WO2023141302A1 - Musk-targeting oligonucleotides - Google Patents

Musk-targeting oligonucleotides Download PDF

Info

Publication number
WO2023141302A1
WO2023141302A1 PCT/US2023/011286 US2023011286W WO2023141302A1 WO 2023141302 A1 WO2023141302 A1 WO 2023141302A1 US 2023011286 W US2023011286 W US 2023011286W WO 2023141302 A1 WO2023141302 A1 WO 2023141302A1
Authority
WO
WIPO (PCT)
Prior art keywords
musk
composition
seq
exons
level
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2023/011286
Other languages
English (en)
French (fr)
Inventor
John Page
Anne VALAT
Sudhir Agrawal
Duncan Brown
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Bolden Therapeutics Inc
Original Assignee
Bolden Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Bolden Therapeutics Inc filed Critical Bolden Therapeutics Inc
Priority to CA3248917A priority Critical patent/CA3248917A1/en
Priority to US18/730,084 priority patent/US20250257359A1/en
Priority to EP23743785.0A priority patent/EP4466360A4/en
Priority to JP2024543383A priority patent/JP2025503098A/ja
Priority to AU2023210230A priority patent/AU2023210230A1/en
Publication of WO2023141302A1 publication Critical patent/WO2023141302A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7115Nucleic acids or oligonucleotides having modified bases, i.e. other than adenine, guanine, cytosine, uracil or thymine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/712Nucleic acids or oligonucleotides having modified sugars, i.e. other than ribose or 2'-deoxyribose
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7125Nucleic acids or oligonucleotides having modified internucleoside linkage, i.e. other than 3'-5' phosphodiesters
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/713Double-stranded nucleic acids or oligonucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y207/00Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/10Protein-tyrosine kinases (2.7.10)
    • C12Y207/10001Receptor protein-tyrosine kinase (2.7.10.1)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/313Phosphorodithioates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/31Chemical structure of the backbone
    • C12N2310/315Phosphorothioates
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/30Chemical structure
    • C12N2310/32Chemical structure of the sugar
    • C12N2310/3212'-O-R Modification
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/10Applications; Uses in screening processes
    • C12N2320/11Applications; Uses in screening processes for the determination of target sites, i.e. of active nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2320/00Applications; Uses
    • C12N2320/30Special therapeutic applications
    • C12N2320/33Alteration of splicing

Definitions

  • Satellite cells In mature muscle tissue, satellite cells constitute a small, scattered population of mitotically and physiologically quiescent cells. Satellite cells are also implicated in normal muscle growth and maintenance throughout life, indicating that they could be exploited to treat muscle wasting conditions.
  • Skeletal muscle makes up about 35% of body weight and is essential for metabolism, locomotion, and breathing, which highlights its importance in human health. Muscle wasting reduces mobility, metabolism, and quality of life for the majority of cancer patients, elderly patients, and many others with no history of neuromuscular dysfunction. In addition, muscular dystrophies are an often fatal group of genetic diseases leading to severe muscle loss, including Duchenne Muscular Dystrophy which affects children.
  • Neurogenesis and muscle regeneration are dependent on neural stem cells (NSCs) and muscle satellite cells.
  • the present disclosure provides an insight that presence and/or activity of a particular form(s) of the muscle-specific tyrosine kinase (MuSK) protein, specifically lacking a functional Ig3 domain, may achieve or contribute to beneficial biological events including, for example, neurogenesis and/or muscle regeneration.
  • MoSK muscle-specific tyrosine kinase
  • the present disclosure provides certain technologies for enhancing neurogenesis, including in particular in adult humans.
  • technologies provided herein may be useful in medicine, including specifically treatment of diseases, disorders or conditions associated with neurodegeneration, or otherwise with low or reduced neuronal activity (e.g., neuronal activity in an adult hippocampus and/or in subventricular zone(s)).
  • technologies provided herein may be useful in the treatment of one or more of Alzheimer’s Disease (AD), Parkinson’s disease, dementia (e.g., Frontotemporal dementia), stroke, Major Depressive Disorder (MDD), bipolar disorder, Schizophrenia, Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking), Temporal-Lobe Epilepsy, Hippocampal Sclerosis, Niemann Pick Type C, Diabetes-mediated hippocampal neuronal loss, brain injury (e.g., traumatic and/or anoxic brain injury), and Huntington’s disease.
  • AD Alzheimer’s Disease
  • Parkinson’s disease dementia
  • dementia e.g., Frontotemporal dementia
  • stroke e.g., Frontotemporal dementia
  • MDD Major Depressive Disorder
  • MDD bipolar disorder
  • Schizophrenia e.g., Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking
  • Bone morphogenetic protein (BMP) signaling regulates at least two important NSC decision points: 1) quiescence, where proliferating stem cells exit the cell cycle and return to replenish a reserve pool that can supply fresh stem cells; and; 2) differentiation into mature progeny (Mira et al., 2010).
  • BMP bone morphogenetic protein
  • the present disclosure contemplates that manipulating the BMP pathway in NSCs is an attractive target for regulating neurogenesis in the adult brain. Additionally, BMP signaling regulates skeletal muscle stem cell activity in both normal and pathological states.
  • the present disclosure provides technologies for increasing level and/or activity of MuSK form(s) that functionally participate in neurogenesis and/or muscle regeneration, including, in some embodiments, by reducing alternative splicing that would otherwise generate MuSK form(s) that do not so participate.
  • such increase is in a relevant tissue such as muscle.
