exemplary innate immune cells include phagocytic cells such as neutrophils, monocytes and macrophages, Natural Killer (NK) cells, polymophonuclear leukocytes such as neutrophils eosinophils and basophils and mononuclear cells such as monocytes, macrophages and mast cells.
- innate immune cells include phagocytic cells such as neutrophils, monocytes and macrophages, Natural Killer (NK) cells, polymophonuclear leukocytes such as neutrophils eosinophils and basophils and mononuclear cells such as monocytes, macrophages and mast cells.
- NK Natural Killer
- Immune cells with roles in acquired immunity include lymphocytes such as T-cells and B-cells.
- T-cell refers to a type of lymphocyte that originates from a bone marrow precursor that develops in the thymus gland.
- T-cells which develop upon migration to the thymus, which include, helper CD4+ T- cells, cytotoxic CD8+ T cells, memory T cells, regulatory CD4+ T-cells and stem memory T-cells.
- helper CD4+ T- cells include, helper CD4+ T- cells, cytotoxic CD8+ T cells, memory T cells, regulatory CD4+ T-cells and stem memory T-cells.
- T-cells can be distinguished by the ordinarily skilled artisan based on their expression of markers. Methods of distinguishing between T-cell types will be readily apparent to the ordinarily skilled artisan.
- the first receptor and the second receptor together specifically activate the immune cell in the presence of the target cell.
- the immune cell is CD4+, CD8+, a gamma delta T cell, an invariant T cells, an iNK cell , a NK cell, a macrophages, or combinations thereof.
- the immune cell is a gamma delta ( ⁇ ) T cell.
- the immune cell is an invariant T cell.
- the immune cell is an invariant natural killer T cell (iNKT cell).
- the immune cell is a T cell.
- the immune cell is a B cell.
- the immune cell is a Natural Killer (NK) cell.
- the immune cell is CD8-.
- the immune cell is CD8+. In some embodiments, the immune cell is CD4+. In some embodiments, the immune cell is CD4-. In some embodiments, the immune cell is CD8-/CD4+. In some embodiments, the immune cell is a CD8+ CD4- T cell. [0430] In some embodiments, the immune cell is non-natural. In some embodiments, the immune cell is isolated. [0431] Methods transforming populations of immune cells, such as T cells, with the vectors of the instant disclosure will be readily apparent to the person of ordinary skill in the art. For example, CD3+ T cells can be isolated from PBMCs using a CD3+ T cell negative isolation kit (Miltenyi), according to manufacturer’s instructions.
- CD3+ T cells can be isolated from PBMCs using a CD3+ T cell negative isolation kit (Miltenyi), according to manufacturer’s instructions.
- T cells can be cultured at a density of 1 x 10 ⁇ 6 cells/mL in X-Vivo 15 media supplemented with 5% human A/B serum and 1% Pen/strep in the presence of CD3/28 Dynabeads (1:1 cell to bead ratio) and 300 Units/mL of IL-2 (Miltenyi).
- T cells can be transduced with viral vectors, such as lentiviral vectors using methods known in the art.
- the viral vector is transduced at a multiplicity of infection (MOI) of 5.
- Cells can then be cultured in IL-2 or other cytokines such as combinations of IL-7/15/21 for an additional 5 days prior to enrichment.
- the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos.6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041, 10040846; and U.S. Pat. Appl. Pub. No.2006/0121005.
- T cells of the instant disclosure are expanded and activated in vitro.
- the T cells of the instant disclosure are expanded in vitro by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
- T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody.
- a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
- a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- an anti-CD3 antibody and an anti-CD28 antibody can be used.
- an anti-CD28 antibody include 9.3, B- T3, XR-CD28 (Diaclone, Besançon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth.227(1-2):53-63, 1999).
- the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
- the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in “cis” formation) or to separate surfaces (i.e., in “trans” formation). Alternatively, one agent may be coupled to a surface and the other agent in solution.
- the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
- the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.”
- the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
- a 1:1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used.
- the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between.
- more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one.
- the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
- Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells. As those of ordinary skill in the art can readily appreciate, the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
- the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
- a ratio of 1:1 cells to beads is used.
- the cells such as T cells
- the beads and the cells are subsequently separated, and then the cells are cultured.
- the agent-coated beads and cells are not separated but are cultured together.
- the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
- a force such as a magnetic force
- cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached to contact the T cells.
- the cells for example, CD4+ T cells
- beads for example, DYNABEADS CD3/CD28 T paramagnetic beads at a ratio of 1:1
- any cell concentration may be used.
- a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. In some embodiments, cells that are cultured at a density of 1x10 6 cells/mL are used.
- the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between.
- the beads and T cells are cultured together for 2-3 days.
- Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
- serum e.g., fetal bovine or human serum
- IL-2 interleukin-2
- insulin IFN- ⁇
- IL-4 interleukin-7
- GM-CSF GM-CSF
- IL-10 interleukin-12
- IL-15 IL
- additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N- acetyl-cysteine and 2-mercaptoethanol.
- Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
- the media comprises X-VIVO-15 media supplemented with 5% human A/B serum, 1% penicillin/streptomycin (pen/strep) and 300 Units/ml of IL-2 (Miltenyi).
- the T cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO2).
- the T cells comprising TCRs, CARs and inhibitory receptors of the disclosure are autologous. Prior to expansion and genetic modification, a source of T cells is obtained from a subject.
- Immune cells such as T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present disclosure, any number of T cell lines available in the art, may be used. In certain embodiments of the present disclosure, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation. [0443] In some embodiments, cells from the circulating blood of an individual are obtained by apheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations.
- a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
- a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
- the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca2+-free, Mg2+- free PBS, PlasmaLyte A, or other saline solution with or without buffer.
- the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
- immune cells such as T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
- Specific subpopulations of immune cells, such as T cells, B cells, or CD4+ T cells can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti-CD4 -conjugated beads, for a time period sufficient for positive selection of the desired T cells.
- Enrichment of an immune cell population, such as a T cell population, by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- One method is cell sorting and/or selection via negative magnetic immune-adherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
- a monoclonal antibody cocktail typically includes antibodies to CD 14, CD20, CD 11b, CD 16, HLA- DR, and CD8.
- the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C or at room temperature.
- T cells for stimulation, or PBMCs from which immune cells such as T cells are isolated can also be frozen after a washing step.
- the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells may be suspended in a freezing solution.
- one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to ⁇ 80° C at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank.
- the disclosure provides an immune cell expressing the activator and/or blocker receptors described herein, wherein the immune cell has reduced expression and/or function the major histocompatibility (MHC) class I complex.
- the immune cell is autologous.
- the immune cells is isolated or derived from same subject who will receive the cell as part of a therapeutic regimen. It can be advantageous to modify autologous immune cells to have reduced expression and/or function of MHC class I with the blocker receptor is specific to an MHC class I antigen.
- the immune cell is all allogeneic. Allogeneic immune cells can be derived from a donor other than the subject to which the immune cells will be administered. Allogeneic immune cells have been commonly referred to in cell therapy as “off-the-shelf” or “universal” because of the possibility for allogeneic cells to be prepared and stored for use in subjects of a variety of genotypes.
- MHC major histocompatibility complex
- HLA-A HLA-A
- HLA-B HLA-B
- HLA-C HLA-C
- MHC class I alleles are highly polymorphic and expressed in all nucleated cells.
- MHC class I polypeptides encoded by HLA-A, HLA-B, and HLA-C and alleles thereof form heterodimers with ⁇ 2 microglobulin (B2M) and present in complex with antigens on the surface of cells.
- an MHC class I gene or polypeptide may refer to any polypeptide found in the MHC or the corresponding gene encoding said polypeptide.
- the immune cells of the disclosure are inactivated by an inhibitor ligand comprising an MHC class I polypeptide, e.g. HLA-A, HLA-B, and HLA-C and alleles thereof.
- HLA-A alleles can be, for example and without limitation, HLA-A*02, HLA-A*02:01, HLA-A*02:01:01, HLA-A*02:01:01, and/or any gene that encodes protein identical or similar to HLA-A*02 protein.
- HLA-A*02 HLA-A*02:01
- HLA-A*02:01:01 HLA-A*02:01:01
- HLA-A*02:01:01 HLA-A*02:01:01
- HLA-A*02:01:01 HLA-A*02:01:01
- HLA-A*02:01:01:01 HLA-A*02:01:01
- any gene that encodes protein identical or similar to HLA-A*02 protein HLA-A*02 protein.
- it is desirable to eliminate or reduce expression of polypeptides encoded by HLA-A, HLA-B, and HLA-C and alleles thereof in the immune cells.
- the immune cells described herein are modified to inactivate, or reduce or eliminate expression or function of an endogenous gene encoding an allele of an endogenous MHC class I polypeptide.
- the gene encoding the MHC class I polypeptide is HLA-A, HLA-B, and/or HLA-C.
- HLA-A, HLA- B and HLA-C are encoded by the HLA-A, HLA-B and HLA-C loci.
- Each of HLA-A, HLA-B and HLA-C includes many variant alleles, all of which are envisaged as within the scope of the instant disclosure.
- the gene encoding the MHC class I polypeptide is HLA-A. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01:01. [0455] In some embodiments, the genetically engineered immune cells described herein are modified to reduce or eliminate expression of the B2M gene product.
- the beta-2 microglobulin (B2M) gene encodes a protein that associates with the major histocompatibility complex (MHC) class I, i.e. MHC-I complex.
- MHC-I complex is required for presentation of antigens on the cell surface.
- the MHC -I complex is disrupted and non-functional when the B2M is deleted (Wang D et al. Stem Cells Transl Med. 4:1234 ⁇ 1245 (2015)).
- the B2M gene can be disrupted with high efficiency using gene editing techniques known in the art (Ren et al. Clin. Cancer Res.23:2255-2266 (2017)). Reducing or eliminating B2M can reduce, or eliminate functional MHC I on the surface of the immune cell.
- the disclosure provides gene editing systems for editing an endogenous target gene in an immune cell.
- the disclosure provides interfering RNAs specific to sequences of target genes.
- Gene editing systems such as CRISPR/Cas systems, TALENs and zinc fingers can be used to generate double strand breaks, which, through gene repair mechanisms such as homology directed repair or non-homologous end joining (NHEJ), can be used to introduce mutations. NHEJ after resection of the ends of the break, or improper end joining, can be used to introduce deletions.
- the target gene comprises a gene encoding a subunit of the MHC-I complex.
- Target gene sequences include, but are not limited to, promoters, enhancers, introns, exons, intron/exon junctions, transcription products (pre-mRNA, mRNA, and splice variants), and/or 3’ and 5’ untranslated regions (UTRs). Any gene element or combination of gene elements may be targeted for the purpose of genetic editing in the immune cells described herein. Modifications to the target genes can be accomplished using any method known in the art to edit the target gene that results in altered or disrupted expression or function the target gene or gene product. [0458] In some embodiments, modifying the gene encoding the MHC class I polypeptide comprises deleting all or a portion of the gene.
- modifying the gene encoding the MHC class I polypeptide comprises introducing a mutation in the gene.
- the mutation comprises a deletion, insertion, substitution, or frameshift mutation.
- modifying the gene comprises using a nucleic acid guided endonuclease.
- HLA-A gene has NCBI Gene ID: 3105
- HLA-B gene has NCBI Gene ID: 3106
- HLA-C gene has NCBI Gene ID: 3107
- B2M gene has NCBI Gene ID: 567 and NCBI Reference Sequence: NC_000015.10.
- Gene sequences may also be found by searching public databases using keywords.
- HLA-A alleles may be found in the NCBI nucleotide database by searching keywords, “HLA-A*02”, “HLA-A*02:01”, “HLA-A*02:01:01”, or “HLA-A*02:01:01:01.”
- Table 10 provides non-limiting illustrative sequences of HLA-A allele and B2M gene sequences targeted for modification as described herein. Table 10.
- Exemplary Target Gene Sequences The person of ordinary skill in the art will appreciate that T can be substituted for U to convert an RNA sequence to a DNA sequence and vice versa, and both are envisaged as target gene sequences of the disclosure.
- a target gene is edited in the immune cells described herein using a nucleic acid guided endonuclease.
- Exemplary nucleic acid guided endonucleases include Class II endonucleases, such as CRISPR/Cas9.
- CRISPR or “CRISPR gene editing” as used herein refers to a set of clustered regularly interspaced short palindromic repeats, or a system comprising such a set of repeats.
- Cas refers to a CRISPR-associated protein.
- a “CRISPR/Cas” system refers to a system derived from CRISPR and Cas which can be used to silence, knock out, or mutate a target gene. This system is a type of prokaryotic immune system that confers resistance to foreign genetic elements such as plasmids and phages and provides a form of acquired immunity. The CRISPR/Cas system has been modified for use in gene editing.
- gNAs guide nucleic acids
- gRNAs typically guide RNAs
- Cas endonuclease which forms a ribonucleoprotein complex with the gNA.
- the gNA guides the gNA-endonuclease protein complex to a target genomic location, and the endonuclease introduces strand breakage at the target genomic location. This strand breakage can be repaired by cellular mechanisms such non-homologous end joining (leading to deletions) or homologous repair (which can generate insertions), thereby introducing genetic modifications into the host cell genome.
- CRISPR/Cas systems are classified by class and by type.
- Class 2 systems currently represent a single interference protein that is categorized into three distinct types (types II, V and VI). Any class 2 CRISPR/Cas system suitable for gene editing, for example a type II, a type V or a type VI system, is envisaged as within the scope of the instant disclosure.
- Exemplary Class 2 type II CRISPR systems include Cas9, Csn2 and Cas4.
- Exemplary Class 2, type V CRISPR systems include, Cas12, Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), Cas12d (CasY), Cas12e (CasX), Cas12f, Cas12g, Cas12h, Cas12i and Cas12k (C2c5).
- Exemplary Class 2 Type VI systems include Cas13, Cas13a (C2c2) Cas13b, Cas13c and Cas13d.
- the CRISPR sequence sometimes called a CRISPR locus, comprises alternating repeats and spacers.
- the spacers usually comprise sequences foreign to the bacterium such as a plasmid or phage sequence.
- spacer sequences may also be referred to as “targeting sequences.”
- the spacers are derived from the target gene sequence (the gNA).
- An exemplary Class 2 type II CRISPR system relies on the protein Cas9, which is a nuclease with two active cutting sites, one for each strand of the double helix. Combining Cas9 and modified CRISPR locus RNA can be used in a system for gene editing. Pennisi (2013) Science 341: 833-836.
- the Cas protein used to modify the immune cells is Cas9.
- the CRISPR/Cas system can thus be used to edit a target gene, such as a gene targeted for editing in the immune cells described herein, by adding or deleting a base pair, or introducing a premature stop which thus decreases expression of the target.
- the CRISPR/Cas system can alternatively be used like RNA interference, turning off a target gene in a reversible fashion.
- the RNA can guide the Cas protein to a target gene promoter, sterically blocking RNA polymerases.
- a Cas protein may be derived from any bacterial or archaeal Cas protein. Any suitable CRISPR/Cas system is envisaged as within the scope of the instant disclosure.
- Cas protein comprises one or more of Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, Cas12a (Cpf1), Cas13, Csy1, Csy2, Csy3, Cse1, Cse2, Csc1, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx15, Csf1, Csf2, Csf3, Csf4, CasX, CasY, homologs thereof, or modified versions thereof.
- the Cas protein is a Cas9 protein, a Cpf1 protein, a C2c1 protein, a C2c2 protein, a C2c3 protein, Cas3, Cas3-HD, Cas 5, Cas7, Cas8, Cas10, or combinations or complexes of these.
- the Cas protein is a Cas9 protein.
- Artificial CRISPR/Cas systems can be generated which inhibit a target gene, using technology known in the art, e.g., that described in U.S. Publication No.20140068797, and Cong (2013) Science 339: 819-823.
- CRISPR/Cas systems that are known in the art may also be generated which inhibit a target gene, e.g., that described in Tsai (2014) Nature Biotechnol., 32:6569-576, U.S. Pat. Nos. 8,871,445; 8,865,406; 8,795,965; 8,771,945; and 8,697,359.
- Methods of designing suitable gNAs for a particular Cas protein will be known by persons of ordinary skill in the art.
- the present disclosure provides gene-targeting guide nucleic acids (gNAs) that can direct the activities of an associated polypeptide (e.g., nucleic acid guided endonuclease) to a specific target gene sequence within a target nucleic acid genome.
- the genome- targeting nucleic acid can be an RNA.
- a genome-targeting RNA is referred to as a “guide RNA” or “gRNA” herein.
- a guide RNA can comprise at least a targeting sequence that hybridizes to a target nucleic acid sequence of interest, and a CRISPR repeat sequence.
- the gRNA also comprises a second RNA called the tracrRNA sequence, also referred to herein as a “scaffold” sequence.
- the CRISPR repeat sequence and scaffold sequence hybridize to each other to form a duplex.
- the crRNA forms a duplex.
- the duplex can bind a site-directed polypeptide, such that the guide RNA and site-directed polypeptide form a complex.
- the gene-targeting nucleic acid can provide target specificity to the complex by virtue of its association with the site-directed polypeptide. The gene-targeting nucleic acid thus can direct the activity of the site-directed polypeptide.
- the disclosure provides a guide RNA comprising a targeting sequence and a guide RNA scaffold sequence, wherein the targeting sequence is complementary to the sequence of a target gene.
- Exemplary guide RNAs include targeting sequences of about 15-20 bases.
- each gRNA can be designed to include a targeting sequence complementary to its genomic target sequence.
- each of the targeting sequences e.g., the RNA version of the DNA sequences presented in Tables 11 and 14, minus the three 3’ nucleotides which represent that PAM site, can be put into a single RNA chimera or a crRNA.
- the gene targeting nucleic acid can be a double-molecule guide RNA.
- the gene targeting nucleic acid can be a single-molecule guide RNA.
- the gene targeting nucleic acid can be any known configuration of guide RNA known in the art, such as, for example, including paired gRNA, or multiple gRNAs used in a single step. Although it is clear from genomic sequences where the coding sequences and splice junctions are, other features required for gene expression may be idiosyncratic and unclear.
- a double-molecule guide RNA can comprise two strands of RNA. The first strand comprises a sequence in the 5′ to 3′ direction, an optional spacer extension sequence, a targeting sequence and a minimum CRISPR repeat sequence.
- the second strand can comprise a minimum tracrRNA sequence (complementary to the minimum CRISPR repeat sequence), a 3′ tracrRNA sequence and an optional tracrRNA extension sequence.
- a single-molecule guide RNA (sgRNA) in a Type II system can comprise, in the 5′ to 3′ direction, an optional spacer extension sequence, a targeting sequence, a minimum CRISPR repeat sequence, a single-molecule guide linker, a minimum tracrRNA sequence, a 3′ tracrRNA sequence and an optional tracrRNA extension sequence.
- the optional tracrRNA extension can comprise elements that contribute additional functionality (e.g., stability) to the guide RNA.
- the single-molecule guide linker can link the minimum CRISPR repeat and the minimum tracrRNA sequence to form a hairpin structure.
- the optional tracrRNA extension can comprise one or more hairpins.
- guide RNA or single-molecule guide RNA can comprise a targeting sequence and a scaffold sequence.
- the scaffold sequence is a Cas9 gRNA sequence.
- the scaffold sequence is encoded by a DNA sequence that comprises a sequence that shares at least 90%, at least 95%, at least 96%, at least 97%, at least98%, or at least 99% identity to GTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACT TGAAAAAGTGGCACCGAGTCGGTGCTTTTTTTTT (SEQ ID NO: 773).
- the scaffold sequence is encoded by a DNA sequence that comprises GTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTG AAAAAGTGGCACCGAGTCGGTGCTTTTTTTTTTT (SEQ ID NO: 773).
- the sgRNA can comprise a 20 nucleotide targeting sequence at the 5′ end of the sgRNA sequence.
- the sgRNA can comprise a less than a 20 nucleotide targeting sequence at the 5′ end of the sgRNA sequence.
- the sgRNA can comprise a more than 20 nucleotide targeting sequence at the 5′ end of the sgRNA sequence.
- the sgRNA can comprise a variable length targeting sequence with 17-30 nucleotides at the 5′ end of the sgRNA sequence.
- a single-molecule guide RNA (sgRNA) in a Type II system e.g. Cas9
- Cas9 can comprise, in the 5′ to 3′ direction, a minimum CRISPR repeat sequence and a targeting sequence.
- guide RNAs used in the CRISPR/Cas9 or CRISPR/Cpf1 system, or other smaller RNAs can be readily synthesized by chemical means, as illustrated below and described in the art.
- RNAs While chemical synthetic procedures are continually expanding, purifications of such RNAs by procedures such as high performance liquid chromatography (HPLC, which avoids the use of gels such as PAGE) tends to become more challenging as polynucleotide lengths increase significantly beyond a hundred or so nucleotides.
- HPLC high performance liquid chromatography
- One approach used for generating RNAs of greater length is to produce two or more molecules that are ligated together. Much longer RNAs, such as those encoding a Cas9 or Cpf1 endonuclease, are more readily generated enzymatically.
- RNA modifications can be introduced during or after chemical synthesis and/or enzymatic generation of RNAs, e.g., modifications that enhance stability, reduce the likelihood or degree of innate immune response, and/or enhance other attributes, as described in the art.
- the targeting sequence of a gRNA hybridizes to a sequence in a target nucleic acid of interest.
- the targeting sequence of a genome-targeting nucleic acid can interact with a target nucleic acid in a sequence-specific manner via hybridization (i.e., base pairing).
- the nucleotide sequence of the targeting sequence can vary depending on the sequence of the target nucleic acid of interest.
- the targeting sequence can be designed to hybridize to a target nucleic acid that is located 5′ of the reverse complement of a PAM of the Cas9 enzyme used in the system.
- the targeting sequence may perfectly match the target sequence or may have mismatches.
- Each CRISPR/Cas system protein may have a particular PAM sequence, in a particular orientation and position, that it recognizes in a target DNA.
- S. pyogenes Cas9 recognizes in a target nucleic acid a PAM that comprises the sequence 5′-NRG-3′, where R comprises either A or G, where N is any nucleotide and N is immediately 3′ of the target nucleic acid sequence targeted by the targeting sequence.
- the target sequence is complementary to, and hybridizes with, the targeting sequence of the gRNA.
- the target nucleic acid sequence can comprise 20 nucleotides.
- the target nucleic acid can comprise less than 20 nucleotides.
- the target nucleic acid can comprise more than 20 nucleotides.
- the target nucleic acid can comprise at least: 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30 or more nucleotides.
- the target nucleic acid sequence can comprise 20 nucleotides immediately 5′ of the first nucleotide of the reverse complement of the PAM sequence.
- This target nucleic acid sequence is often referred to as the PAM strand or a target strand, and the complementary nucleic acid sequence is often referred to the non-PAM strand or non-target strand.
- the targeting sequence hybridizes to the non-PAM strand of the target nucleic acid, see e.g., US20190185849A1.
- the percent complementarity between the targeting sequence and the target nucleic acid is at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 97%, at least about 98%, at least about 99%, or 100%.
- the percent complementarity between the targeting sequence and the target nucleic acid is at most about 30%, at most about 40%, at most about 50%, at most about 60%, at most about 65%, at most about 70%, at most about 75%, at most about 80%, at most about 85%, at most about 90%, at most about 95%, at most about 97%, at most about 98%, at most about 99%, or 100%. In some examples, the percent complementarity between the targeting sequence and the target nucleic acid is 100% over the six contiguous 5′-most nucleotides of the target sequence of the complementary strand of the target nucleic acid. The percent complementarity between the targeting sequence and the target nucleic acid can be at least 60% over about 20 contiguous nucleotides.
- the length of the targeting sequence and the target nucleic acid can differ by 1 to 6 nucleotides, which may be thought of as a bulge or bulges.
- the targeting sequence can be designed or chosen using computer programs known to persons of ordinary skill in the art.
- the computer program can use variables, such as predicted melting temperature, secondary structure formation, predicted annealing temperature, sequence identity, genomic context, chromatin accessibility, % GC, frequency of genomic occurrence (e.g., of sequences that are identical or are similar but vary in one or more spots as a result of mismatch, insertion or deletion), methylation status, presence of SNPs, and the like.
- RNAs comprising a targeting sequence.
- the guide RNA further comprises a guide RNA scaffold sequence.
- the targeting sequence is complementary to the sequence of a target gene selected from the group consisting of HLA-A, HLA-B, HLA-C, B2M or an allele thereof.
- the target gene is an HLA-A gene. In some embodiments, the target gene is an HLA-B gene. In some embodiments, the target gene is an HLA-C gene. In some embodiments the target gene is HLA-A, HLA-B, HLA-C, or a combination thereof. In some embodiments, targeting sequence comprises a sequence that shares about 90%, about 95%, about 96%, about 97%, about 98%, about 99% identity to or is identical to a sequence disclosed in Tables 11 and14. [0485] In some embodiments, the gNAs specifically target the sequence of an endogenous HLA-A locus.
- the gNAs that specifically target the sequence of an HLA-A locus comprise a sequence that shares about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity to a sequence selected from the sequences disclosed in Table 11.
- the gNAs that specifically target the sequence of an HLA-A locus comprise a sequence selected from the sequences disclosed in Table 11.
- the gNAs specifically target a sequence of HLA-A*02 alleles.
- the gRNAs specifically target, and hybridize to, a sequence shared by all HLA-A*02 alleles, but that is not shared by HLA-A*02 and HLA-A*03 alleles.
- the gNAs specifically target a sequence of HLA-A*02:01 alleles. In some embodiments, the gNAs specifically target a sequence of HLA-A*02:01:01 alleles. In some embodiments, the gNAs specifically target a sequence of HLA-A*02:01:01 alleles. In some embodiments, the gNAs specifically target a sequence of HLA- A*02:01:01:01 alleles. [0487] In some embodiments, the gNAs specifically target a coding DNA sequence of HLA-A*02. [0488] In some embodiments, the gNAs specifically target a coding DNA sequence that is shared by more than 1000 HLA-A*02 alleles.
- the gNAs that specifically target a coding DNA sequence in greater than 1000 HLA-A*02 alleles comprise a sequence that shares about 90%, about 95%, about 96%, about 97%, about 98%, about 99% identity or is identical to a sequence selected from the sequences set forth in Table 11.
- Tables 11-14 are presented as DNA sequences. The skilled artisan will understand that thymine (T) can be replaced with uracil (U) in any DNA sequence including those set forth in Tables 11-14, to arrive at the corresponding RNA sequence.
- Table 11 Illustrative sequences targeting HLA-A alleles
- the sequences disclosed in Table 11 include the corresponding genomic sequences, inclusive of the PAM sequence.
- the skilled artisan will understand that the targeting sequence of the gRNA does not include three 3’ terminal nucleotides of the sequences in Table 11, which represent the corresponding PAM site for the gRNA.
- the disclosure provides gNAs comprising a targeting sequence specific to the B2M gene.
- the gNAs specifically target the coding sequence (CDS) sequence of the B2M gene.
- the gNA comprises a sequence that targets the B2M gene promoter sequence.
- the gNA comprise a targeting sequence and a gNA scaffold sequence.
- the targeting sequence comprises a sequence set forth in Table 12, or a sequence shares about 90%, about 95%, about 96%, about 97%, about 98%, about 99% identity thereto.
- the targeting sequence is complementary to a sequence of the B2M gene.
- the B2M gene comprises a sequence that shares about 90%, about 95%, about 96%, about 97%, about 98%, about 99% identity to the B2M sequence set forth in Table 10.
- Illustrative sequences targeting B2M 198 DOCKET NO.: 06 199 are edited using TALEN gene editing.
- TALEN or “TALEN gene editing” refers to a transcription activator-like effector nuclease, which is an artificial nuclease used to edit a target gene.
- TALENs are produced artificially by fusing a TAL effector DNA binding domain to a DNA cleavage domain.
- Transcription activator-like effectors (TALEs) derived from Xanthomonas bacteria can be engineered to bind any desired DNA sequence, including a portion of target genes such as TCR subunits, MHC class I complex components, or CD52.
- TALE Transcription activator-like effectors
- a restriction enzyme can be produced which is specific to any desired DNA sequence, including a target gene sequence.
- TALEN a TALE protein is fused to a nuclease (N), which is a wild- type or mutated Fold endonuclease.
- N nuclease
- FokI Several mutations to FokI have been made for its use in TALENs; these, for example, improve cleavage specificity or activity.
- FokI domain functions as a dimer, requiring two constructs with unique DNA binding domains for sites in the target genome with proper orientation and spacing.
- TALENs specific to sequences in a target gene can be constructed using any method known in the art, including various schemes using modular components.
- a target gene is edited in the immune cells described herein using ZFN gene editing.
- ZFN or “Zinc Finger Nuclease” or “ZFN gene editing” refer to a zinc finger nuclease, an artificial nuclease which can be used to edit a target gene.
- a ZFN comprises a Fold nuclease domain (or derivative thereof) fused to a DNA-binding domain.
- the DNA-binding domain comprises one or more zinc fingers.
- a zinc finger is a small protein structural motif stabilized by one or more zinc ions.
- a zinc finger can comprise, for example, Cys2His2, and can recognize an approximately 3-bp sequence.
- Various zinc fingers of known specificity can be combined to produce multi-finger polypeptides which recognize about 6, 9, 12, 15 or 18-bp sequences.
- TALEN a ZFN must dimerize to cleave DNA.
- a pair of ZFNs are required to target non-palindromic DNA sites.
- the two individual ZFNs must bind opposite strands of the DNA with their nucleases properly spaced apart.
- a ZFN can create a double-stranded break in the DNA, which can create a frame-shift mutation if improperly repaired, leading to a decrease in the expression and amount of a target gene or gene product in a cell.
- ZFNs can also be used with homologous recombination to mutate in a target gene.
- ZFNs specific to sequences in a target gene can be constructed using any method known in the art.
- the expression and of function of one or more MCH-I components are reduced using RNA interference.
- RNAi refers to the process of sequence-specific post-transcriptional gene silencing, mediated by double-stranded RNA (dsRNA).
- Duplex RNAs such as siRNA (small interfering RNA), miRNA (micro RNA), shRNA (short hairpin RNA), ddRNA (DNA- directed RNA), piRNA (Piwi-interacting RNA), or rasiRNA (repeat associated siRNA) and modified forms thereof are all capable of mediating RNA interference.
- dsRNA molecules may be commercially available or may be designed and prepared based on known sequence information.
- the anti-sense strand of these molecules can include RNA, DNA, PNA, or a combination thereof.
- DNA/RNA chimeric polynucleotides include, but are not limited to, a double-strand polynucleotide composed of DNA and RNA that inhibits the expression of a target gene.
- dsRNA molecules can also include one or more modified nucleotides, as described herein, which can be incorporated on either or both strands. [0509] In RNAi gene silencing or knockdown, dsRNA comprising a first (anti-sense) strand that is complementary to a portion of a target gene and a second (sense) strand that is fully or partially complementary to the first anti-sense strand is introduced into an organism.
- RNAi RNA induced silencing complex
- siRNAs Following cleavage by Dicer, siRNAs enter the RISC complex and direct cleavage of a single stranded RNA target having a sequence complementary to the anti-sense strand of the siRNA duplex. The other strand of the siRNA is the passenger strand. Cleavage of the target RNA takes place in the middle of the region complementary to the anti-sense strand of the siRNA duplex. siRNAs can thus down regulate or knock down gene expression by mediating RNA interference in a sequence-specific manner.
- target gene or “target sequence” refers to a gene or gene sequence whose corresponding RNA is targeted for degradation through the RNAi pathway using dsRNAs or siRNAs as described herein.
- the siRNA comprises an anti-sense region complementary to, or substantially complementary to, at least a portion of the target gene or sequence, and sense strand complementary to the anti- sense strand.
- the siRNA directs the RISC complex to cleave an RNA comprising a target sequence, thereby degrading the RNA.
- the disclosure provides interfering RNAs.
- the double stranded RNA molecule of the disclosure may be in the form of any type of RNA interference molecule known in the art.
- the double stranded RNA molecule is a small interfering RNA (siRNA).
- the double stranded RNA molecule is a short hairpin RNA (shRNA) molecule.
- the double stranded RNA molecule is a Dicer substrate that is processed in a cell to produce an siRNA.
- the double stranded RNA molecule is part of a microRNA precursor molecule.
- the shRNA is a length to be suitable as a Dicer substrate, which can be processed to produce a RISC active siRNA molecule. See, e.g., Rossi et al., US2005/0244858.
- a Dicer substrate double stranded RNA e.g.
- a shRNA can be of a length sufficient that it is processed by Dicer to produce an active siRNA, and may further include one or more of the following properties: (i) the Dicer substrate shRNA can be asymmetric, for example, having a 3' overhang on the anti-sense strand, (ii) the Dicer substrate shRNA can have a modified 3' end on the sense strand to direct orientation of Dicer binding and processing of the dsRNA to an active siRNA, for example the incorporation of one or more DNA nucleotides, and (iii) the first and second strands of the Dicer substrate ds RNA can be from 21-30 bp in length.
- the interfering RNAs comprise a sequence complementary to a sequence of a B2M mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the B2M mRNA. In some embodiments, the B2M mRNA sequence comprises a coding sequence. In some embodiments, the B2M mRNA sequence comprises an untranslated region. [0515] In some embodiments, the interfering RNAs comprise a sequence complementary to a sequence of an HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02 mRNA.
- the HLA-A*02 mRNA sequence comprises a coding sequence. In some embodiments, the HLA- A*02 mRNA sequence comprises an untranslated region.
- the interfering RNA is a short hairpin RNA (shRNA).
- the shRNA comprises a first sequence, having from 5’ to 3’ end a sequence complementary to the B2M mRNA; and a second sequence, having from 5’ to 3’ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA.
- the first sequence is 18, 19, 20, 21, or 22 nucleotides.