  • a tissues such as a brain tissue (e.g., hippocampal and/or subventricular) and/or lung tissue.
  • the present disclosure provides an insight that presence and/or activity of a particular form(s) of the muscle-specific tyrosine kinase (MuSK) protein, specifically lacking a functional Ig3 domain, may achieve or contribute to neurogenesis in adult humans, or otherwise provide neurological benefit(s).
  • the MuSK transcript can be alternatively spliced, including to generate at least one form (i.e., ⁇ Ig3-MuSK) that lacks the Ig3 domain.
  • the present disclosure appreciates that increasing presence and/or level of ⁇ Ig3- MuSK, and/or of other functional form(s) in which its Ig3 domain is altered (e.g., mutated, blocked, etc.) or removed, may provide benefits as described herein. [0010] In some embodiments, the present disclosure provides technologies for increasing level and/or activity of one or more forms of MuSK whose Ig3 domain is altered (e.g., mutated, blocked, removed, etc.) for example so that it fails to effectively participate in interaction(s) with BMP.
  • the present disclosure provides technologies for reducing Ig3 + MuSK, for example by reducing level and/or activity of one or more forms of MuSK whose Ig3 domain effectively participates in interaction(s) with BMP.
  • an agent that targets the MuSK Ig3 domain, as described herein e.g., a MuSK-targeting oligonucleotide
  • level and/or activity of a MuSK/BMP complex is useful in contexts of neurogenesis and/or muscle regeneration and/or of muscle growth.
  • provided agent(s) may enhance muscle growth.
  • muscle growth occurs in uninjured tissue.
  • muscle growth occurs in injured tissue.
  • enhanced and/or increased muscle growth is determined by a decrease in satellite cell number and/or increase in muscle fiber size.
  • muscle growth can be characterized by a decrease in satellite cell number and/or increase in muscle fiber size, which is indicative of satellite cells differentiating and fusing into/augmenting existing muscle fibers and forming new muscle fibers.
  • Embodiments of the present invention provide methods of enhancing neurogenesis and/or muscle regeneration and/or growth, for example in a subject in need thereof, by administering a composition that downregulates MuSK Ig3 domain protein expression, MuSK Ig3 domain gene expression, and/or MuSK Ig3 activation of BMP signaling, thereby upregulating muscle satellite cells which results in enhancement of muscle regeneration and/or growth.
  • such a composition can comprise and/or deliver a MuSK-targeting oligonucleotide (e.g., a MuSK Ig3-targeting exon-skipping oligonucleotide).
  • a MuSK-targeting oligonucleotide e.g., a MuSK Ig3-targeting exon-skipping oligonucleotide.
  • enhancing neurogenesis is used in the context of treating a disease or disorder associated with reduced Adult Hippocampal Neurogenesis (AHN). As AHN occurs throughout life in humans and is dramatically reduced in AD (Moreno-Jimenez et al., 2019; Steiner et al., 2019), the present disclosure provides compositions and methods for promoting AHN, enhancing cognitive function and combating neurodegeneration (e.g., Alzheimer’s disease).
  • enhancing neurogenesis is used in the context of treating a disease or disorder associated with reduced Subventricular Zone Neurogenesis.
  • NSCs reside in the subventricular zone (SVZ) lining the lateral ventricles and generate astrocytes and oligodendrocytes that support the existing circuitry as well as neurons in the olfactory bulb that are critical for olfactory discrimination.
  • the present disclosure provides compositions and methods for compensating for the degeneration of neurons in the SVZ through enhancing endogenous neurogenesis.
  • the present disclosure provides compositions and methods for treating diseases specifically associated with striatal neurogenesis such as Parkinson’s disease (which could benefit both from increasing AHN and striatal neurogenesis in the SVZ; Pitcher et al.2012; Sterling et al.2013) and Huntington’s disease (Sassone et al., 2018).
  • diseases specifically associated with striatal neurogenesis such as Parkinson’s disease (which could benefit both from increasing AHN and striatal neurogenesis in the SVZ; Pitcher et al.2012; Sterling et al.2013) and Huntington’s disease (Sassone et al., 2018).
  • the present disclosure provides compositions and methods for treating other diseases including addiction (e.g., chronic cocaine use and lifelong cigarette smoking).
  • a subject of interest can be at risk of, or afflicted with, a disease or disorder including, but not limited to, neuromuscular dysfunction, neurodegenerative disorder, cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • a subject of interest can be at risk of, or afflicted with a disease or disorder associated with lung damage, including, for example, idiopathic pulmonary fibrosis (IPF), acute respiratory distress syndrome (ARDS), pneumonia, and/or certain infections, including viral infections including coronaviral infections such as COVID19.
  • a disease or disorder including, but not limited to, neuromuscular dysfunction, neurodegenerative disorder, cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • a subject of interest can be at risk of, or afflicted with a disease or disorder associated with lung damage, including, for example, idiopathic pulmonary fibrosis (IPF),
  • Exemplary neuromuscular dysfunctions or disorders that can be treated by technologies of the present invention include, but are not limited to, Becker muscular dystrophy, Congenital muscular dystrophy, Distal muscular dystrophy, Duchenne muscular dystrophy, Emery-Dreifuss muscular dystrophy, Facioscapulohumeral muscular dystrophy, Limb-girdle muscular dystrophy, Myotonic muscular dystrophy, and Oculo-pharyngeal muscular dystrophy.
  • enhancing muscle growth is used in the context of treating a disease or disorder associated with muscle atrophy or muscle wasting.