- the first sequence is complementary to a sequence selected from the sequences set forth in Tables 13 and 14. In some embodiments, the first sequence has GC content greater than or equal to 25% and less than 60%. In some embodiments, the first sequence is complementary to a sequence selected from the sequences set forth in Tables 13 and 14. In some embodiments, the first sequence does not comprise four nucleotides of the same base or a run of seven C or G nucleotide bases. In some embodiments, the first sequence is 21 nucleotides. [0518] Illustrative target B2M sequences complementary to the first sequence are shown in Table 13. [0519] In some cases, the first sequence may have 100% identity, i.e.
- An exemplary sequence encoding a B2M shRNA comprises a sequence of GCACTCAAAGCTTGTTAAGATCGAAATCTTAACAAGCTTTGAGTGC (SEQ ID NO: 349), or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- a further exemplary sequence encoding a B2M shRNA comprises a sequence of GTTAACTTCCAATTTACATACCGAAGTATGTAAATTGGAAGTTAAC (SEQ ID NO: 350), or a sequence having at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the interfering RNAs comprise a sequence complementary to a sequence of an HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02 mRNA. In some embodiments, the HLA-A*02 mRNA sequence comprises a coding sequence. In some embodiments, the HLA-A*02 mRNA sequence comprises an untranslated region. [0523] In some embodiments, the interfering RNAs comprise a sequence complementary to a sequence of an HLA-A*03 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*03 mRNA.
- the HLA-A*03 mRNA sequence comprises a coding sequence. In some embodiments, the HLA-A*03 mRNA sequence comprises an untranslated region.
- the interfering RNA is a short hairpin RNA (shRNA). In some embodiments, the shRNA comprises a first sequence, having from 5’ to 3’ end a sequence complementary to the HLA-A*02 mRNA; and a second sequence, having from 5’ to 3’ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA.
- shRNA short hairpin RNA
- the shRNA comprises a first sequence, having from 5’ to 3’ end a sequence complementary to the HLA-A*02 mRNA; and a second sequence, having from 5’ to 3’ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA.
- DOCKET NO.: 06 Illustrative target HLA sequences complementary to the first sequence are shown in Table 14. Table 14.
- Illustrative target HLA sequences complementary to first sequence are separated by a linker, sometimes referred to as a loop.
- both the first sequence and the second sequence are encoded by one single-stranded RNA or DNA vector.
- the loop is between the first and second sequences.
- the first sequence and the second sequence hybridize to form a duplex region.
- the first sequence and second sequence are joined by a linker sequence, forming a “hairpin” or “stem-loop” structure.
- the shRNA can have complementary first sequences and second sequences at opposing ends of a single stranded molecule, so that the molecule can form a duplex region with the complementary sequence portions, and the strands are linked at one end of the duplex region by a linker (i.e. loop sequence).
- the linker, or loop sequence can be either a nucleotide or non-nucleotide linker.
- the linker can interact with the first sequence, and optionally, second sequence through covalent bonds or non-covalent interactions.
- Any suitable nucleotide loop sequence is envisaged as within the scope of the disclosure.
- An shRNA of this disclosure may include a nucleotide, non-nucleotide, or mixed nucleotide/non-nucleotide linker that joins the first sequence of the shRNA to the second sequence of the shRNA.
- a nucleotide loop sequence can be ⁇ 2 nucleotides in length, for example about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides in length. Illustrative loop sequences are disclosed in Table 16. [0528]
- the shRNA further comprises a 5’ flank sequence and a 3’ flank sequence. In some embodiments, wherein the 5’ flank sequence is joined to the 5’ end of the first sequence, and wherein the 3’ flank sequence is joined to the 3’ end of the second sequence.
- flanking shRNA stem loop sequence with 5’ and 3’ sequences similar to those found in microRNAs can target the shRNA for processing by the endogenous microRNA processing machinery, increasing the effectiveness of shRNA processing.
- flanking sequences may increase shRNA compatibility with polymerase II or polymerase III promoters, leading to more effective regulation of shRNA expression.
- the 5’ flank sequence is selected from the sequences set forth in Table 15. Illustrative flank sequence are shown in Table 15. Table 15.
- the first and second sequence are present on a single stranded polynucleotide, wherein the first sequence and second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA.
- the loop region comprises a sequence selected from the sequences set forth in Table 16. Table 16.
- shRNAs of the disclosure may be generated exogenously by chemical synthesis, by in vitro transcription, or by cleavage of longer double-stranded RNA with Dicer or another appropriate nuclease with similar activity.
- siRNAs produced from protected ribonucleoside phosphoramidites using a conventional DNA/RNA synthesizer, may be obtained from commercial suppliers such as Millipore Sigma (Houston, Tex.), Ambion Inc. (Austin, Tex.). Invitrogen (Carlsbad, Calif.), or Dharmacon (Lafayette, Colo.).
- siRNAs can be purified by extraction with a solvent or resin, precipitation, electrophoresis, chromatography, or a combination thereof, for example. Alternatively, siRNAs may be used with little if any purification to avoid losses due to sample processing.
- shRNAs of the disclosure can be produced using an expression vector into which a nucleic acid encoding the double stranded RNA has been cloned, for example under control of a suitable promoter.
- Pharmaceutical Compositions [0534] The disclosure provides pharmaceutical compositions comprising immune cells comprising the first and second receptors of the disclosure and a pharmaceutically acceptable diluent, carrier or excipient.
- compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; and preservatives.
- the immune cell expresses both the first receptor and the second receptor. In some embodiments, at least about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% of the immune cells express both the first receptor and the second receptor.
- At least 90% of the immune cells express both the first receptor and the second receptor.
- Treating Cancer [0537] Provided herein are methods of killing a plurality of cancer cells, or treating cancer, in a subject, comprising administering to the subject a therapeutically effective amount of a composition comprising immune cells comprising the first and second receptors of the disclosure. The immune cells express both receptors in the same cell.
- Cancer is a disease in which abnormal cells divide without control and spread to nearby tissue.
- the cancer comprises a liquid tumor or a solid tumor. Exemplary liquid tumors include leukemias and lymphomas. Cancers can arise in virtually an organ in the body, including epithelial tissues.
- MSLN positive cancers that can be treated using the methods described herein include mesothelioma, ovarian cancer, cervical cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancers such as lung adenocarcinomas, colorectal cancer and cholangiocarcinoma.
- the plurality of cancer cells express the target antigen.
- the plurality cancer cells of the subject express MSLN.
- MSNL positive cancers include mesothelioma cancer, ovarian cancer, cervical cancer, colorectal cancer, esophageal cancer, head and neck cancer, kidney cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancer, lung adenocarcinomas, colorectal cancer, or cholangiocarcinoma, as well as other solid epithelial tumors.
- Further cancers that express MSLN include relapsed, refractory or metastatic gastric, esophageal, head and neck and kidney cancers.
- the MSLN positive cancer comprises an epithelial tumor, for example a carcinoma.
- kits for treating MSLN+ cancer in a subject having a MSLN+ tumor, the tumor having loss of heterozygosity at an MHC class I locus comprise administering to the subject an effective amount of the immune cells or pharmaceutical compositions described herein.
- the methods comprise (a) determining HLA-A, HLA-B, or HLA-C genotype or expression of normal cells and a plurality of cancer cells of the subject; (b) determining the expression of MSLN in a plurality of cancer cells of the subject; and (c) administering to the subject an effective amount of the immune cells or pharmaceutical compositions of the disclosure if the normal cells express an HLA-A, HLA-B or HLA-C non-target antigen and the plurality of cancer cells do not express the HLA-A, HLA-B or HLA-C non-target antigen, and the plurality of cancer cells are also MSLN-positive.
- the methods comprise (a) determining HLA-A, HLA-B or HLA-C genotype or expression of normal cells and a plurality of cancer cells of the subject; and (b) administering to the subject an effective amount of the immune cells or pharmaceutical compositions of the disclosure if the normal cells express an HLA-A, HLA-B or HLA-C non-target antigen and the plurality of cancer cells do not express the non-target antigen.
- the non-target antigen comprises HLA-A*02, HLA-A*01, HLA-A*03, HLA-A*11, HLA- B*07 or HLA-C*07.
- a plurality of cancer cells do not express a polymorphic allele of ICAM1, COMT or CXCL16.
- the cancer cells have lost an allele of CAM1, COMT or CXCL16 through loss of heterozygosity at that locus.
- the plurality of cancer cells do not express, or have lower expression than normal cells, of LRRN4 or UPK3B.
- the disclosure provides methods of treating a cancer in a subject comprising: (a) determining the genotype of normal cells and a plurality of cancer cells of the subject at a polymorphic locus selected from the group consisting of a polymorphic locus of ICAM1, a polymorphic locus of COMT and a polymorphic locus of CXCL16; (b) determining the expression of MSLN in a plurality of cancer cells; and (c) administering a plurality of immune cells to the subject if the normal cells are heterozygous for the polymorphic locus and the plurality of cancer cells are hemizygous for the polymorphic locus, and the plurality of cancer cells are MSLN positive, wherein the plurality of immune cells comprise: (i) a first receptor, optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to MSLN, or a peptide antigen thereof in a complex with a major histo
- SNP genotyping methods include, inter alia, PCR based methods such as dual-probe TaqMan assays, array based hybridization methods and sequencing.
- Methods of measuring the expression of the target antigen in cancer or normal cells from a subject will be readily apparent to persons of ordinary skill in the art. These include, inter alia, methods of measuring RNA expression such as RNA sequencing and reverse transcription polymerase chain reaction (RT-PCR), as well as methods of measuring protein expression such as immunohistochemistry based methods.
- Methods of measuring loss of heterozygosity in a plurality of cancer cells include, inter alia, high throughput sequencing of genomic DNA extracted from cancer cells using methods known in the art.
- the disclosure provides methods of treating a cancer in a subject comprising measuring the expression level of the non-target antigen in a plurality of cancer cells, and treating the subject when the expression level of the non-target antigen in the plurality of cancer cells is less than the expression level of the non-target antigen in the plurality of cancer cells is less than the expression level of the non-target antigen a plurality of healthy cells.
- the non-target antigen comprises LRRN4 or UPKB3, or a peptide antigen of LRRN4 or UPKB3.
- the methods comprise determining the expression of MSLN in a plurality of cancer cells; and administering a plurality of immune cells to the subject if the plurality of cancer cells have low or no expression of the non-target antigen, and the plurality of cancer cells are MSLN positive.
- Methods of measuring the expression of the target antigen in cancer or cells from a subject will be readily apparent to persons of ordinary skill in the art. These include, inter alia, methods of measuring RNA expression such as RNA sequencing and reverse transcription polymerase chain reaction (RT-PCR), as well as methods of measuring protein expression such as immunohistochemistry based methods.
- the immune cells are T cells.
- the immune cells are allogeneic or autologous.
- the second receptor increases the specificity of the immune cells for the MSLN positive cancer cells compared to immune cells that express the first receptor but do not express the second receptor.
- the immune cells have reduced side effects compared to immune cells that express the first receptor but do not express the second receptor.
- Administration of the immune cells or pharmaceutical compositions described herein can arrest the growth of a tumor in the subject.
- the immune cells or pharmaceutical compositions can kill tumor cells, so that the tumor stops growing, or is reduced in size.
- immune cells or pharmaceutical compositions can prevent formation of additional tumors, or reduce the total number of tumors in the subject.
- Administration of the immune cells or pharmaceutical compositions described herein can result in selective killing of a cancer cell but not a wild-type cell in the subject.
- about 60% of the cells killed are cancer cells
- about 65% of the cells killed are cancer cells
- about 70% of the cells killed are cancer cells
- about 75% of the cells killed are cancer cells
- about 80% of the cells killed are cancer cells
- about 85% of the cells killed are cancer cells
- about 90% of the cells killed are cancer cells
- about 95% of the cells killed are cancer cells or about 100% of the cells killed are cancer cells.
- Administration of the immune cells or pharmaceutical compositions described herein can result in the killing of about 40%, about 50%, about 60%, about 70%, about 80%, about 90% or all of the cancer cells of the subject.
- administering the immune cells or pharmaceutical compositions described herein can result in fewer side effects for the subject than administration of an otherwise equivalent immune cell comprising the first activator receptor but no second inhibitory receptor.
- administering the immune cells or pharmaceutical compositions described herein can reduce dose limited toxicity relative to the MSLN CAR, or MSLN TCR administered without the second inhibitory receptor.
- Treating cancer can result in a reduction in size of a tumor. A reduction in size of a tumor may also be referred to as “tumor regression”.
- tumor size is reduced by 5% or greater relative to its size prior to treatment; more preferably, tumor size is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75% or greater.
- Size of a tumor may be measured by any reproducible means of measurement. The size of a tumor may be measured as a diameter of the tumor. [0555] Treating cancer can result in a reduction in tumor volume.
- tumor volume is reduced by 5% or greater relative to its size prior to treatment; more preferably, tumor volume is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75% or greater.
- Tumor volume may be measured by any reproducible means of measurement.
- the size of the tumor is reduced by about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, or about 100%, relative to the size of the tumor before administration of the immune cells or pharmaceutical compositions.
- the tumor is eliminated. [0557] Treating cancer results in a decrease in number of tumors.
- tumor number is reduced by 5% or greater relative to number prior to treatment; more preferably, tumor number is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75%.
- Number of tumors may be measured by any reproducible means of measurement. The number of tumors may be measured by counting tumors visible to the naked eye or at a specified magnification. Preferably, the specified magnification is 2x, 3x, 4x, 5x, 10x, or 50x. [0558] Treating cancer can result in a decrease in number of metastatic lesions in other tissues or organs distant from the primary tumor site.
- the number of metastatic lesions is reduced by 5% or greater relative to number prior to treatment; more preferably, the number of metastatic lesions is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75%.
- the number of metastatic lesions may be measured by any reproducible means of measurement.
- the number of metastatic lesions may be measured by counting metastatic lesions visible to the naked eye or at a specified magnification.
- the specified magnification is 2x, 3x, 4x, 5x, 10x, or 50x.
- Treating cancer can result in an increase in average survival time of a population of treated subjects in comparison to a population receiving carrier alone.
- the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days.
- An increase in average survival time of a population may be measured by any reproducible means.
- An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound.
- An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with an active compound.
- Treating cancer can result in an increase in average survival time of a population of treated subjects in comparison to a population of untreated subjects.
- the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days.
- An increase in average survival time of a population may be measured by any reproducible means.
- An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound.
- An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with an active compound.
- Treating cancer can result in increase in average survival time of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the present disclosure, or a pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative thereof.
- the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days.
- An increase in average survival time of a population may be measured by any reproducible means.
- An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound.
- Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving carrier alone. Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population. Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the present disclosure, or a pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative thereof.
- the mortality rate is decreased by more than 2%; more preferably, by more than 5%; more preferably, by more than 10%; and most preferably, by more than 25%.
- a decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means.
- a decrease in the mortality rate of a population may be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with an active compound.
- a decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following completion of a first round of treatment with an active compound.
- Treating cancer can result in a decrease in tumor growth rate.
- tumor growth rate is reduced by at least 5% relative to number prior to treatment; more preferably, tumor growth rate is reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%.
- Tumor growth rate may be measured by any reproducible means of measurement. Tumor growth rate can be measured according to a change in tumor diameter per unit time. [0564] Treating cancer can result in a decrease in tumor regrowth.
- tumor regrowth is less than 5%; more preferably, tumor regrowth is less than 10%; more preferably, less than 20%; more preferably, less than 30%; more preferably, less than 40%; more preferably, less than 50%; even more preferably, less than 50%; and most preferably, less than 75%.
- Tumor regrowth may be measured by any reproducible means of measurement. Tumor regrowth is measured, for example, by measuring an increase in the diameter of a tumor after a prior tumor shrinkage that followed treatment. A decrease in tumor regrowth is indicated by failure of tumors to reoccur after treatment has stopped. [0565] Treating or preventing a cancer can result in a reduction in the rate of cellular proliferation.
- the rate of cellular proliferation is reduced by at least 5%; more preferably, by at least 10%; more preferably, by at least 20%; more preferably, by at least 30%; more preferably, by at least 40%; more preferably, by at least 50%; even more preferably, by at least 50%; and most preferably, by at least 75%.
- the rate of cellular proliferation may be measured by any reproducible means of measurement.
- the rate of cellular proliferation is measured, for example, by measuring the number of dividing cells in a tissue sample per unit time.
- the proportion of proliferating cells is reduced by at least 5%; more preferably, by at least 10%; more preferably, by at least 20%; more preferably, by at least 30%; more preferably, by at least 40%; more preferably, by at least 50%; even more preferably, by at least 50%; and most preferably, by at least 75%.
- the proportion of proliferating cells may be measured by any reproducible means of measurement.
- the proportion of proliferating cells is measured, for example, by quantifying the number of dividing cells relative to the number of nondividing cells in a tissue sample.
- the proportion of proliferating cells can be equivalent to the mitotic index.
- Treating or preventing cancer can result in a decrease in size of an area or zone of cellular proliferation.