  • Muscle atrophy or muscle wasting may be observed in connection with various diseases and conditions described herein, such as neuromuscular disorders, or direct or indirectly caused by prolonged inactivity, bed rest, hospitalization, aging, malnutrition, cancer cachexia, chronic inflammatory diseases, etc..
  • Example chronic inflammatory diseases include rheumatoid arthritis, chronic heart failure, and chronic obstructive pulmonary disease (COPD).
  • COPD chronic obstructive pulmonary disease
  • disorders associated with muscle atrophy/wasting include disorders associate with decreased mobility, such as rheumatoid arthritis, osteoarthritis, and injury. (2016 Powers, Scott K., et al. Medicine and science in sports and exercise 48(11): 2307).
  • the present disclosure provides therapies for preventing/treating muscle wasting or muscle atrophy related to or as a result of a number of diseases or conditions described herein.
  • methods of the present invention can also be used when a subject is in need of enhanced muscle regeneration and muscle growth following surgery, trauma and/or prolonged immobilization (e.g., from bed-rest or casting).
  • Embodiments of the present invention also provide methods of preventing or treating neurodegenerative diseases (e.g., AD) and/or muscle fibrosis, e.g., in a subject in need thereof, by administering a composition that downregulates the MuSK Ig3 domain protein expression, the MuSK Ig3 domain gene expression, and/or the MuSK Ig3 activation of BMP signaling.
  • AD neurodegenerative diseases
  • muscle fibrosis e.g., in a subject in need thereof, by administering a composition that downregulates the MuSK Ig3 domain protein expression, the MuSK Ig3 domain gene expression, and/or the MuSK Ig3 activation of BMP signaling.
  • the composition can comprise, e.g., a MuSK-targeting oligonucleotide (e.g., a MuSK Ig3-targeting exon- skipping oligonucleotide).
  • the subject can be at risk of, or afflicted with, various neurodegenerative diseases, such as Alzheimer’s Disease (AD), Parkinson’s disease, dementia (e.g., Frontotemporal dementia), stroke, Major Depressive Disorder (MDD), bipolar disorder, Schizophrenia, Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking), Temporal-Lobe Epilepsy, Hippocampal Sclerosis, Niemann Pick Type C, Diabetes-mediated hippocampal neuronal loss, brain injury (e.g., traumatic and/or anoxic brain injury), and Huntington’s disease or muscle fibrosis resulting from a disease or condition including, but not limited to, trauma, heritable disease, muscle disorder and aging.
  • the trauma can result from, for example, radiation treatment, crush injury, laceration, and amputation.
  • the heritable disease or muscle disorder include, but are not limited to, Congenital Muscular Dystrophy, Duchenne Muscular Dystrophy, Becker’s Muscular Dystrophy; Amyotrophic Lateral Sclerosis (ALS), and age-associate sarcopenia.
  • the present invention features, inter alia, an oligonucleotide composition comprising plurality of oligonucleotides, the oligonucleotide composition being characterized in that, when it is contacted with a MuSK transcript in a transcript splicing system, relative amounts of transcripts that do and do not include Ig3 domain-encoding sequences are altered as compared with such relative amounts observed under reference conditions selected from the group consisting of absence of the composition, presence of a reference composition, and combinations thereof.
  • the oligonucleotides mediate skipping of at least one exon of the MuSK gene.
  • the exon skipping lowers levels of mRNAs encoding MuSK protein form that participate in BMP signaling compared with levels observed absent the exon skipping.
  • the MuSK protein form participating in BMP signaling is or comprises a MuSK protein form that forms a MuSK/BMP complex.
  • the exon skipping reduces the level and/or activity of a MuSK/BMP complex.
  • at least one skipped exon is selected from the group consisting of exons 3, 4, 6, and 7.
  • the relative amounts are amounts of transcripts including exons 6 and 7 relative to those lacking exons 6 and 7.
  • relative amounts are amounts of transcripts including exons 3 and 4 relative to those lacking exons 6 and 7.
  • the alteration comprises skipping one or more of exons 6 and 7 of MuSK. In some embodiments, the alteration comprises skipping one or more of exons 3 and 4 of MuSK. In some embodiments, the alteration comprises skipping one or more of exons 6 and 7 of MuSK, but skipping none of exons 3 and 4 of MuSK.
  • MuSK splicing is altered in that level of MuSK transcripts including exons 6 and 7 is decreased or level of MuSK protein forms including sequences encoded by exons 6 and 7 is decreased, or both.
  • MuSK splicing is altered in that level of MuSK transcripts including exons 3 and 4 is decreased or level of MuSK protein forms including sequences encoded by exons 3 and 4 is decreased, or both. In some embodiments, MuSK splicing is altered in that level of MuSK transcripts including exons 6 and 7 is increased or level of MuSK protein forms including sequences encoded by exons 6 and 7 is increased, or both. In some embodiments, MuSK splicing is altered in that level of MuSK transcripts including exons 3 and 4 is increased or level of MuSK protein forms including sequences encoded by exons 3 and 4 is increased, or both.
  • MuSK splicing is altered in that level of MuSK transcripts including exons 3 and 4 remains substantially unchanged and level of MuSK transcripts including exons 6 and 7 is decreased. In some embodiments, MuSK splicing is altered in that level of MuSK protein forms including sequences encoded by exons 3 and 4 remains substantially unchanged and l level of MuSK protein forms including sequences encoded by exons 6 and 7 is decreased. In some embodiments, MuSK splicing is altered in that total level of MuSK transcripts remained substantially unchanged and level of MuSK transcripts including exons 6 and 7 is decreased.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 10%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 50%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 80%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 100%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 120%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 150%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 180%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 200%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 250%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 300%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 350%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 400%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 450%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 500%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 600%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 700%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 800%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 900%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by about 1000%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is increased by at least 1000%. [0029] In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 10%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 50%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 80%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 100%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 120%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 150%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 180%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 200%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 250%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 300%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 350%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 400%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 450%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 500%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 600%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 700%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 800%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 900%.
  • MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by about 1000%. In some embodiments, MuSK splicing is altered in that ratio of MuSK transcripts including exons 3 and 4 to MuSK transcripts including exons 6 and 7 is decreased by at least 1000%. [0030] In some embodiments, prior to contact with one or more exon-skipping oligonucleotides as described herein, ratio of MuSK transcripts including exons 3 and 4 (i.e., total MuSK transcripts) to MuSK transcripts in a cell or system including exons 6 and 7 is between about 1:1 and 1:0.1.
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 is about 1:1, 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1.
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 is between about 1:0.9 and 1:0.0001.
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 is about 1:0.9, 1:0.8, 1:0.7, 1:0.6, 1:0.5, 1:0.4, 1:0.3, 1:0.2, or 1:0.1, 1:0.05, 1:0.01, 1:0.001, or 1:0001.
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 is between about 1:0.9 and 1:0.8, 1:08 and 1:0.7, 1:0.7 and 1:0.6, 1:0.6 and 1:0.5, 1:0.5 and 1:0.4, 1:0.4 and 1:0.3, 1:0.3 and 1:0.2, 1:0.2 and 1:0.1, 1:0.1 and 1:0.05, 1:0.05 and 1:0.01, 1:0.01 and 1:0.001, or 1:0.001 and 1:0001.
  • ratio of MuSK transcripts including exons 3 and 4 i.e., total MuSK transcripts
  • ratio of MuSK transcripts including exons 3 and 4 is between about 1:0.9 and 1:0.5.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases at a level at least 2 fold greater than the decrease observed for the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases at a level at least 3 fold greater than the decrease observed for the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases at a level at least 4 fold greater than the decrease observed for the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases at a level at least 5 fold greater than the decrease observed for the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases at a level at least 10 fold greater than the decrease observed for the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 70% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 80% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 90% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 30%.
  • the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 20%. In some embodiments, the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 10%.
  • the base sequence of the oligonucleotide comprises a sequence having no more than 5 mismatches from a 18-25 base long portion of the MuSK gene or its complement.
  • the oligonucleotides correspond to positions 83776- 83800 and on 83854-83878 of the MuSK gene sequence represented in SEQ ID NO: 77.
  • the oligonucleotides described herein target a region on the MuSK genomic sequence within a region defined by nucleotides 83841-83905 and 83962-84032 on the MuSK gene sequence represented in SEQ ID NO: 77.
  • oligonucleotides target a region on the MuSK genomic sequence within or comprising at least a portion of sequence ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126). In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to no more than 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to at least 15 consecutive bases of region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 15-30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 16 consecutive bases of region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 17 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 18 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 20 consecutive bases of region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 21 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 24 consecutive bases of region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 27 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 28 consecutive bases of region 1, SEQ ID: 126.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 30 consecutive bases of region 1, SEQ ID: 126. [0044] In some embodiments, oligonucleotides target a region on the MuSK genomic sequence within or comprising at least a portion of sequence GGGGAGAAGTTCAGTACTGCCAAGGCTGCAGCCACCATCAGCATAGCAGGTAGG ATGCCCCTTCACATTTG (region 2, SEQ ID 211).
  • oligonucleotides target a portion of MUSK transcript comprising a sequence that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to no more than 30 consecutive bases of region 2, SEQ ID: 211.
  • oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to at least 15 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to 15-30 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MUSK transcript comprising a sequence that is identical to 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 15 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 16 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 17 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 18 consecutive bases of region 2, SEQ ID: 211.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 19 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 20 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 21 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 22 consecutive bases of region 2, SEQ ID: 211.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 23 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 24 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 25 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 26 consecutive bases of region 2, SEQ ID: 211.
  • oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 27 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 28 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 29 consecutive bases of region 2, SEQ ID: 211. In some embodiments, oligonucleotides target a portion of MuSK transcript comprising a sequence that is identical to 30 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a sequence within or comprising at least a portion of ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126). In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to a sequence that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 95% identical to a portion of region 1 (SEQ ID: 126) that includes at least 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 10 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 11 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 12 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 13 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 14 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 15 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 16 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 17 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 18 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 19 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 20 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 21 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 22 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 23 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 24 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 25 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 26 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 27 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 28 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 29 consecutive bases of region 1 (SEQ ID: 126). In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of region 1 (SEQ ID: 126) that includes at least 30 consecutive bases of region 1 (SEQ ID: 126).
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to no more than 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 15-30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 16 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 17 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 18 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 21 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 24 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 25 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 27 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 28 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 29 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 30 consecutive bases of region 1, SEQ ID: 126. [0048] In some embodiments, an oligonucleotide has a length of 30 bases. In some embodiments, an oligonucleotide has a length of 29 bases. In some embodiments, an oligonucleotide has a length of 28 bases. In some embodiments, an oligonucleotide has a length of 27 bases. In some embodiments, an oligonucleotide has a length of 26 bases. In some embodiments, the oligonucleotide has a length of 25 bases.