- size of an area or zone of cellular proliferation is reduced by at least 5% relative to its size prior to treatment; more preferably, reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%.
- Size of an area or zone of cellular proliferation may be measured by any reproducible means of measurement.
- the size of an area or zone of cellular proliferation may be measured as a diameter or width of an area or zone of cellular proliferation.
- Treating or preventing cancer can result in a decrease in the number or proportion of cells having an abnormal appearance or morphology.
- the number of cells having an abnormal morphology is reduced by at least 5% relative to its size prior to treatment; more preferably, reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%.
- An abnormal cellular appearance or morphology may be measured by any reproducible means of measurement.
- An abnormal cellular morphology can be measured by microscopy, e.g., using an inverted tissue culture microscope.
- An abnormal cellular morphology can take the form of nuclear pleiomorphism.
- Dosage and Administration [0569]
- the immune cells and of the present disclosure may be administered in a number of ways depending upon whether local or systemic treatment is desired. [0570] In general, administration may be parenteral.
- Methods for administration of cells for adoptive cell therapy are known and may be used in connection with the provided methods and compositions. For example, adoptive T cell therapy methods are described, e.g., in US Patent Application Publication No. 2003/0170238 to Gruenberg et al and U.S. Pat. No.4,690,915 to Rosenberg.
- the compositions of the disclosure are suitable for parenteral administration.
- parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue, thus generally resulting in the direct administration into the blood stream, into muscle, or into an internal organ.
- Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like.
- parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intravenous, intraarterial, intrathecal, intraventricular, intraurethral, intracranial, intratumoral, intrasynovial injection or infusions; and kidney dialytic infusion techniques.
- parenteral administration of the compositions of the present disclosure comprises intravenous or intraarterial administration.
- Formulations of a pharmaceutical composition suitable for parenteral administration typically generally comprise of immune cells combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and the like. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents.
- Parenteral formulations also include aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents.
- exemplary parenteral administration forms include solutions or suspensions in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired.
- Formulations for parenteral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
- the formulated composition comprising the immune cells is suitable for administration via injection.
- the formulated composition comprising the immune cells is suitable for administration via infusion.
- compositions of the present disclosure may be prepared according to conventional techniques well known in the pharmaceutical industry. Such techniques include the step of bringing into association the immune cells with the pharmaceutical carrier(s) or excipient(s), such as liquid carriers.
- Aqueous suspensions may further contain substances that increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran.
- the suspension may also contain stabilizers.
- the compositions of the present disclosure may additionally contain other adjunct components conventionally found in pharmaceutical compositions.
- compositions may contain additional, compatible, pharmaceutically-active materials such as, for example, antipruritics, astringents, local anesthetics or anti-inflammatory agents, or may contain additional materials useful in physically formulating various dosage forms of the compositions of the present disclosure, such as dyes, preservatives, antioxidants, opacifiers, thickening agents and stabilizers.
- additional materials useful in physically formulating various dosage forms of the compositions of the present disclosure, such as dyes, preservatives, antioxidants, opacifiers, thickening agents and stabilizers.
- additional materials useful in physically formulating various dosage forms of the compositions of the present disclosure, such as dyes, preservatives, antioxidants, opacifiers, thickening agents and stabilizers.
- additional materials useful in physically formulating various dosage forms of the compositions of the present disclosure, such as dyes, preservatives, antioxidants, opacifiers, thickening agents and stabilizers.
- dyes preservatives, antioxidants, o
- the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as chemotherapeutic agents.
- the pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Many types of release delivery systems are available and known. Such systems can avoid repeated administrations of the composition, thereby increasing convenience to the subject and the physician. [0581] Administration can be effected in one dose, continuously or intermittently throughout the course of treatment. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician.
- the pharmaceutical composition in some embodiments contains the immune cells in amounts effective to treat or prevent a cancer, such as a therapeutically effective or prophylactically effective amount.
- Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over days, weeks or months, depending on the condition, the treatment can be repeated until a desired suppression of cancer signs or symptoms occurs. However, other dosage regimens may be useful and can be determined.
- the desired dosage can be delivered by a single bolus administration or infusion of the composition or by multiple bolus administrations or infusions of the composition.
- the cells or population of cells can be administrated in one or more doses. In some embodiments, an effective amount of cells can be administrated as a single dose.
- an effective amount of cells can be administrated as more than one doses over a period time. Timing of administration is within the judgment of a managing physician and depends on the clinical condition of the patient.
- the cells or population of cells may be obtained from any source, such as a blood bank or a donor, or the patient themselves.
- An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administered will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.
- an effective amount of cells or composition comprising those cells are administrated parenterally.
- administration can be an intravenous administration.
- administration can be directly done by injection within a tumor.
- an assay which comprises, for example, comparing the extent to which target cells are lysed or one or more cytokines are secreted by immune cells expressing the receptors, upon administration of a given dose of such immune cells to a mammal, among a set of mammals of which is each given a different dose of the immune cells, can be used to determine a starting dose to be administered to a mammal.
- the cells are administered as part of a combination treatment, such as simultaneously with or sequentially with, in any order, another therapeutic intervention, such as an antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent.
- the immune cells of the disclosure are in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order.
- the immune cells are co-administered with another therapy sufficiently close in time such that the immune cell populations enhance the effect of one or more additional therapeutic agents, or vice versa.
- the immune cells are administered prior to the one or more additional therapeutic agents.
- the immune cells are administered after to the one or more additional therapeutic agents.
- a lymphodepleting chemotherapy is administered to the subject prior to, concurrently with, or after administration (e.g., infusion) of adoptive immune cells.
- the lymphodepleting chemotherapy is administered to the subject prior to administration of the immune cells.
- the lymphodepleting chemotherapy ends 1-4 days (e.g., 1, 2, 3, or 4 days) prior to adoptive cell infusion.
- multiple doses of adoptive cells are administered, e.g., as described herein.
- a lymphodepleting chemotherapy is administered to the subject prior to, concurrently with, or after administration (e.g., infusion) of the immune cells described herein.
- lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc.
- lymphodepleting agents include, but are not limited to, antithymocyte globulin, anti-CD3 antibodies, anti-CD4 antibodies, anti-CD8 antibodies, anti-CD52 antibodies, anti-CD2 antibodies, TCR ⁇ blockers, anti- CD20 antibodies, anti-CD19 antibodies, Bortezomib, rituximab, anti-CD 154 antibodies, rapamycin, CD3 immunotoxin, fludarabine, cyclophosphamide, busulfan, melphalan, Mabthera, Tacrolimus, alefacept, alemtuzumab, OKT3, OKT4, OKT8, OKT11, fingolimod, anti-CD40 antibodies, anti-BR3 antibodies, Campath-1H, anti-CD25 antibodies, calcineurin inhibitors, mycophenolate, and steroids, which may be used alone or in combination.
- a lymphodepletion regimen can include, administration of alemtuzumab, cyclophosphamide, benduamustin, rituximab, pentostatin, and/or fludarabine. Lymphodepletion regimen can be administered in one or more cycles until the desired outcome of reduced circulating immune cells.
- the lymphodepletion comprises administering an agent that specifically targets, and reduces or eliminates CD52+ cells in the subject, and the immune cells are modified to reduce or eliminate CD52 expression.
- an immune stimulating therapy is administered to the subject prior to, concurrently with, or after administration (e.g. infusion) of adoptive immune cells.
- the immune stimulating therapy comprises homeostatic cytokines. In some embodiments, the immune stimulating therapy comprises immune-stimulatory molecules. In some embodiments, the immune stimulating therapy comprises IL-2, IL-7, IL-12, IL-15, IL-21, IL-9, or a functional fragment thereof. In some embodiments, the immune stimulating therapy comprises IL-2, IL-7, IL-12, IL-15, IL-21, IL-9, or combinations thereof. In some embodiments, the immune stimulating therapy comprises IL-2, or a functional fragment thereof.
- Methods for adoptive cell therapy using autologous cells includes isolating immune cells from patient blood, performing a series of modifications on the isolated cells including transducing the cells with one or more vectors encoding the dual receptor system described herein, and administering the cells to a patient.
- Providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy requires isolation of immune cell from the patient’s blood, and can be accomplished through methods known in the art, for example, by leukapheresis. During leukapheresis, blood from a subject is extracted and the peripheral blood mononuclear cells (PBMCs) are separated, and the remainder of the blood is returned to the subject’s circulation.
- PBMCs peripheral blood mononuclear cells
- the PBMCs are stored either frozen or cryopreserved as a sample of immune cells and provided for further processing steps, such as, e.g. the modifications described herein.
- the method of treating a subject described herein comprises modifications to immune cells from the subject comprising a series of modifications comprising enrichment and/or depletion, activation, genetic modification, expansion, formulation, and cryopreservation.
- the disclosure provides enrichment and/or depletion steps that can be, for example, washing and fractionating methods known in the art for preparation of subject PBMCs for downstream procedures, e.g. the modifications described herein.
- methods can include devices to remove gross red blood cells and platelet contaminants, systems for size-based cell fractionation for the depletion of monocytes and the isolation of lymphocytes, and/or systems that allow the enrichment of specific subsets of T cells, such as, e.g. CD4+, CD8+, CD25+, or CD62L+ T cells.
- T cells such as, e.g. CD4+, CD8+, CD25+, or CD62L+ T cells.
- a target sub-population of immune cells will be isolated from the subject PMBCs for further processing.
- enrichment steps as provided herein, may also encompass any newly discovered method, device, reagent or combination thereof.
- the disclosure provides activation steps that can be any method known in the art to induce activation of immune cells, e.g.
- Immune cell activation can be achieved, for example, by culturing the subject immune cells in the presence of dendritic cells, culturing the subject immune cells in the presence of artificial antigen-presenting cells (AAPCs), or culturing the immune cells in the presence of irradiated K562-derived AAPCs.
- Other methods for activating subject immune cells can be, for example, culturing the immune cells in the presence of isolated activating factors and compositions, e.g. beads, surfaces, or particles functionalized with activating factors.
- Activating factors can include, for example, antibodies, e.g. anti-CD3 and/or anti- CD28 antibodies.
- Activating factors can also be, for example, cytokines, e.g. interleukin (IL)-2 or IL-21. Activating factors can also be costimulatory molecules, such as, for example, CD40, CD40L, CD70, CD80, CD83, CD86, CD137L, ICOSL, GITRL, and CD134L. Those skilled in the art will appreciate that activating factors, as provided herein, may also encompass any newly discovered activating factor, reagent, composition, or combination thereof that can activate immune cells. [0594] The disclosure provides genetic modification steps for modifying the subject immune cells. In some embodiments, the genetic modification comprises transducing the immune cell with a vector comprising a shRNA described herein complementary to B2M or HLA-A.
- the genetic modification comprises modifying the genome of the immune cells to induce mutations in B2M or HLA-A using CRISPR/Cas mediated genome engineering.
- the method comprises transducing the immune cell with one or more vectors encoding the activator and inhibitory receptors, thereby producing immune cells expressing the activator and inhibitory receptors.
- Cell culture flasks with gas-permeable membranes at the base may be used for immune cell expansion. Any such system known in the art that enables expansion of immune cells for clinical use is encompassed by the expansion step provided herein.
- Immune cells are expanded in culture systems in media formulated specifically for expansion. Expansion can also be facilitated by culturing the immune cell of the disclosure in the presence of activation factors as described herein.
- expansion steps, as provided herein may also encompass any newly discovered culture systems, media, or activating factors that can be used to expand immune cells.
- the disclosure provides formulation and cryopreservation steps for the expanded genetically modified subject immune cells.
- Formulation steps provided include, for example, washing away excess components used in the preparation and expansion of immune cells of the methods of treatment described herein.
- Any pharmaceutically acceptable formulation medium or wash buffer compatible with immune cell known in the art may be used to wash, dilute/concentration immune cells, and prepare doses for administration.
- Formulation medium can be acceptable for administration of the immune cells, such as, for example crystalloid solutions for intravenous infusion.
- Cryopreservation can optionally be used to store immune cells long-term. Cryopreservation can be achieved using known methods in the art, including for example, storing cells in a cryopreservation medium containing cryopreservation components.
- Cryopreservation components can include, for example, dimethyl sulfoxide or glycerol.
- Immune cells stored in cryopreservation medium can be cryopreserved by reducing the storage temperature to - 80 o C to -196 o C.
- the method of treatment comprises determining the HLA germline type of the subject. In some embodiments, the HLA germline type is determined in bone marrow. [0598] In some embodiments, the method of treatment comprises determining the level of expression of MSLN. In some embodiments, the level of expression of MSLN is determined in tumor tissue samples from the subject. In some embodiments, the expression level of MSLN is determined using next generation sequencing. In some embodiments, the expression level of MSLN is determined using RNA sequencing. In some embodiments, the level of MSLN is determined using immunohistochemistry.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-A*02 inhibitory receptor to a subject in need thereof, wherein the subject is determined to be HLA germline HLA-A*02 heterozygous and have cancer cells with loss of HLA-A*02.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-A*01 inhibitory receptor to a subject in need thereof, wherein the subject is determined to be HLA germline HLA-A*01 heterozygous and have cancer cells with loss of HLA-A*01.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-A*03 to a subject in need thereof, wherein the subject is determined to be HLA germline HLA-A*03 heterozygous and have cancer cells with loss of HLA- A*03.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-A*07 inhibitory receptor to a subject in need thereof, wherein the subject is determined to be HLA germline HLA-A*07 heterozygous and have cancer cells with loss of HLA-A*07.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-C*07 inhibitory receptor to a subject in need thereof, wherein the subject is determined to be HLA germline HLA-C*07 heterozygous and have cancer cells with and loss of HLA-C*07.
- the method of treatment comprises administering a therapeutically effective dose of immune cells comprising an HLA-B*07 inhibitory receptor in a subject in need thereof, wherein the subject is determined to be HLA germline HLA-B*07 heterozygous and have cancer cells with loss of HLA-B*07.
- the disclosure provides method of treatment of heterozygous HLA-A*02 patients with malignancies that express MSLN and have lost HLA-A*02 expression; and/or of treatment of heterozygous HLA-A*02 adult patients with recurrent unresectable or metastatic solid tumors that express MSLN and have lost HLA-A*02 expression.
- the disclosure provides method of treatment of heterozygous HLA-A*03 patients with malignancies that express MSLN and have lost HLA-A*03 expression; and/or of treatment of heterozygous HLA-A*03 adult patients with recurrent unresectable or metastatic solid tumors that express MSLN and have lost HLA-A*03 expression.
- a therapeutically effective dose of the immune cells described herein are administered.
- the immune cells of the disclosure are administered by intravenous injection.
- the immune cells of the disclosure are administered by intraperitoneal injection.
- a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells, about 1 ⁇ 10 6 cells, about 2 ⁇ 10 6 cells, about 3 ⁇ 10 6 cells, 4 ⁇ 10 6 cells, about 5 ⁇ 10 6 cells, about 6 ⁇ 10 6 cells, about 7 ⁇ 10 6 cells, about 8 ⁇ 10 6 cells, about 9 ⁇ 10 6 cells, about 1 ⁇ 10 7 , about 2 ⁇ 10 7 , about 3 ⁇ 10 7 , about 4 ⁇ 10 7 , about 5 ⁇ 10 7 , about 6 ⁇ 10 7 , about 7 ⁇ 10 7 , about 8 ⁇ 10 7 , about 9 ⁇ 10 7 , about 1 ⁇ 10 8 cells, about 2 ⁇ 10 8 cells, about 3 ⁇ 10 8 cells, about 4 ⁇ 10 8 cells, about 5 ⁇ 10 8 cells, about 6 ⁇ 10 8 cells, about 7 ⁇ 10 8 cells , about 8 ⁇ 10 8 cells, about 9 ⁇ 10 8 cells, about 1 ⁇ 10 9 cells, about 2 ⁇ 10 9 cells, about 3 ⁇ 10 9 cells, about 3 ⁇ 10 9 cells, about 4 ⁇ 10 9 cells, about 5 ⁇ 10 9 cells, about 6 ⁇ 10 8 cells, about
- a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 9 ⁇ 10 10 cells, about 1 ⁇ 10 6 cells to about 5 ⁇ 10 10 cells, about 2 ⁇ 10 6 cells to about 5 ⁇ 10 9 cells, about 3 ⁇ 10 6 cells to about 5 ⁇ 10 9 cells, about 4 ⁇ 10 6 cells to about 3 ⁇ 10 9 cells, about 5 ⁇ 10 6 cells to about 2 ⁇ 10 9 cells, about 6 ⁇ 10 6 cells to about 1 ⁇ 10 9 cells, 0.5 ⁇ 10 6 cells to about 6 ⁇ 10 9 cells, about 1 ⁇ 10 6 cells to about 5 ⁇ 10 9 cells, about 2 ⁇ 10 6 cells to about 5 ⁇ 10 9 cells, about 3 ⁇ 10 6 cells to about 4 ⁇ 10 9 cells, about 4 ⁇ 10 6 cells to about 3 ⁇ 10 9 cells, about 5 ⁇ 10 6 cells to about 2 ⁇ 10 9 cells, about 6 ⁇ 10 6 cells to about 1 ⁇ 10 9 cells, 0.5 ⁇ 10 6 cells to about 6 ⁇ 10 8 cells, about 1 ⁇ 10 6 cells to about 5 ⁇ 10 8 cells, about 2 ⁇ 10 6 cells to about 5 ⁇ 10 8 cells,
- a therapeutically effective dose comprises about 0.5 ⁇ 10 5 cells to about 9 ⁇ 10 10 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 1 ⁇ 10 10 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 5 ⁇ 10 9 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 1 ⁇ 10 9 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 6 ⁇ 10 8 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 6 cells to about 9 ⁇ 10 10 cells.
- a therapeutically effective dose comprises about 0.5 ⁇ 10 7 cells to about 1 ⁇ 10 10 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 7 cells to about 5 ⁇ 10 9 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 7 cells to about 1 ⁇ 10 9 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 7 cells to about 6 ⁇ 10 8 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 8 cells to about 9 ⁇ 10 10 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 8 cells to about 1 ⁇ 10 10 cells. In some embodiments, a therapeutically effective dose comprises about 0.5 ⁇ 10 8 cells to about 5 ⁇ 10 9 cells.
- kits and articles of Manufacture comprising the polynucleotides and vectors encoding the receptors described herein, and immune cells comprising the receptors described herein.
- the kit comprises articles such as vials, syringes and instructions for use.
- the kit comprises a polynucleotide or vector comprising a sequence encoding one or more receptors of the disclosure.
- the kit comprises a plurality of immune cells comprising the first and second receptors as described herein.
- the plurality of immune cells comprises a plurality of T cells.
- the kit further comprises instructions for use.
- ENUMERATED EMBODIMENTS [0609] The disclosure can be understood with reference to the following illustrative, enumerated embodiments: Embodiment Set I [0610] I-1.
- An immune cell responsive to loss of heterozygosity in a cancer cell comprising: a.
- a first receptor optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to a target antigen selected from: i. a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or ii. Mesothelin (MSLN), or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b.
- CAR chimeric antigen receptor
- TCR T cell receptor
- a second receptor optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen selected from ICAM1, COMT, and CXCL16, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I) , wherein the non-target antigen comprises a polymorphism.
- MHC-I major histocompatibility complex class I
- I-2 The immune cell of embodiment I-1, wherein the non-target antigen is lost from the cancer cell through loss of heterozygosity (LOH).
- LHO heterozygosity
- An immune cell responsive to low or no expression of a protein in a cancer cell comprising: a. a first receptor, optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to a target antigen selected from: i. a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or ii. MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b.
- a target antigen selected from: i. a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or ii. MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b
- a second receptor optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen selected from LRRN4 and UPK3B, or peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I), wherein the non-target antigen is expressed at a lower level by the cancer cell than by a non-target cell.
- MHC-I major histocompatibility complex class I
- the non-target antigen is expressed at a lower level by the cancer cell than by a non-target cell.
- the target antigen is a peptide antigen of a cancer cell-specific antigen in a complex with a major histocompatibility complex class I (MHC-I).
- MHC-I major histocompatibility complex class I
- the immune cell of any one of embodiments I-1-12 wherein the cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cancer cell, a colorectal cancer cell, an esophageal cancer cell, a head and neck cancer cell, a kidney cancer cell, an uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell, a lung cancer cell, a colorectal cancer cell or a cholangiocarcinoma cell. [0623] 14. The immune cell of any one of embodiments I-1-13, wherein the cancer cell expresses MSLN. [0624] 15.
- the first receptor is a T cell receptor (TCR). [0629] 20.
- CAR chimeric antigen receptor
- scFv single chain Fv antibody fragment
- V ⁇ ⁇ chain variable domain
- TCR ⁇ chain variable domain TCR ⁇ chain variable domain
- 22. The immune cell of embodiment I-19 or I-20, wherein the extracellular ligand binding domain comprises an scFv.
- the immune cell of embodiment I-22 wherein the scFv comprises a sequence selected from the group consisting of SEQ ID NOs: 3-6, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto. [0633] 24. The immune cell of embodiment I-22, wherein the scFv comprises or consists essentially of a sequence selected from the group consisting of SEQ ID NOs: 3-6. [0634] 25.
- An immune cell responsive to loss of heterozygosity in a cancer cell comprising: a.
- a first receptor optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to Mesothelin (MSLN), or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b. a second receptor, optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen, wherein the non-target antigen comprises HLA-A*02. [0635] 26.
- CAR chimeric antigen receptor
- TCR T cell receptor
- MSLN Mesothelin
- MHC-I major histocompatibility complex class I
- the immune cell of embodiment I-25 wherein the extracellular ligand binding domain of the first receptor comprises an antibody fragment, a single chain Fv antibody fragment (scFv), a ⁇ chain variable domain (V ⁇ ), or a TCR ⁇ chain variable domain and a TCR ⁇ chain variable domain.
- scFv single chain Fv antibody fragment
- V ⁇ ⁇ chain variable domain
- TCR ⁇ chain variable domain and a TCR ⁇ chain variable domain a TCR ⁇ chain variable domain.
- 27 The immune cell of embodiment I-25, wherein the extracellular ligand binding domain of the first receptor comprises an scFv.
- the scFv comprises a sequence selected from the group consisting of SEQ ID NOs: 3-6, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto. [0638] 28.
- scFv single chain Fv antibody fragment
- V ⁇ ⁇ chain variable domain
- TCR ⁇ chain variable domain TCR ⁇ chain variable domain
- TCR ⁇ chain variable domain a TCR ⁇ chain variable domain
- the immune cell of embodiment I-36, wherein the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 74.
- 40 The immune cell of any one of embodiments I-25-39, wherein the second receptor comprises a LILRB1 intracellular domain and a LILRB1 transmembrane domain, or a functional variant thereof.
- the immune cell of embodiment I-40 wherein the LILRB1 intracellular domain and LILRB1 transmembrane domain comprises SEQ ID NO: 69 or a sequence at least 95% identical to SEQ ID NO: 69.
- 42 The immune cell of any one of embodiments I-25-41, wherein the cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cancer cell, a colorectal cancer cell, an esophageal cancer cell, a head and neck cancer cell, a kidney cancer cell, an uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell, a lung cancer cell, a colorectal cancer cell or a cholangiocarcinoma cell.
- the immune cell of any one of embodiments I-25-50, wherein the first receptor is a chimeric antigen receptor (CAR) or a TCR.
- composition of embodiment I-52 further comprising a pharmaceutically acceptable carrier, diluent or excipient.
- 54. The pharmaceutical composition of embodiment I-52 or I-53, for use as a medicament in the treatment of cancer.
- a polynucleotide system comprising one or more polynucleotides comprising polynucleotide sequences encoding: a. a first receptor, optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to a target antigen selected from: i.
- CAR chimeric antigen receptor
- TCR T cell receptor
- a cancer cell-specific antigen or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or ii. MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b. a second receptor, optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen selected from ICAM1, COMT and CXCL16, or an antigen peptide thereof in a complex with a major histocompatibility complex class I (MHC-I), wherein the non-target antigen comprises a polymorphism.
- MHC-I major histocompatibility complex class I
- MHC-I major histocompatibility complex class I
- a polynucleotide system comprising one or more polynucleotides comprising polynucleotide sequences encoding: a. a first receptor, optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to a target antigen selected from: i. a cancer cell-specific antigen, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); or ii. MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b.
- a first receptor optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR)
- CAR chimeric antigen receptor
- TCR T cell receptor
- a second receptor optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen selected from LRRN4 and UPK3B, or peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I), wherein the non-target antigen is expressed at a lower level by the cancer cell than by a non-target cell.
- MHC-I major histocompatibility complex class I
- a first receptor optionally a chimeric antigen receptor (CAR) or T cell receptor (TCR), comprising an extracellular ligand binding domain specific to MSLN, or a peptide antigen thereof in a complex with a major histocompatibility complex class I (MHC-I); and b. a second receptor, optionally an inhibitory chimeric antigen receptor, comprising an extracellular ligand binding domain specific to a non-target antigen, wherein the non-target antigen comprises HLA-A*02.
- a vector comprising the one or more polynucleotides of any one of embodiments I-55-57. [0669] 59.
- a method of killing a plurality of cancer cell and/or treating cancer in a subject comprising administering to the subject an effective amount of the immune cell of any one of embodiments I-1-51 or the pharmaceutical composition of any one of embodiments I-52-54.
- a method of making a plurality of immune cells comprising: a. providing a plurality of immune cells, and b.
- kits comprising the immune cell of any one of embodiments I-1-51 or the pharmaceutical composition of any one of embodiments I-52-54.
- the kit of embodiment I-63 further comprising instructions for use.
- Embodiment Set II [0675] 1.
- An immune cell comprising: (a) first receptor, comprising an extracellular ligand binding domain specific to Mesothelin (MSLN); and (b) a second receptor, comprising an extracellular ligand binding domain specific to HLA-A*03, wherein the first receptor is an activator receptor responsive to MSLN; and wherein the second receptor is an inhibitory receptor responsive to HLA-A*03.
- MSLN Mesothelin
- a second receptor comprising an extracellular ligand binding domain specific to HLA-A*03, wherein the first receptor is an activator receptor responsive to MSLN; and wherein the second receptor is an inhibitory receptor responsive to HLA-A*03.
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 as disclosed Table 6; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertion relative to the CDRs of Table 6 or Table 7. [0678] 4.
- CDRs complementarity determining regions
- CDRs complementarity determining regions
- SEQ ID NOS: 638, 645, 650, 657, 676, and 693 SEQ ID NOS: 638, 645, 650, 658, 677, and 694;
- SEQ ID NOS: 639, 646, 651, 657, 676, and 698 SEQ ID NOS: 638, 645, 650, 657, 676, and 693
- SEQ ID NOS: 638, 645, 650, 658, 677, and 694 SEQ ID NOS: 638, 645, 650, 659, 678, and 695
- the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 of (i) SEQ ID NOS: 638, 645, 650, 657, 676, and 693; (ii) SEQ ID NOS: 638, 645, 650, 658, 677, and 694; (iii) SEQ ID NOS: 638, 645, 650, 659, 678, and 695; (iv) SEQ ID NOS: 638, 645, 650, 660, 678, and 696; (v) SEQ ID NOS: 638, 645, 650, 661, 679, and 697; (vi) SEQ ID NOS: 639, 646, 651, 657, 676, and 698; (vii) SEQ ID NOS: 639, 646, 651, 657, 676, and 698; (vii)
- the immune cell of any one of embodimentss II-1-4, wherein the extracellular ligand binding domain of the second receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 of SEQ ID NOS: 1260-1265.
- CDRs complementarity determining regions
- the extracellular ligand binding domain of the second receptor comprises a polypeptide sequence selected from the polypeptide sequence disclosed in Table 5; or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cell of any one of embodiments II-1-4, wherein the extracellular ligand binding domain of the second receptor comprises any one of SEQ ID NOS: 615-628 or SEQ ID NO: 1259, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto. [0683] 9. The immune cell of any one of embodiments II-1-4, wherein the extracellular ligand binding domain of the second receptor comprises any one of SEQ ID NOS: 615-628. [0684] 10. The immune cell of any one of embodiments II-1-4, wherein the extracellular ligand binding domain of the second receptor comprises SEQ ID NO: 1259. [0685] 11.
- CAR chimeric antigen receptor
- 12 The immune cell of any one of embodiments II-1-11, wherein the extracellular ligand binding domain of the first receptor comprises complementarity determining regions (CDRs) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, CDR- H3 as disclosed Table 2; or CDR sequences having at most 1, 2, or 3 substitutions, deletions, or insertions relative to the CDRs of Table 2. [0687] 13.
- CDRs complementarity determining regions
- VH variable heavy
- VL variable light
- variable heavy (VH) portion comprising SEQ ID NO: 233 or a sequence having at least 85%, at least 90%, at least 95%, at least 97%, or at least 99% identity thereto
- VL variable light
- the extracellular ligand binding domain of the first receptor comprises an scFv sequence of SEQ ID NO: 171; or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the hinge domain comprises a CD8 ⁇ hinge domain.
- the CD8 ⁇ hinge domain comprises a sequence of SEQ ID NO: 7, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cell of any one of embodiments II-11-19, wherein the transmembrane domain comprises a CD28 transmembrane domain. [0695] 21.
- the immune cell of embodiment II-20 wherein the CD28 transmembrane domain comprises a sequence of SEQ ID NO: 11, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- 22 The immune cell of any one of embodiments II-11-21, wherein the intracellular domain comprises a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, and a CD3 ⁇ activation domain.
- 23. The immune cell of embodiment II-22, wherein the intracellular domain comprises a sequence of SEQ ID NO: 285, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- 24 The immune cell of embodiment II-20, wherein the CD28 transmembrane domain comprises a sequence of SEQ ID NO: 11, or a sequence having at least 85%, at least 90%, at least 95%, at least 97% or at least 99% identity thereto.
- the immune cell of embodiment II-25, wherein the LILRB1 intracellular domain comprises a sequence at least 90%, at least 95%, at least 97%, at least 99%, or is identical to SEQ ID NO: 70. [0701] 27.
- the second receptor comprises a LILRB1 transmembrane domain or a functional variant thereof.
- 29. The immune cell of any one of embodiments II-1-28, wherein the second receptor comprises a LILRB1 hinge domain or functional variant thereof. [0704] 30.
- the immune cell of embodiment II-29 wherein the LILRB1 hinge domain comprises a sequence at least 90%, at least 95%, at least 97%, at least 99% or is identical to SEQ ID NO: 73.
- the second receptor comprises a LILRB1 intracellular domain, a LILRB1 transmembrane domain, a LILRB1 hinge domain, a functional variant of any of these, or combinations thereof.
- the immune cell of embodiment II-31 wherein the LILRB1 hinge domain, LILRB1 intracellular domain and LILRB1 transmembrane domain comprises SEQ ID NO: 71 or a sequence at least 90%, at least 95%, at least 97%, at least 99% or is identical to SEQ ID NO: 71.
- the second receptor comprises a sequence of SEQ ID NO: 1268, or a sequence having at least 90%, at least 95%, at least 97%, or at least 99% identity thereto.
- the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cancer cell, a colorectal cancer cell, an esophageal cancer cell, a head and neck cancer cell, a kidney cancer cell, an uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell, a lung cancer cell, a colorectal cancer cell or a cholangiocarcinoma cell.
- the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cancer cell, a colorectal cancer cell, an esophageal cancer cell, a head and neck cancer cell, a kidney cancer cell, an uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell, a lung cancer cell, a colorectal cancer cell or a cholangiocarcinoma cell.
- the immune cell of embodiment II-34 wherein the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cell, a uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell or a lung adenocarcinoma cell.
- the MSLN+ cancer cell is a mesothelioma cancer cell, an ovarian cancer cell, a cervical cell, a uterine cancer cell, a gastric cancer cell, a pancreatic cancer cell or a lung adenocarcinoma cell.
- 36 The immune cell of any one of embodiments II-1-35, wherein the MSLN+ cancer cell is a MSLN+/HLA-A*03– cancer cell that does not express HLA-A*03.
- the immune cell of embodiment II-36 wherein the MSLN+/HLA-A*03– cancer cell is derived from a MSLN+/HLA-A*03+ cell by loss of heterozygosity at HLA- A leading to loss of HLA-A*03.
- the immune cell of embodiment II-42 wherein the MHC Class I gene is beta-2-microglobulin (B2M).
- B2M beta-2-microglobulin
- 44. The immune cell of embodiment II-43, further comprising a polynucleotide comprising an interfering RNA, the interfering RNA comprising a sequence complementary to a sequence of a B2M mRNA.
- 45. The immune cell of embodiment II-44, wherein the interfering RNA comprises a sequence selected from the group of sequences set forth in Table 13, or a sequence having at most 1, 2, 3, or 4 substitutions, insertions or deletions relative thereto. [0720] 46.
- the immune cell of embodiment II-44 or II-45, wherein the interfering RNA is capable of inducing RNAi-mediated degradation of the B2M mRNA.
- the immune cell of embodiment II-46, wherein the interfering RNA is a short hairpin RNA (shRNA).
- shRNA short hairpin RNA
- the shRNA comprises: (a) a first sequence, having from 5’ end to 3’ end a sequence complementary to a sequence of the B2M mRNA; and (b) a second sequence, having from 5’ end to 3’ end a sequence complementary to the first sequence, wherein the first sequence and the second sequence form the shRNA.
- the immune cell of embodiment II-47 or II-48 wherein the shRNA is encoded by a sequence comprising a sequence of GCACTCAAAGCTTGTTAAGATCGAAATCTTAACAAGCTTTGAGTGC (SEQ ID NO: 349) or GTTAACTTCCAATTTACATACCGAAGTATGTAAATTGGAAGTTAAC (SEQ ID NO: 350), or a sequence having at least 80%, at least 90%, or at least 95% identity thereto. [0724] 50.