  • the oligonucleotide has a length of 24 bases. In some embodiments, the oligonucleotide has a length of 23 bases. In some embodiments, the oligonucleotide has a length of 22 bases. In some embodiments, the oligonucleotide has a length of 21 bases. In some embodiments, the oligonucleotide has a length of 20 bases. In some embodiments, the oligonucleotide has a length of 19 bases. In some embodiments, the oligonucleotide has a length of 18 bases. In some embodiments, the oligonucleotide has a length of 17 bases.
  • the oligonucleotide has a length of 16 bases. In some embodiments, the oligonucleotide has a length of 15 bases. [0049] In some embodiments, the oligonucleotide has a length of less than about 50 bases. In some embodiments, the oligonucleotide has a length of less than about 40 bases. In some embodiments, the oligonucleotide has a length of less than about 30 bases. In some embodiments, the oligonucleotide has a length of more than about 10 bases. In some embodiments, the oligonucleotide has a length of more than about 15 bases. In some embodiments, the oligonucleotide has a length of more than about 20 bases. In some embodiments, the base sequence of the oligonucleotide comprises from 5’ to 3’:
  • the oligonucleotide is complementary to a nucleotide sequence that is at least 90% identical to any one of SEQ ID NOs: 39-76 and and 212-253.
  • the oligonucleotides comprise one or more types of base modifications, sugar modification, and internucleotidic linkage modifications.
  • the oligonucleotides comprise non-natural sugar moieties, or non-natural internucleotidic linkages, or both.
  • the oligonucleotides comprise internucleotidic linkage modifications.
  • the internucleotidic linkages of the oligonucleotide comprises natural phosphate, phosphorothioate, or phosphodithioate linkages. In some embodiments, each internucleotidic linkages of the oligonucleotide is a phosphorothioate linkage. In some embodiments, each internucleotidic linkage of the oligonucleotide is a natural phosphate linkage. In some embodiments, oligonucleotide comprises at least one natural phosphate linkage and at least one phosphodithioate linkage.
  • the oligonucleotides comprise sugar modification.
  • the modified sugar moiety has a 2’-modification.
  • the modified sugar moiety comprises a bicyclic sugar modification.
  • the modified sugar moiety comprises a 2’-modification, wherein a 2’-modification is 2’-OR 1 , wherein R 1 is optionally substituted C 1-6 alkyl.
  • the modified sugar moiety comprises a 2’-modification, wherein a 2’-modification is 2’-MOE.
  • the modified sugar moiety comprises a 2’-modification, wherein a 2’- modification is 2’-OMe.
  • each sugar of the oligonucleotide is a 2’- MOE modified sugar.
  • an oligonucleotide comprises 2’-OH sugar (RNA sugar).
  • an oligonucleotide comprise 2’-H sugar (DNA sugar). In some embodiments, an oligonucleotide comprises 2’-MOE sugar. In some embodiments, an oligonucleotide comprises 2’-OMe sugar. In some embodiments, an oligonucleotide comprises 2’-MOE, 2’-OMe, 2’-OH, 2’-H sugar, or any combination thereof. In some embodiments, an oligonucleotide comprises at least one 2’-MOE sugar and at least one 2’- OH sugar (RNA sugar). In some embodiments, an oligonucleotide comprises at least one 2’- MOE sugar and at least one 2’-H sugar (DNA sugar).
  • the oligonucleotide has the structure from 5’ to 3’of: wherein * represents a phosphorothioate linkage, and each sugar of the oligonucleotides is a 2’-MOE modified sugar.
  • an oligonucleotide composition comprising a mixture of two or more oligonucleotides according to any one of the embodiments.
  • the composition comprises oligonucleotides that targets regions of the MuSK gene that correspond to positions 83776-83800 and on 83854-83878 of SEQ ID NO: 77.
  • a pharmaceutical composition comprises a therapeutically effective amount of an oligonucleotide, and at least one pharmaceutically acceptable inactive ingredient selected from pharmaceutically acceptable diluents, pharmaceutically acceptable excipients, and pharmaceutically acceptable carriers, wherein the oligonucleotide is an oligonucleotide of any one of the embodiments.
  • the oligonucleotides are formulated a nanocarrier.
  • the oligonucleotides are formulated in lipid nano-particles (LNPs).
  • the oligonucleotides are covalently conjugated to an additional moiety selected from lipids (for example, cholesterol), peptides, aptamers, antibodies, and sugars (for example, N-acetylgalactosamine (GalNAc). In some embodiments, the oligonucleotides are covalently conjugated to N-acetylgalactosamine (GalNAc).
  • the disclosure features, a method of altering relative amounts of MuSK spliced transcripts, the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of previous embodiments.
  • the disclosure features the alteration of MuSK spliced transcripts being characterized in that, the ratio of MuSK transcripts containing Ig3 domain- encoding sequences to MuSK transcription containing no Ig3 domain-encoding sequences is increased. In some embodiments, the alteration of MuSK spliced transcripts being characterized in that, the ratio of MuSK transcripts containing Ig3 domain-encoding sequences to MuSK transcription containing no Ig3 domain-encoding sequences decreases. In some embodiments, the alteration of MuSK spliced transcripts being characterized in that, MuSK transcripts containing Ig3 domain-encoding sequences decreases and level of total MuSK transcripts remains substantially the same.
  • the alteration of MuSK spliced transcripts is characterized in that, the level of MuSK transcripts including exons 6 and 7 decreases or level of MuSK protein forms including sequences encoded by exons 6 and 7 decreases, or both.