- the immune cell of embodiment II-43 comprising one or more modifications to a sequence encoding B2M, wherein the one or more modifications reduce the expression and/or eliminate the function of B2M. [0725] 51.
- the immune cell of embodiment II-50, wherein the one or more modifications comprise one or more inactivating mutations of the endogenous gene encoding B2M.
- 52. The immune cell of embodiment II-51, wherein the one or more inactivating mutations comprise a deletion, an insertion, a substitution, or a frameshift mutation.
- 53. The immune cell of any one of embodiments II-51 or II-52, wherein the one or more inactivating mutations are introduced with a nucleic acid guided endonuclease in a complex with at least one guide nucleic acid (gNA) that specifically targets a sequence of the endogenous gene encoding B2M.
- gNA guide nucleic acid
- the immune cell of embodiment II-53 wherein the gNA comprises a sequence selected from the group of sequences set forth in Table 12, or a sequence having at most 1, 2, 3, or 4 substitutions, insertions or deletions relative thereto.
- the immune cell of embodiment II-42, wherein the MHC Class I gene is HLA-A*03.
- the immune cell of embodiment II-55 further comprising a polynucleotide comprising an interfering RNA, comprising a sequence complementary to a sequence of an HLA-A*03 mRNA.
- 57 57.
- the immune cell of embodiment II-56, wherein the interfering RNA is capable of inducing RNA interference (RNAi)-mediated degradation of the HLA-A*03 mRNA.
- RNAi RNA interference
- shRNA short hairpin RNA
- the immune cell of embodiment II-55 comprising one or more modifications to a sequence of an endogenous gene encoding HLA-A*03, wherein the one or modifications reduce the expression and/or eliminate the function of HLA-A*03.
- 60 The immune cell of embodiment II-59, wherein the one or more modifications comprise one or more inactivating mutations of the endogenous gene encoding HLA-A*03.
- 61 The immune cell of embodiment II-59 or II-60, wherein the one or more inactivating mutations are introduced with a nucleic acid guided endonuclease in a complex with at least one guide nucleic acid (gNA) that specifically targets a sequence of the endogenous gene encoding HLA-A*03.
- gNA guide nucleic acid
- composition of embodiment II-63 further comprising a pharmaceutically acceptable carrier, diluent or excipient.
- a pharmaceutically acceptable carrier for use as a medicament in the treatment of MSLN+ cancer.
- a polynucleotide or polynucleotide system comprising one or more polynucleotides comprising polynucleotide sequences encoding: (a) a first receptor, comprising an extracellular ligand binding domain specific to Mesothelin (MSLN); and (b) a second receptor, comprising an extracellular ligand binding domain specific to HLA-A*03, wherein the first receptor is an activator receptor responsive to MSLN on the MSLN+ cancer cell; and wherein the second receptor is an inhibitory receptor responsive to HLA-A*03. [0743] 69.
- MSLN Mesothelin
- a polynucleotide or polynucleotide system comprising one or more polynucleotides comprising polynucleotide sequences encoding the first receptor and the second receptor for use in generating the immune cells of any one of embodiments II-1-62.
- 70. The polynucleotide or polynucleotide system of embodiment II-66 or II-67, comprising a sequence encoding an shRNA specific to B2M.
- 71 The polynucleotide or polynucleotide system of embodiment II-68, wherein the sequences encoding the first receptor, the second receptor and the shRNA specific to B2M are encoded by the same polynucleotide.
- a vector comprising the one or more polynucleotides of any one of embodiments II-66-70.
- 74 A method of killing a MSLN+ cancer cell having loss of heterozygosity at an HLA-A*03 locus, comprising administering to the subject an effective amount of the immune cell of any one of embodiments II-1-62 or the pharmaceutical composition of any one of embodiments 63-65. [0749] 75.
- a method of treating MSLN+ cancer in a subject having a MSLN+ tumor having loss of heterozygosity at an HLA-A*03 locus comprising administering to the subject an effective amount of the immune cell of any one of embodiments II-1-62 or the pharmaceutical composition of any one of embodiments II-63-65. [0750] 76.
- a method of treating a cancer in a subject comprising: determining HLA-A genotype or expression of normal cells and a plurality of cancer cells of the subject; optionally, determining the expression of MSLN in a plurality of cancer cells of the subject; and administering to the subject an effective amount of the immune cell of any one of embodiments 1-62 or the pharmaceutical composition of any one of embodiments II-63-65 if the normal cells express HLA-A*03 and the plurality of cancer cells do not express HLA-A*03, and the plurality of cancer cells are MSLN-positive. [0751] 77.
- any one of embodiments II-74-76 wherein the cancer comprises mesothelioma cancer, ovarian cancer, cervical cancer, colorectal cancer, esophageal cancer, head and neck cancer, kidney cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancer, colorectal cancer, or cholangiocarcinoma.
- the cancer comprises mesothelioma cancer, ovarian cancer, cervical cancer, colorectal cancer, esophageal cancer, head and neck cancer, kidney cancer, uterine cancer, gastric cancer, pancreatic cancer, lung cancer, colorectal cancer, or cholangiocarcinoma.
- 80 The method of any one of embodiments II-77, wherein the cancer has relapsed in a subject, the cancer is refractory to one or more prior administered anticancer therapies, and/or the cancer is metastatic.
- 81 wherein the cancer has relapsed in a subject, the cancer is refractory to one or more prior administered anti
- a method of making a plurality of immune cells comprising: providing a plurality of immune cells, and transforming the plurality of immune cells with the polynucleotide system of any one of embodiment II-66-70, or the vector of embodiment II-71.
- a kit comprising the immune cell of any one of embodiments II-1-62 or the pharmaceutical composition of any one of embodiments II-63-65.
- the kit of embodiment II-98 further comprising instructions for use.
- Example 1 Identification of Differentially Expressed Blockers
- Candidate blocker targets were identified using a bioinformatics pipeline. In brief, publicly available expression databases, as described below, were searched for genes with loss of expression in tumor versus normal colon tissue. These genes were filtered for membrane proteins, and for expression in the TCGA-MESO dataset (mesothelioma). A diagram of this process is shown in FIG.14.
- Candidate blocker targets are expressed in the mesothelium in healthy tissues, but are not expressed in Mesothelin (MSLN) positive cancers, which include ovarian cancers and pancreatic cancers, and approximately three- quarters of lung and colorectal cancers.
- MSLN Mesothelin
- TCGA Cancer Genome Atlas
- FIG.2 shows RNA expression of MSLN in normal tissues (data from the Genotype-Tissue Expression, GTEx project, gtexportal.org/home).
- Mesothelin is expressed in normal adipose, fallopian tube, lung and salivary gland tissues.
- FIG.5 shows LRRN expression in normal tissues from the GTex portal (www.gtexportal.org/home/), while FIGS.6 and 7 show LRRN4 expression in TCGA samples, and FIG.8 shows LRRN4 expression in CCLE cell lines.
- LRRN4 like MSLN, is highly expressed in adipose and lung tissues. Moreover, LRRN4 has a large extracellular domain that contains multiple leucine rich repeat (LRR) and fibronectin type- III domains (FIG.9).
- LRR leucine rich repeat
- FIG.9 fibronectin type- III domains
- dbSNP a database of single nucleotide polymorphisms that includes human single nucleotide variations and small-scale insertions and deletions along with publication, population frequency, molecular consequence, and genomic mapping information.
- Common variations were defined as having a minor allele frequency (MAF) of greater than or equal to 0.01 in at least one major population and with at least two unrelated individuals having the minor allele in NCBI. MAF of greater than or equal to 0.1 was used as the criterion for common variations.
- Uniprot The Universal Protein Resource
- GTEx The Genotype-Tissue Expression
- TCGA The Cancer Genome Atlas
- CCLE Cancer cell line Encyclopedia
- FPKM Colorectal Cancer
- CDR sequence from antibodies to blocker targets are used to generate scFv using standard molecular biology techniques.
- Candidate scFv are fused to inhibitor receptor hinge or transmembrane domains to generate inhibitory receptors using standard molecular biology techniques.
- Candidate scFv are also fused to activator receptor hinge or transmembrane domains (e.g., CAR) to generate full length activator receptors to use as a positive control for scFv binding to target antigens.
- activator receptor hinge or transmembrane domains e.g., CAR
- the ability of candidate scFv to work in the context of an inhibitory receptor is assayed in Jurkat cells using the NFAT- luciferase reporter assay.
- Example 4 HLA-A*02 Blocker can Block MSLN Activator Mediated Activation of Jurkat Cells
- Cell culture [0784] Jurkat cells encoding an NFAT Luciferase reporter were obtained from BPS Bioscience. In culture, Jurkat cells were maintained in RPMI media supplemented with 10% FBS, 1% Pen/Strep and 0.4mg/mL G418/Geneticin. All other cell lines used in this study were obtained from ATCC, and maintained as suggested by ATCC.
- Jurkat cell transfection [0786] Jurkat cells were transiently transfected via 100uL format Neon electroporation system (Thermo Fisher Scientific) according to manufacturer's protocol using the following settings: 3 pulses, 1500V, 10 msec. Cotransfection was performed with 1-3ug of activator CAR or TCR construct and 1-3ug of blocker constructs or empty vector per 1e6 cells and recovered in RPMI media supplemented with 20% heat-inactivated FBS and 0.1% Pen/Strep.
- Neon electroporation system Thermo Fisher Scientific
- Jurkat-NFAT-luciferase activation studies [0788] Jurkat cells were resuspended in 15uL of RPMI supplemented with 10% heat- inactivated FBS and 0.1% Pen/Strep, added to the peptide-loaded beads and co-cultured for 6 hours. ONE-Step Luciferase Assay System (BPS Bioscience) was used to evaluate Jurkat luminescence. Assays were performed in technical duplicates.
- PBMCs Primary T cell transduction, expansion, and enrichment
- Frozen PBMCs were thawed in 37°C water bath and cultured at 1e6 cells/mL in LymphoONE (Takara) with 1% human serum and activated using 1:100 of T cell TransAct (Miltenyi) supplemented with IL-15 (10ng/mL) and IL-21 (10ng/mL). After 24 hours, lentivirus was added to PBMCs at a MOI of 5. PBMCs were cultured for 2-3 additional days to allow cells to expand under TransAct stimulation. Post expansion, activator and blocker transduced primary T cells were enriched using anti-PE microbeads (Miltenyi) according to manufacturer’s instructions.
- enriched primary T cells were incubated with SiHa or HeLa cells expressing renilla luciferase (Biosettia), and GFP or RFP. Live luciferase-expressing SiHa or HeLa cells were quantified using a Renilla Luciferase Reporter Assay System (Promega). Enriched primary T cells were incubated with SiHa or HeLa (“tumor” cells) or HLA-A*02 transduced SiHa or HeLa cells (“normal” cells).
- WT “tumor” SiHa or HeLa cells stably expressing GFP or RFP and renilla luciferase (Biosettia) or HLA-A*02 “normal” SiHa or HeLa cells stably expressing RFP and luciferase (Biosettia) were imaged together with unlabeled primary T cells using an IncuCyte live cell imager.
- Activation of Jurkat effector cells expressing an MSLN CAR activator and a pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor was assayed using the NFAT Luciferase assay.
- Jurkat cells were transfected with activator:blocker DNA at a ratio of 1:4, and activation was assayed in a cell-free bead based assay (FIG. 10A). Beads were loaded with either activator antigen, or activator and blocker antigens, and the ratio of beads to Jurkat cells was varied. In the cell-free bead based assay, the pMHC HLA-A*02 scFv LIR-1 based inhibitory receptor was able to block activation of the Jurkat cells when cells were contacted with beads carrying the pMHC HLA-A*02 blocker and MSLN activator in cis.
- Presence of the pMHC HLA-A*02 blocker on the beads was able to shift EMAX of MSLN CAR by greater than or equal to 12X (FIG. 10A).
- Activation Jurkat cells transfected with the same activator and blocker at a 1:4 DNA ratio were assayed for activation using the chronic myelogenous leukemia cell line K562.
- K562 expresses MSLN, the activator antigen.
- SiHa and HeLa cells endogenously express MSLN, and were transduced to express the HLA-A*02 inhibitory receptor target.
- Activation of primary effector T cells was assayed by looking at fold induction of IFN ⁇ .
- the pMHC HLA-A*02 LIR-1 inhibitory receptor was able to block activation of primary T cells when the primary T cells were presented with SiHa or HeLa target cells expressing HLA-A*02 (greater than 10X and 5X inhibition, respectively).
- the pMHC HLA-A*02 inhibitory receptor was also able to inhibit killing by T cells expressing both the MSLN scFv CAR and the pMHC HLA-A*02 LIR-1 inhibitory receptor, when the T cells were presented with SiHa cells that expressed MSLN but not HLA-A*02 (FIG.12).
- Example 5 HLA-A*02 Blocker Inhibits MSLN CAR Activators Directed at MSLN Using K562 and HeLa Target Cells
- Cell culture [0799] MSLN CAR activator and HLA-A02 LIR-1 inhibitory receptor were examined, using Jurkat effector cells and K562 target cells (FIG. 15A).
- MSLN CAR T cells expressing MSLN CAR (with two different MSLN ligand binding domains) to kill HeLa cells expressing the blocker target, HLA-A*02, was also assayed (FIGS. 15B-15C).
- the MSLN ligand represents surface antigens that can extend into the realm of 100,000 epitopes/cell.
- the ratio of A to B module expression was varied using different DNA concentrations in transient transfection assays.
- the activator and inhibitory receptor system is flexible enough to accommodate low and high target densities, in principle allowing optimization for pMHC targets as well as non-pMHC surface antigens. [0800]
- Jurkat cells encoding an NFAT luciferase reporter were obtained from BPS Bioscience.
- MSLN antigen binding domains [0802] MSLN-activating CAR scFv were derived from human M5 (LBD1) as described Beatty, et al. WO2015/090230A1 and humanized SS1 (LBD2) as described in BioLuminate, 2019 (BioLuminate, version 3.6, version 3.6 ed. Schrödinger, LLC, New York, NY) and US 6,809,184 B1.
- Jurkat cell transfection and activation [0803] Jurkat cells were transiently transfected via 100uL format Neon electroporation system (Thermo Fisher Scientific) according to manufacturer's protocol using the following settings: 3 pulses, 1500V, 10 msec. Co-transfection was performed with 1-3ug of activator construct and 1-3 ug of blocker constructs or empty vector per 1e6 cells and recovered in RPMI media supplemented with 20% heat-inactivated FBS and 0.1% Pen/Strep.
- Neon electroporation system Thermo Fisher Scientific
- Jurkat cells were stained 18-24 hours post-transfection with 10ug/mL streptavidin-PE-HLA-A*02-pMHC tetramer for 60 minutes at 4°C in PBS with 1% BSA and characterized by flow cytometry (BD FACS Canto II).
- Jurkat cell activation was evaluated using the NFAT-luciferase assay system as described in Example 4.
- Primary T cell transduction, expansion, and enrichment [0806]
- Leukopaks were purchased from AllCells®. Collection protocols and donor informed consent were approved by an Institutional Review Board (IRB), with strict oversight. HIPAA compliance and approved protocols were also followed. Frozen PBMCs were thawed and cultured as described in Example 4.
- PBMCs lentiviral vectors including activator or blocker receptor.
- PBMCs were cultured for 2-3 additional days to allow cells to expand under TransAct stimulation.
- activator and blocker transduced primary T cells were enriched for blocker-positive T cells by positive selection using anti-PE microbeads (Miltenyi) according to manufacturer’s instructions. Briefly, primary T cells were incubated with 10ug/mL streptavidin-PE-HLA-A*02-pMHC tetramer for 60 minutes at 4°C in MACS buffer (0.5% BSA + 2mM EDTA in PBS).
- Target cells were imaged together with unlabeled primary T cells using an IncuCyte live cell imager. Fluorescence intensity of live target cells over time was quantified using IncuCyte imaging software.
- Example 6 Mouse SS1 MSLN Antigen Binding Domain Activator in 2 nd and 3 rd Generation CAR Architectures and HLA-A*02 Blocker [0809] Originally, humanized M5 and SS1 scFv targeting MSLN were used with a third generation CAR architecture (CD28, 4-1BB and CD3 zeta). The effect of using a murine SS1 scFv antigen binding domain, and second generation CAR architecture (4-1BB and CD3zeta intracellular domains) was assayed.
- HLA-A*02- donor T cells were transduced with MSLN third generation CAR activator (a CAR with CD28, 4-1BB and CD3 zeta intracellular domains) and an HLA- A*02 scFv LIR-1 blocker using a PA2.1 antigen binding domain.
- MSLN CAR activators with humanized M5, humanized SS1 and murine SS1 scFv were assayed (Table 1).
- HLA- A*02 blocker sequences are described in Table 5.
- T cells were transduced with activator and/or blocker constructs, cultured, and enriched as described in Examples 4 and 5.
- FIG.16 shows that inhibitor receptors were able to effectively block killing of HeLa cells by T cells expressing the MSLN third generation CAR when the HeLa cells also expressed HLA-A*02. Further, FIG. 16 shows that the murine SS1 generation 3 CAR (upper right plot, boxed) provides a better window than the humanized M5 and humanized SS1 CARs. Note, in FIG.16, C-0883 is an HLA-A*02 CAR used as a positive control, additional sequences are described in Table 19.
- T cells expressing the MSLN activator and HLA-A*02 LIR1 blocker were transduced with activator and/or blocker receptor constructs, cultured, and enriched as described in Examples 4 and 5. T cells were used on day 14 following transduction, and were cultured with Capan target cells at an effector: target ratio of 1:1. Cytotoxicity was assayed as described in Examples 4 and 5.
- FIG.17 shows that inhibitor receptors were able to effectively block killing of Capan cells by T cells expressing the MSLN third generation CAR when the Capan cells also expressed HLA-A*02.
- FIG. 18 shows that killing of MSLN+ HLA-A*02+_HeLa cells, and HCT116 wild type cells (which natively express both MSLN and HLA-A*02) by T cells expressing the mSS12 nd generation CAR was effectively blocked by HLA-A*02 scFv LIR-1 inhibitory receptor.
- the 2 nd generation mSS1 CAR was more effectively blocked by inhibitory receptors with a PA2.1 scFv antigen binding domain than by inhibitory receptors with a BB7.2 scFv antigen binding domain.
- Expression of the 2 nd generation CAR with the murine SS1 scFv was also confirmed via FACS, and the results are shown in FIG. 19.
- the SS1 antigen binding domain was stained using a recombinant soluble MSLN ligand.
- Jurkat cells were transfected with a KRAS TCR activator receptor and/or HLA-A*02 scFv LIR-1 inhibitory receptor (humanized PA2.1 or humanized BB7.2) with a variety of LIR-1 derived hinges, methods as described supra, and co-cultured with T2 target cells that were either HLA-A11 positive, or HA-A11 and HLA-A*02 positive. Inhibitory receptors with both the shorter and longer hinge behaved similarly (FIG. 20A-B). An inhibitory receptor with a mouse PA2.1 scFv and slightly longer hinges was also assayed functioned similarly to shorter LIR-1 hinges in the T2-Jurkat assay (FIG. 21A-B).
- Hinge sequences are shown in black in FIG.20B and FIG.21B, with the gray SS representing a linker between the antigen binding domain and the hinge, and the gray VIGIL the start of the LIR-1 transmembrane domain. Hinge, transmembrane domain and intracellular domain of the inhibitory receptors were all derived from LIR-1.
- FIGS.20A-20B and 21A- 21B show that LIR-1 hinge length can be varied without negatively effecting the LIR-1 inhibitory receptor. Shorter hinges can provide an advantage when packaging nucleic acid sequences encoding LIR-1 inhibitory receptors in lentiviral vectors for delivery.
- Example 8 Mesothelin-specific CAR-T cell therapy that incorporates an HLA- gated safety mechanism selectively kills tumor cells
- MSLN Mesothelin
- Tmod dual-receptor
- T cells engineered with the MSLN CAR Tmod construct described in this example contain: (i) a MSLN-activated CAR; and, (ii) an inhibitory receptor gated by HLA-A*02.
- the Tmod system robustly protects “normal” cells even in mixed-cell populations in vitro and in a xenograft model.
- the MSLN CAR can also be paired with other HLA class I blockers, supporting extension of the approach to patients beyond HLA-A*02 heterozygotes.
- the Tmod mechanism exemplified by the MSLN CAR Tmod construct may provide an alternative route to leverage solid-tumor antigens such as MSLN in safer, more effective ways than previously possible.
- MSLN Mesothelin
- This approach seeks to avoid systemic toxicity to normal tissues by pairing a MSLN-targeted CAR with a LIR-1-based inhibitory receptor that blocks effector function against normal cells that express the HLA-A*02 allele (FIG.22A-22B).
- This dual-receptor construct is intended to treat genetically defined cancer patients who have LOH of the HLA-A*02 allele in their MSLN(+) tumor.
- the difference in HLA-A*02 expression in tumor vs. normal tissues caused by LOH creates an all-or-nothing input to the effector cells that is believed to confer high selectivity for tumor killing.
- RESULTS Isolation and characterization of potent, selective MSLN CARs [0817]
- mammalian surface display libraries encoding either IgG antibodies (mAbs) or scFvs were screened (FIGS. 23A-23B).
- Soluble biotinylated MSLN labeled with fluorochrome were used as probe to enrich for cells in the library that stained for MSLN via FACS.
- a mixture of soluble CEA and EGFR was used to deplete cells encoding mAbs or scFvs with non-specific binding properties.
- the HC-CDRs or VH may be paired with any of the LC-CDRs or VL, as the heavy chains and light chains share similarity, with routine testing to confirm desired expression and binding activity.
- Single chain variable fragments scFvs
- a linker e.g., GGGGSGGGGSGGGGSGG (SEQ ID NO: 152) or another suitable linker
- the light chains have high sequence similarity; pairing of VL and VH to generate full antibodies have been determined without undue experimentation.
- scFvs are provided in Table 1
- illustrative heavy and light chains are provided in Tables 3 and 4
- illustrative CDR sequences are provided in Table 2.
- Sequences of illustrative chimeric antigen receptors using the MSLN scFv are provided as Table 20, below.
- Table 20 Sequences of Receptors comprising single chain variable fragments (scFv)
- CAR1-CAR6 third-generation chimeric antigen receptors
- SS1, M5 and m912 anti-MSLN scFvs from the literature (SS1, M5 and m912) in Jurkat functional assays.
- the CARs displayed a range of sensitivities (EC50) and maximal responses (E max ) (FIG.24A). All constructs were Gen3 except SS1 (Gen2).
- Jurkat cell dose-response was measured to assess the sensitivity in a 6 hour co- culture assay: (1) Titrated MSLN-encoding mRNA was used to transfect HEK293 cells; (2) QIFIKIT (quantitative analysis kit, Agilent®) was used to convert flow-cytometry based surface expression to MSLN molecules/cell; and, (3) The molecule/cell sensitivities (EC50) of 6 novel and three benchmark CARs were calculated from fitting the dose- response curves. For those CARs with sensitivities below the limit of detection of the assay, EC50 was reported as ⁇ 3000 MSLN molecules/cell. Maximum signal (Emax) for each construct was also noted. Experiments were repeated 1-4 times.
- Gen3 CARs All were expressed as Gen3 CARs, with the exception of Gen2 SS1.
- MSLN(+) target cells HEK293 cells transfected with synthetic MSLN mRNA were used.
- the CARs displayed a range of sensitivities (EC 50 ) and maximal responses (E max ) (FIG. 24A).
- E max maximal responses
- binders all but CAR 16 exhibit higher sensitivity than hM5 and sSS1.
- an extensive campaign to identify anti-MSLN binders yielded hundreds of sequences identified in an NGS screen, and 62 candidate constructs were produced, all of which bind MSLN. Six of these shown superior activity.
- CAR 18 and CAR 29 demonstrated superior sensitivity to comparator CAR constructs.
- Emax is related to surface expression of the receptor and EC50 to its binding and signal transduction properties, especially the LBD [15,16].
- the EC50 was converted from relative response measured by luminescence in Jurkat cells to absolute molecules/cell using standard curves and QIFIKIT methodology necessary [27].
- One of the benchmark CARs (m912) displayed low functional sensitivity, with an EC50 estimated at ⁇ 80K molecules/cell.
- the EC50s for the other benchmarks and novel CARs ranged downwards of ⁇ 6K molecules/cell.
- Several novel LBDs assayed as CARs in Jurkat cells had EC50s below the limit of detection ( ⁇ 3K molecules/cell).
- CAR3 and the benchmark M5 were tested for responsiveness to a panel of MSLN(+) and (-) cell lines. Both CARs displayed MSLN-specific activation and were inactive against MSLN(-) lines (FIG.24B and 25A). MSLN Tmod constructs are blocked efficiently by HLA-A*02 antigen in Jurkat and primary T cells [0826] CAR1-6 and the benchmark CARs were tested as components of Tmod constructs where the CARs were paired with an A*02-directed inhibitory receptor or “blocker” previously shown to inhibit functional response in Jurkat and primary T cells [18].
- This blocker comprised an A*02-binding scFv fused to the hinge, transmembrane and intracellular domains of the ITIM-containing LIR-1 protein (FIG.22B).
- the MSLN CAR3 Tmod construct was examined in detail in a series of quantitative mRNA titration experiments for activation and blocking sensitivity in Jurkat cells (FIG.27B and 27C).
- the cervical carcinoma HeLa cell line that, like most other cancer lines, expresses endogenous MSLN was used. This line is HLA- A*02(-).
- mRNA titration experiments enabled estimation of EC 50 and IC 50 for the MSLN CAR3 Tmod construct and these parameters were viewed in the context of the expression levels of antigens on normal and tumor tissues derived from high-quality public databases (FIG.28A).
- Target cells were HeLa cells and variants: (i) native MSLN(+)A*02(-) HeLa cells modeled tumor cells without blocker antigen; and, (ii) transgenic A*02(+) variant HeLa cells modeled normal mesothelial cells. Combinations of different constructs and target cells demonstrated that all MSLN CAR Tmod constructs kill tumor cells potently and block killing in an A*02-ligand-dependent fashion (FIG. 28B). Two other MSLN CARs from the literature (SS1 and M5) were used for comparison (FIG. 29A). Cytotoxicity was mirrored by IFN- ⁇ release (FIG. 29B) and T cell activation (FIG.29C).
- the Tmod constructs composed of an HLA-A*02-directed blocker and different MSLN CAR activators displayed high potency and specificity for MSLN(+)A*02(-) target cells in both Jurkat and primary T cell assays.
- the MSLN CAR3 Tmod construct mediates selective, reversible cytotoxicity in mixed-cell and serial cultures [0830] A variety of other properties of the MSLN CAR3 Tmod construct important in the context of cancer cell therapy were tested.
- the construct mediated antigen-selective cytotoxicity in mixed cultures of tumor and normal target cells Native MSLN(+)HLA- A*02(-) HeLa cells labeled with RFP were mixed at different ratios with MSLN(+)A*02(+) cells labeled with GFP. These cocultures were exposed to T cells engineered with different receptor constructs and imaged. Whereas CAR-only constructs killed indiscriminately, the Tmod constructs killed the native HeLa tumor cells only, leaving the A*02(+) cells unharmed (FIG.30A). Selectivity was detectable even at normal:tumor cell ratios of 9:1 (FIG.30B, FIGs.31A and 31B).
- Tmod cells The capacity of Tmod cells to switch between ON (active killing) and OFF (blocked) states was examined using cytotoxicity assays as readout. In these experiments the transduced T cells were transferred from one batch of target cells to another (FIG. 32A, FIG.33A,). The Tmod cells displayed the capacity to activate and kill after being exposed for 2 days to normal cells where they were quiescent. The reverse was also true. Tmod cells engaged in killing tumor cells were able to quickly switch to the OFF state and refrain from killing the normal cells after transfer and without a rest period. The ability to switch states was maintained through two cycles, over a total of four days.
- MSLN CAR3 Tmod mediates selective, reversible cytotoxicity in mixed cultures of tumor and normal cells and is unaffected by sMSLN at levels observed in some cancer patients’ blood. All of these features are consistent with a cell therapy that has the potential to be safe and efficacious in selected cancer patients.
- MSLN CAR3 Tmod cells display no detectable off-target activity [0834]
- MSLN CAR3 Tmod construct mediates selective killing of tumor cells in a xenograft model [0835] To examine behavior of MSLN CAR3 Tmod cells in vivo, a mouse xenograft model was used. HeLa cells did not grow well in the immunocompromised (NSG) mice, so another cervical cancer cell line, MS751, was developed as grafted target cells.
- NSG immunocompromised
- MSLN(+)A*02(-) MS751 cells generated by CRISPR knockout of HLA-A*02, modeled tumor while the MSLN(+)A*02(+) transgenic variant modeled normal cells in these in vivo experiments.
- the cell lines were engineered with luciferase to enable bioluminescence as an independent readout of tumor survival and growth. Mice (10/cohort) were implanted with tumor cells on their left flank and normal cells on their right flank in half of the mice in each cohort, and vice versa in the other half to control for flank growth variation (FIG. 34A).
- mice were infused via tail vein with 2E7 total T cells/mouse.
- both the CARs and the Tmod constructs killed the MSLN(+)A*02(-) tumor cells equally well measured by caliper and bioluminescence intensity (FIGs. 34B and 34C, FIGs.35B and 35C).
- Tmod cells killed only the tumor grafts, mirroring in vitro cytotoxicity (FIG.14A).
- the normal cell grafts grew comparably to those in the control groups treated with untransduced T cells or saline.
- MSLN CAR3 Tmod construct may be suitable for allogeneic cell therapy and autologous products, provided that a method is employed to reduce expression of A*02 in the patient’s T cells.
- the MSLN CAR3 can be paired with an HLA-A*11-directed blocker [0839]
- the impressive performance of the MSLN CAR3 Tmod construct that utilizes an A*02-directed blocker suggested the possibility that CAR3 might be paired with blockers gated by other HLA class I alleles.
- the properties of the A*02 blocker described here suggest it will inhibit activation signals that arise from the CAR across a broad range of MSLN antigen levels. It is also likely that the blocker will inhibit other sources of T cell activation triggered by the CAR, including off-target. Because the HLA blocker antigen is ubiquitously expressed in nucleated cells, it should provide an inhibitory signal under all circumstances except when the blocker antigen is absent as in tumors selected for LOH. The blocker may also prevent cytokine-release syndrome, a continuing source of toxicity observed for T cell therapies [14, 33], if the stimulus involves normal cells or cell fragments.
- the MSLN therapeutic candidate described here requires selection of patients who are germline heterozygous for the blocker-antigen allele and whose tumors have lost this allele via LOH. Fortunately, such diagnostic tests have been developed recently which utilize the enormous power of DNA sequencing technology [27-29]. DNA- sequence-based LOH detection has sufficient sensitivity to distinguish most cases of clonal vs. subclonal LOH in the tumor, thereby enriching for patients most likely to benefit from the therapy. Because this diagnostic method utilizes genome sequence from the tumor, it detects any allelic variation and is not restricted to HLA-A*02. The lead MSLN Tmod construct described here is applicable to a subset of HLA-A*02(+) patients.
- the MSLN CAR3 activator can be paired with blockers directed at 3 other HLA-I allelic products including HLA-A*11.
- A*11 is the most frequent HLA-I allele in most Asian populations and represents a significant opportunity for benefit in parts of the world beyond the US. Indeed, with a collection of blockers directed at 6-8 of the most common HLA-I alleles in the world, it should be possible to cover the large majority of solid tumors that harbor LOH at the HLA locus—estimated to be >15% of solid-tumor mortality at present [22, 30].
- the HLA-A*02 blocker can be paired effectively with other activators including a CAR directed at another well-known tumor-associated antigen, CEA (Sandberg et al., in preparation; 31).
- CEA tumor-associated antigen
- the modular Tmod system leverages the capacity of cells—unique among therapeutic modalities—to integrate multiple signals into a coordinated response and thus offers a means to address the fundamental obstacles of solid-tumor therapy [18, 21, 22]. Therapeutics must access the tumor and overcome barriers that do not exist for blood cancers where cell therapies have proven effective [23].
- T cells have an advantage over most other modalities, including antibodies, in that they possess a natural mechanism for active extravasation and biodistribution (see for review Mastrogiovanni et al. [24]). Furthermore, the Tmod approach described here that exploits LOH mitigates the key constraint on solid-tumor therapeutics posed by normal tissue expression of most targets. Though notoriously non-homogeneous, a large proportion of genetic alterations arise in the founding cell of the neoplasm and are present in all its descendants [25]. Such homogeneous mutations include LOH and, if such clonal LOH can be distinguished via a diagnostic test from later alterations present in tumors, LOH heterogeneity at the HLA locus should not constitute a source of resistance [26].
- LOH is an irreversible event and should be stable even after strong selective pressure is applied via therapy.
- rates of HLA-I loss will likely increase, further expanding the pool of patients who may benefit from MSLN Tmod therapeutics [34].
- PBMCs peripheral blood mononuclear cells
- Activating and blocking CAR constructs were designed and constructed as previously described 9 . Briefly, activating CARs were created by fusing the anti-MSLN scFv LBDs to the CD8 ⁇ hinge, CD28 transmembrane (TM), and CD28, 4-1BB and CD3 ⁇ intracellular domains (ICD).
- Blocking CARs were generated by fusing the anti-HLA- A*02, A*03 or B*07 scFv LBDs derived from monoclonal antibodies PA2.1 [32], GAP A3 [36] (SEQ ID NO: 1259) or BB7.1 [37] (SEQ ID NO: 1257), respectively, to the hinge, TM and ICD domains of LIR-1. Gene segments were combined using Golden Gate cloning and inserted downstream of a human EF1 ⁇ promoter in a lentiviral expression vector. [0846] For messenger RNA (mRNA) preparation, PCR was used to generate the DNA template used for in vitro synthesis mRNA.