  • the alteration of MuSK spliced transcripts being characterized in that, level of MuSK transcripts including exons 6 and 7 is increased or level of MuSK protein forms including sequences encoded by exons 6 and 7 is increased, or both.
  • the alteration of MuSK spliced transcripts is characterized in that, the level of MuSK transcripts including exons 3 and 4 decreases or level of MuSK protein forms including sequences encoded by exons 3 and 4 decreases, or both. In some embodiments, the alteration of MuSK spliced transcripts is characterized in that, the level of MuSK transcripts including exons 3 and 4 is increased or level of MuSK protein forms including sequences encoded by exons 3 and 4 is increased, or both.
  • the alteration of MuSK spliced transcripts being characterized in that, the level of MuSK transcripts including exons 3 and 4 remains substantially the same, or level of MuSK protein forms including sequences encoded by exons 3 and 4 remains substantially the same, or both.
  • the alteration of MuSK spliced transcripts is characterized that, the level of MuSK transcripts including exons 3 and 4 remains substantially the same, or level of MuSK protein forms including sequences encoded by exons 3 and 4 remains substantially the same, or both; and level of MuSK transcripts including exons 6 and 7 decreases or level of MuSK protein forms including sequences encoded by exons 6 and 7 decreases, or both.
  • the disclosure features, a method of treating a subject suffering from one or more features of neurodegenerative diseases, the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of the previous embodiments.
  • a method of increasing neurogenesis the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of the previous embodiments.
  • the disclosure features, a method of treating a subject suffering from one or more features of neuromuscular dysfunction or a muscular dystrophy, the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of the previous embodiments.
  • a method of increasing muscle regeneration and/or muscle growth the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of the previous embodiments.
  • the disclosure features, a method of treating muscle fibrosis, the method comprising a step of administering to a subject a pharmaceutical composition that comprises or delivers a composition of any one of the previous embodiments.
  • the subject is at risk of, or afflicted with, a disease or disorder selected from the group consisting of: neuromuscular dysfunction, neurodegenerative disorder, cardiac disorder, and diseases characterized by muscle wasting.
  • the neurodegenerative disorder is selected from the group consisting of Alzheimer’s Disease (AD), Parkinson’s disease, dementia (e.g., Frontotemporal dementia), stroke, Major Depressive Disorder (MDD), bipolar disorder, Schizophrenia, Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking), Temporal-Lobe Epilepsy, Hippocampal Sclerosis, Niemann Pick Type C, Diabetes-mediated hippocampal neuronal loss, brain injury (e.g., traumatic and/or anoxic brain injury), and Huntington’s disease.
  • AD Alzheimer’s Disease
  • Parkinson’s disease dementia
  • dementia e.g., Frontotemporal dementia
  • stroke e.g., Major Depressive Disorder (MDD), bipolar disorder, Schizoph
  • the neurodegenerative disease is Alzheimer’s Disease (AD).
  • AD Alzheimer’s Disease
  • the neuromuscular dysfunction is a muscular dystrophy selected from the group consisting of: Becker, Congenital, Distal, Duchenne, Emery- Dreifuss, Facioscapulohumeral, Limb-girdle, Myotonic, and Oculo-pharyngeal muscular dystrophy.
  • the disclosure features, [0071]
  • the cardiac disorder is myocardial infarction or cardiomyopathy.
  • the subject is in need of enhanced muscle regeneration and/or growth following a condition selected from the group consisting of: surgery, trauma and prolonged immobilization.
  • the prolonged immobilization results from bed-rest or casting.
  • the subject is at risk of, or afflicted with, sarcopenia.
  • the subject is at risk of, or afflicted with, muscle fibrosis resulting from a disease or condition selected from the group consisting of: trauma, heritable disease, muscle disorder, and aging.
  • the trauma is the result of a condition selected from the group consisting of: radiation treatment, crush injury, laceration, and amputation.
  • the heritable disease or muscle disorder selected from the group consisting of: Congenital Muscular Dystrophy, Duchenne Muscular Dystrophy, Becker’s Muscular Dystrophy; Amyotrophic Lateral Sclerosis (ALS), and age-associate sarcopenia.
  • the composition is delivered to the CNS. In some embodiments, the composition is delivered to the cerebrospinal fluid. In some embodiments, the composition is delivered to the muscle. In some embodiments, the composition is delivered to the liver. In some embodiments, the composition can be formulated for systemic or localized administration.
  • the composition is formulated for delivery by a route selected from intravenous injection, intravenous infusion, intramuscular injection, intrathecal administration, oral administration, buccal administration, inhalation, nasal administration, topical administration, ophthalmic administration or otic administration.
  • the composition is formulated for delivery by intramuscular administration.
  • the composition is formulated for delivery by intravenous administration.
  • the composition is formulated for delivery by oral administration.
  • FIG.1 is a schematic representation of an interaction between BMP and Ig3 domain of MuSK and its implications in BMP signaling and neurogenesis and cognition.
  • FIG.2 is a schematic representation of the full-length and MuSK ⁇ Ig3 transcripts and encoded proteins and exemplary primer design to selectively detect total MuSK and full-length MuSK transcripts.
  • FIG.3 shows relative MuSK expression measured by qPCR using Taqman or SYBR green technology in LHCN-M2 cells.
  • FIG.4 is a schematic representation of “region 1” and “region 2” of exon 7 of MuSK transcript.