- mRNA messenger RNA
- T7 promoter was introduced via N-terminal primer and common overhang regions were used for both N- and C-terminal primers.
- the PCR product was used as a template for in vitro transcription (IVT) using the T7 ARCA mRNA kit (New England Biolabs, E2060S).
- the IVT reaction comprised 1x ARCA/NTP mix, 1.25 mM ⁇ -UTP (TriLink), 25 ug PCR product template, and 1x T7 RNA polymerase.
- the IVT reaction was incubated at 37 oC for 2 h, then 2 uL of DNase I (New England Biolabs, M0303S) was added to each reaction and incubated at 37 oC for 15 min.
- soluble MSLN catalog #MSN-H82E9
- irrelevant, off-target proteins EGFR and CEA
- FACS fluorescence-activated cell sorting
- the HLA-A*11 binder generation campaign was similarly conducted.
- the HuTARG library was subjected to on-target enrichment using HLA-A*11:01 tetramer and off-target depletion using a pool of 4 unrelated HLA class I tetramers.
- on- and off-target binding cells were collected, and RNA was reverse transcribed into cDNA.
- CDRs complementarity determining regions
- PCR polymerase chain reaction
- NGS next-generation sequencing
- Binders of interest were selected by comparing the input and output NGS counts.
- MSLN surface quantification [0848] To quantify surface mesothelin molecules, adherent cells were first washed once with DPBS then once with Versene. Cells were coated with Versene and incubated at 37 oC for ⁇ 15 min. After incubation, flasks were tapped vigorously to promote complete detachment. The cells were then diluted with DBPS at 1:2 ratio (Versene:DPBS) and counted.300,000 cells were centrifuged at 500 xg for 5 min.
- the mixture was washed with 100 uL FACS buffer twice, then stained with 100 uL of anti-mouse F(ab’)2-Goat Alexa Fluor 647 (Invitrogen) antibody diluted 2000x in FACS buffer for 45 min on ice.
- the stained cells and beads were washed 2x with 100 uL FACS buffer, then resuspended in 100 uL FACS buffer to measure fluorescence.
- the calibration curve plotting median fluorescence intensity of each bead population vs. number of molecules was plotted according to manufacturer’s protocol provided by the QIFIKIT (Agilent). The number of endogenous MSLN molecules was determined by fitting the cell’s median fluorescence intensity onto the calibration curve generated with the QIFIKIT beads.
- MSLN activator and various blocker sensitivity determination [0849] To determine activator or blocker sensitivities, antigen was titrated into antigen(-) cell lines at various concentrations. Flow cytometry and QIFIKIT methodology [17] using standard curves could then be used to calculate absolute molecules/cell. The EC50 or IC50 value of activators or blockers, respectively, expressed in Jurkat cells was then measured by luminescence. Specifically, HEK293T or HeLa cell transfection with antigen mRNA was performed using the 4D nucleofection kit (Lonza).
- mRNA was diluted to 1000 ng/uL in SE or SF buffer supplemented with Supplement solution (complete buffer) for HEK293T or HeLa cells respectively.
- the diluted mRNA was serially diluted 2x by adding stock mRNA to equal volumes of complete buffer 13 times, with the 15 th well lacking any added mRNA.
- Target cells were detached from the flask using TrypLE Express (Gibco). Appropriate number of cells were harvested then resuspended in complete buffer at 11.1e6 viable cells/mL.
- Jurkat-NFAT luciferase effector cells were transfected with appropriate CAR DNA at 1 ug per 1e6 cells or CAR Tmod DNA (single vector construct, unless otherwise noted) at 4 ug per 1e6 cells using the Neon electroporation system using the following parameters: 1500 V, 10 ms, 3 pulses. Transfected cells were immediately transferred to pre-warmed RPMI supplemented with 20% heat-inactivated (HIA) FBS and 0.1% pen/strep and incubated for 18-24 h at 37 °C, 5% CO2.
- HAA heat-inactivated
- Jurkat cells were counted and resuspended in RPMI + 10% HIA FBS and 0.1% pen/strep at 0.67e6 cells per mL. 1e4 resuspended Jurkat cells in 15 uL were then co- cultured with transfected cells in the 384-well plate for 6 h. Luciferase activity was measured using ONE-Step Luciferase Assay System (BPS Bioscience). [0850] For target cell co-transfections including MSLN and HLA-A*02 the protocol above was used except for minor adjustments to the mRNA dilutions step. mRNA encoding HLA-A*02 and MSLN were prepared by Aldevron and TriLink respectively.
- a 14-point 2x serial dilution was performed with MSLN mRNA. This serial dilution was combined with each of four dilutions of various constant amounts of A*02 mRNA so that the top concentration of MSLN mRNA was 500 ng/ul and the A*02 mRNA concentrations were as follows: 500 ng/uL, 25 ng/ul, 1.25 ng/uL, and 0 ng/uL.
- a 14-point 2x serial dilution was performed with A*02 mRNA.
- target cells were plated in 25 uL complete LymphoOne media (containing 1% HIA human AB serum) per well in a black, clear-bottom 384-well plate and allowed to adhere overnight at 37 oC with 5% CO2.
- complete LymphoOne media containing 1% HIA human AB serum
- target cells were pre-mixed at the desired ratios prior to seeding.
- E:T effective effector:target
- T cells were resuspended in LymphoOne media containing 1000 ng/mL (2x) soluble, monomeric MSLN (Acro Biosystems) for a final concentration of 500 ng/mL upon plating with target cells. Each sample was tested in triplicate wells.
- cytotoxicity assays were performed as described above, using HeLa target cells that express native levels of MSLN and transgenic HLA-A*11 antigen.
- the T cell containing media in each well was mixed and transferred to a v- bottom plate and spun down at 400 xg for 5 min. Supernatants were collected and frozen until further analysis for secreted IFN- ⁇ using a BD Human IFN- ⁇ flex kit as per manufacturer’s instructions. Remaining T cells were then stained for human CD3, washed, and characterized for forward and side scatter by flow cytometry [35].
- RACA Repeat antigen-challenge assay
- MSLN knockout cell line generation [0855] To develop MSLN(-) cell line controls for endogenous MSLN(+) cell lines, a CRISPR strategy to target full-length MSLN was utilized.
- Two Alt-R CRISPR-Cas9 sgRNAs targeting different exons of mesothelin were obtained from Integrated DNA Technologies (IDT), with sgRNA_1 targeting exon 2, and sgRNA_2 targeting exon 16.
- the sgRNAs were rehydrated in nuclease-free water and combined with Alt-R® S.p. HiFi Cas9 Nuclease V3 (IDT) to yield a 9:1 sgRNA:Cas9 mole ratio.
- Both RNP solutions were incubated at room temperature for 10-20 min separately to allow each of the guides to complex with Cas9 independently. The RNP complexes of both guides were subsequently combined, added to the desired cells as per the manufacturer’s instructions, and electroporated.
- MSLN(-) population R&D, anti-MSLN pAb or clone #618923.
- Bulk-sorted MSLN(-) cells were then screened against MSLN binders in Jurkat cell-based assays. Selectivity screening using Jurkat cells [0856] To explore off-target reactivity of MSLN CAR3 Tmod cells, Jurkat cell activation was tested against a diverse panel of target cell lines chosen to encompass the large majority of adult gene expression similarly as described elsewhere (Wang et al., in preparation).
- mice (10/cohort) were implanted subcutaneously with 5e6 MS751 firefly luciferase(+) HLA-A KO tumor or renilla luciferase(+) A*02 transgenic normal cells mixed 1:1 with Matrigel in 100 uL on their right and left flanks, respectively, in half of the mice in each cohort, and vice versa in the other half to control for flank growth variation.
- Transductions were performed 24 h post-activation using lentivirus (Alstem) at MOI 10.
- 24 h post- transduction primary T cells were transfected with CRISPR-Cas9:sgRNA complexes. Briefly, cells were collected and washed with PBS before resuspending in supplemented P3 nucleofection buffer (Lonza).
- PBMCs were cultured and expanded in LymphoONE Tcell Expansion Medium (Takara Bio) supplemented with 1% HIA human AB serum and 300 IU/mL IL-2 for 6 days.
- Post expansion, positively transduced primary T cells were enriched using anti-PE microbeads (Miltenyi) according to manufacturer’s instructions against Protein L- biotin:streptavidin-PE using LS column. Cytotoxicity of B2M KO primary T cells was then assessed exactly as described above.
- Statistical analysis [0859] Statistical analyses were performed using GraphPad Prism software.
- FIG.41 shows the characterization of MSLN CAR A*03 Tmod constructs in Jurkat cell functional assays (left).
- MSLN activator CAR SEQ ID NO: 303
- A*03 blocker mBA GAP-A3, SEQ ID NO: 1268
- open circles or empty vector control (open circles).
- Jurkat NFAT luciferase cells expressing the CAR +/- blocker were co-cultured with wild-type, endogenous MSLN(+) HeLa cells transfected with a titration of A*03:01 mRNA.
- FIG.42 shows the functional characterization of MSLN CAR A*03 Tmod constructs (mBAsh GAP-A3, SEQ ID NO: 1268 plus ⁇ 2M shRNA) in primary T cells from 5 different donors on MS751 target cells.
- MS751 tumor cells express the MSLN antigen.
- MS751 normal cells express both MSLN and A*03 antigens.
- FIG.43 shows the functional characterization of MSLN CAR A*03 Tmod constructs (mBAsh GAP-A3, SEQ ID NO: 1268 plus ⁇ 2M shRNA) in primary T cells from 5 different donors on HeLa target cells.
- HeLa tumor cells express the MSLN antigen.
- HeLa normal cells express both MSLN and A*03 antigens.
- the selectivity window between tumor cells versus. normal cells for each donor is indicated in the table.
- FIG.44A and FIG.44B show the Tmod construct (mBAsh(A3), SEQ ID NO: 1268 plus ⁇ 2M shRNA) mediates selective killing of tumor cells in a xenograft model.
- FIG. 44A shows a schematic diagram of the dual-flank tumor and normal MS751 xenograft model.
- FIG.44B shows xenograft sizes assessed by caliper measurements.
- Day 0 xenograft injection.
- Horizontal dashed line indicated time of T cell injection.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Epidemiology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3243381A CA3243381A1 (en) | 2022-01-28 | 2023-01-27 | COMPOSITIONS AND METHODS OF TREATMENT OF MESOTHELINE-POSITIVE CANCERS |
| IL314114A IL314114A (en) | 2022-01-28 | 2023-01-27 | Compositions and methods for the treatment of mesothelin-positive types of cancer |
| EP23747631.2A EP4469559A4 (en) | 2022-01-28 | 2023-01-27 | COMPOSITIONS AND METHODS OF TREATMENT OF MESOTHELINE-POSITIVE CANCERS |
| AU2023213691A AU2023213691A1 (en) | 2022-01-28 | 2023-01-27 | Compositions and methods for treating mesothelin positive cancers |
| MX2024009338A MX2024009338A (es) | 2022-01-28 | 2023-01-27 | Composiciones y metodos para tratamiento de canceres positivos a mesotelina. |
| CN202380031880.6A CN119403921A (zh) | 2022-01-28 | 2023-01-27 | 用于治疗间皮素阳性癌症的组合物和方法 |
| KR1020247028607A KR20240155391A (ko) | 2022-01-28 | 2023-01-27 | 메소텔린 양성 암을 치료하기 위한 조성물 및 방법 |
| US18/833,321 US20250269027A1 (en) | 2022-01-28 | 2023-01-27 | Compositions and methods for treating mesothelin positive cancers |
| JP2024544442A JP2025503967A (ja) | 2022-01-28 | 2023-01-27 | メソテリン陽性がんを処置するための組成物及び方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202263304409P | 2022-01-28 | 2022-01-28 | |
| US63/304,409 | 2022-01-28 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023147019A2 true WO2023147019A2 (en) | 2023-08-03 |
| WO2023147019A3 WO2023147019A3 (en) | 2023-09-14 |
Family
ID=87472570
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2023/011698 Ceased WO2023147019A2 (en) | 2022-01-28 | 2023-01-27 | Compositions and methods for treating mesothelin positive cancers |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20250269027A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4469559A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2025503967A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240155391A (cg-RX-API-DMAC7.html) |
| CN (1) | CN119403921A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2023213691A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3243381A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL314114A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024009338A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023147019A2 (cg-RX-API-DMAC7.html) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025030141A1 (en) * | 2023-08-02 | 2025-02-06 | A2 Biotherapeutics, Inc. | Compositions and methods for treating cancers with hla-a*03 loss of expression |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN109504696A (zh) * | 2017-09-15 | 2019-03-22 | 上海恒润达生生物科技有限公司 | 靶向人源化mesothelin的嵌合抗原受体的方法和用途 |
| BR112021006100A2 (pt) * | 2018-09-28 | 2021-07-20 | Immpact-Bio Ltd. | métodos para identificação de pares de receptor de antígeno ativador (acar)/receptor de antígeno quimérico inibitório (icar) para uso em terapias de câncer |
| CA3132458A1 (en) * | 2019-03-15 | 2020-09-24 | Rutgers, The State University Of New Jersey | Cd147 chimeric antigen receptors and methods of use |
| SG11202112676VA (en) * | 2019-05-16 | 2021-12-30 | Memorial Sloan Kettering Cancer Center | Mesothelin cars and uses thereof |
| MX2022001711A (es) * | 2019-08-09 | 2022-05-10 | A2 Biotherapeutics Inc | Receptores en la superficie celular que responden a la perdida de heterocigosidad. |
| CN115052887B (zh) * | 2019-12-11 | 2026-03-31 | A2生物治疗公司 | 基于lilrb1的嵌合抗原受体 |
| IL300500A (en) * | 2020-08-20 | 2023-04-01 | A2 Biotherapeutics Inc | Preparations and methods for the treatment of mesothelin positive cancer |
-
2023
- 2023-01-27 AU AU2023213691A patent/AU2023213691A1/en active Pending
- 2023-01-27 WO PCT/US2023/011698 patent/WO2023147019A2/en not_active Ceased
- 2023-01-27 US US18/833,321 patent/US20250269027A1/en active Pending
- 2023-01-27 EP EP23747631.2A patent/EP4469559A4/en active Pending
- 2023-01-27 JP JP2024544442A patent/JP2025503967A/ja active Pending
- 2023-01-27 CN CN202380031880.6A patent/CN119403921A/zh active Pending
- 2023-01-27 IL IL314114A patent/IL314114A/en unknown
- 2023-01-27 KR KR1020247028607A patent/KR20240155391A/ko active Pending
- 2023-01-27 MX MX2024009338A patent/MX2024009338A/es unknown
- 2023-01-27 CA CA3243381A patent/CA3243381A1/en active Pending
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025030141A1 (en) * | 2023-08-02 | 2025-02-06 | A2 Biotherapeutics, Inc. | Compositions and methods for treating cancers with hla-a*03 loss of expression |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2025503967A (ja) | 2025-02-06 |
| WO2023147019A3 (en) | 2023-09-14 |
| EP4469559A2 (en) | 2024-12-04 |
| AU2023213691A1 (en) | 2024-09-05 |
| EP4469559A4 (en) | 2025-12-03 |
| IL314114A (en) | 2024-09-01 |
| CA3243381A1 (en) | 2023-08-03 |
| MX2024009338A (es) | 2024-08-09 |
| KR20240155391A (ko) | 2024-10-28 |
| US20250269027A1 (en) | 2025-08-28 |
| CN119403921A (zh) | 2025-02-07 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11602543B2 (en) | Compositions and methods for treating mesothelin positive cancers | |
| US12435124B2 (en) | Compositions and methods for treating CEACAM positive cancers | |
| EP4058474B1 (en) | Compositions and methods for treating egfr positive cancers | |
| US11730764B2 (en) | Compositions and methods for treating HER2 positive cancers | |
| WO2022040470A1 (en) | Compositions and methods for treating ceacam positive cancers | |
| US20250269027A1 (en) | Compositions and methods for treating mesothelin positive cancers | |
| CN116635043A (zh) | 用于治疗egfr阳性癌症的组合物和方法 | |
| US20250177445A1 (en) | Engineered receptors specific to hla-e and methods of use | |
| CN116761817A (zh) | 用于治疗间皮素阳性癌症的组合物和方法 | |
| HK40080722B (en) | Compositions and methods for treating egfr positive cancers | |
| HK40080722A (en) | Compositions and methods for treating egfr positive cancers | |
| WO2025030141A1 (en) | Compositions and methods for treating cancers with hla-a*03 loss of expression |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23747631 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 314114 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024544442 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2024/009338 Country of ref document: MX |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024015203 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU23213691 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023747631 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2023213691 Country of ref document: AU Date of ref document: 20230127 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2023747631 Country of ref document: EP Effective date: 20240828 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202380031880.6 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23747631 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112024015203 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240724 |
|
| WWP | Wipo information: published in national office |
Ref document number: 202380031880.6 Country of ref document: CN |
|
| WWP | Wipo information: published in national office |
Ref document number: 18833321 Country of ref document: US |