  • FIG.5 shows an alignment of the ASOs Bld1-Bld18 on the genetic sequence of MuSK.
  • FIG.6 shows microscopic acquisitions of LHCN-M224h after being transfected with the ASOs Bld1-Bld4, Bld6, Bld7, Bld9, Bld11, Bld12, Bld13, Bld14, Bld15, Bld16, Bld17, and untreated control at 100nM (scale 100nm).
  • FIG.7 shows relative MuSK expression measured by qPCR of LHCN-M2 cells transfected with ASOs Bld1-Bld18 at 50 and 100 nM.
  • FIG.8 shows alignment of the ASOs Bld1-Bld18 on the genetic sequence of MuSK and their effect on MuSK expression. Green: no effect or increase in MuSK expression (MuSK expression comprised between 90 and 300% of the untreated condition). Orange: moderate decrease in MuSK expression (MuSK expression comprised between 40 and 70% of the untreated condition).
  • FIG.9 shows an alignment of the ASOs Bld19-Bld38 on the genetic sequence of MuSK.
  • FIG.10 shows microscopic acquisitions of LHCN-M224 h after being transfected with the ASOs Bld 19-22, Bld29-34, and untreated control at 100 nM (scale 100nm).
  • FIG.11 shows relative MuSK expression measured by qPCR of LHCN-M2 cells transfected with ASOs (control, Bld19-Bld28) at 50 and 100 nM.
  • Panel A shows MuSK34 expression
  • panel B shows MuSK67 expression. All samples are normalized to the housekeeping genes GAPDH and YWHAZ and to controls.
  • FIG.12 shows the alignment of the ASOs Bld19-Bld38 on the genetic sequences and their effect on MuSK expression. Green: no effect or increase in MuSK expression (MuSK expression comprised between 90 and 300% of the untreated condition). Orange: moderate decrease in MuSK expression (MuSK expression comprised between 40 and 70% of the untreated condition).
  • FIG.13 shows relative MuSK expression in response to various doses of ASOs (Bld25 (panel A), Bld26 (panel B), Bld27 (panel C), Bld28 (panel D), Bld35 (panel E), Bld38 (panel F)).
  • MuSK34 (in blue) and MuSK67 (in red) expressions were measured by qPCR and normalized to housekeeping genes and to the controls. The estimated IC is indicated on each graph.
  • FIG.14 shows relative MuSK expression in response to various doses of ASOs (Bld25 (panel A), Bld26 (panel B)). MuSK34 (in blue) and MuSK67 (in red) expressions were measured by qPCR and normalized to housekeeping genes and to the controls. The 4 tested doses were 5, 7.5, 12.5 and 25 nM.
  • FIG.15 shows relative MuSK expression in response to combination of ASOs Bld25 and Bld26 at 12.5 nM final concentration compared to an untreated control. MuSK34 (in blue) and MuSK67 (in red) expressions were measured by qPCR and normalized to housekeeping genes and to controls.
  • FIG.16 shows migration of PCR products from exon 3 to exon 9 on gel electrophoresis.
  • cDNA of ASO-treated cells (Bld25, i.e., “hu7-10 or Bld26, i.e., “hu73”) was amplified by PCR and deposited on gel electrophoresis to be migrated (panel A). Predicted products are presented in panel B and panel B’.
  • FIG.17 shows an alignment of sequences of various target portion of “region 1”.
  • FIG.18 shows the relative change of gene expression of total MuSK (MuSK34) and MuSK containing Ig3 domain (MuSK67) for ASOs Bld51-Bld66 at a concentration of 12.5 nM (Panel A) and at a concentration of 100 nM (Panel B).
  • FIG.19 shows an alignment of ASOs Bld25-1, Bld25-2, Bld25, Bld25-3, Bld25-4, BLd25-5, Bld26-1, Bld26-2, Bld26, Bld26-3, Bld26-4, Bld27, Bld28, Bld35, Bld 38 on various target portions of “region 1” and “region 2” of exon 7 of human MuSK.
  • FIG.20 shows MuSK gene expression analyzed in qPCR. Panel A shows relative gene expression of MuSKIg3 (MuSK67) and Panel B shows relative gene expression of total MuSK (MuSK34).
  • FIG.21 shows MuSK gene expression from only the ASOs which showed relative expression of MuSK67 of less than 50% and total MuSK (MuSK34) of greater than 60% compared to the control.
  • Panel A shows relative gene expression of MuSKIg3 (MuSK67) and
  • Panel B shows relative gene expression of total MuSK (MuSK34).
  • FIG.22 shows a comparison of Bld25-5 to Bld25 after transfection with ASO for 24 hours (Panels A and B) and 48 hours (Panels C and D).
  • FIG.23 shows an alignment of ASOs Bld25, Bld25-A, Bld25-B, Bld25-C, Bld25-D, Bld25-E, Bld25-5, Bld25-5-A, Bld25-5-B, Bld25-5-C, Bld25-5-D, Bld25-5-E, Bld26-2, Bld26-2-A, Bld26-2-B, Bld26-2-C, Bld26-2-D, Bld26, Bld26-B, Bld26-C, Bld26-D, on various target portions of “region 1” of exon 7 of human MuSK.
  • FIG.24 shows relative gene expression (MuSK34 and MuSK67) for ASOs Bld25-A, Bld25-B, Bld25-C, Bld25-D, and Bld25-E.
  • FIG.25 shows relative gene expression (MuSK34 and MuSK67) for ASOs Bld25-5-A, Bld25-5-B, Bld25-5-C, Bld25-5-D, and Bld25-5-E.
  • FIG.26 shows a graphical representation of the 3 variants of MuSK RNA.
  • FIG.27 shows the gel migration of pcr products from cells treated with Bld25 and Bld25-5 and intensity of bands from Bld25 and Bld25-5 products.
  • FIG.28 shows that the sequence of the band lower band positioned, where ⁇ 6,7 variant 1 (687 bases) was expected, was indeed the sequence of this splice variant.
  • FIG.29 shows images of HCN-M2 cells being treated for 48h with 10nM of siRNA against MuSK and were then stained for MuSK protein on days 2, 3, 4, and 5 following siRNA treatment.
  • Administration typically refers to the administration of a composition to a subject or system, for example to achieve delivery of an agent (e.g., an agonizing agent) that is, or is included in or otherwise delivered by, the composition.
  • an agent e.g., an agonizing agent
  • Those of ordinary skill in the art will be aware of a variety of routes that may, in appropriate circumstances, be utilized for administration to a subject, for example a human.
  • administration may be ocular, oral, buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc), enteral, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e.g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
  • dermal which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc
  • enteral intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within
  • an agent e.g., an agonizing agent
  • CNS central nervous system
  • administration may involve only a single dose.
  • administration may involve application of a fixed number of doses.
  • administration may involve dosing that is intermittent (e.g., a plurality of doses separated in time) and/or periodic (e.g., individual doses separated by a common period of time) dosing.
  • administration may involve continuous dosing (e.g., perfusion) for at least a selected period of time.
  • agent in general, the term “agent”, as used herein, may be used to refer to a compound or entity of any chemical class including, for example, a polypeptide, nucleic acid, saccharide, lipid, small molecule, metal, or combination or complex thereof.
  • the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
  • the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
  • the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
  • an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
  • potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
  • the term “agent” may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
  • the term “agent” may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties. In some embodiments, the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety.
  • Agonist Those skilled in the art will appreciate that the term “agonist” may be used to refer to an agent (i.e., an “agonizing agent”), condition, or event whose presence, level, degree, type, or form correlates with increased level or activity of another agent (i.e., the agonized agent or the target agent).
  • an agonist may be or include an agent of any chemical class including, for example, small molecules, polypeptides, nucleic acids, carbohydrates, lipids, metals, and/or any other entity that shows the relevant activating activity.
  • an agonist may be direct (in which case it exerts its influence directly upon its target); in some embodiments, an agonist may be indirect (in which case it exerts its influence by other than binding to its target; e.g., by interacting with a regulator of the target, so that level or activity of the target is altered).
  • an agonist is a binding agent that is a protein (e.g., an antibody) or a nucleic acid (e.g., an antisense oligonucleotide) that binds a target (e.g., a protein or nucleic acid) so that level, form, and/or or activity of the target is altered.
  • a target e.g., a protein or nucleic acid
  • the altered level, form and/or activity is an increased level of altered protein expressed from the target nucleic acid sequence.
  • an agonizing agent may bind to (and potentially agonize) a binding target, which binding causes an increase in level or activity of a further agonized target.
  • an agonizing agent that binds to a nucleic acid target may alter level and/or activity of that target, and in some specific embodiments may agonize an activity of that nucleic acid target (e.g., by increasing its modification, splicing, 5’ cap formation, and/or 3’ end formation, transport, and/or translation, etc, so that a level of a desired product – e.g., mRNA, is increased) and/or may agonize a downstream target, such as a polypeptide encoded by such nucleic acid target.
  • an agonizing agent may be or comprise an oligonucleotide that binds to a primary transcript and alters its splicing pattern so that level and/or activity of a particular spliced form (e.g., mature mRNA) is increased, which may, in turn achieved increased level of a product (e.g., a polypeptide) that is or is encoded by such particular spliced form.
  • a particular spliced form e.g., mature mRNA
  • a product e.g., a polypeptide
  • Antagonist may be used to refer to an agent (i.e., an “antagonizing agent”), condition, or event whose presence, level, degree, type, or form correlates with decreased level or activity of another agent (i.e., the inhibited agent, or target).
  • an antagonist may be or include an agent of any chemical class including, for example, small molecules, polypeptides, nucleic acids, carbohydrates, lipids, metals, and/or any other entity that shows the relevant inhibitory activity.
  • an antagonist may be direct (in which case it exerts its influence directly upon its target); in some embodiments, an antagonist may be indirect (in which case it exerts its influence by other than binding to its target; e.g., by interacting with a regulator of the target, so that level or activity of the target is altered).
  • an antagonist is binding agent that is a protein (e.g., an antibody) or a nucleic acid (e.g., an antisense oligonucleotide) that binds a target (e.g., a protein or nucleic acid) so that the level, form, and/or activity of the target is altered.
  • the altered level, form and/or activity is a decreased level of altered protein expressed from the target nucleic acid sequence.
  • an antagonizing agent may bind to (and potentially antagonize) a binding target, which binding causes a decrease in level or activity of a further antagonized target.
  • an antagonizing agent that binds to a nucleic acid target may alter level and/or activity of that target, and in some specific embodiments may antagonize an activity of that nucleic acid target (e.g., by decreasing its modification, splicing, 5’ cap formation, and/or 3’ end formation, transport, and/or translation, etc, so that a level of an undesired product – e.g., mRNA, is suppressed) and/or may antagonize a downstream target, such as a polypeptide encoded by such nucleic acid target.
  • an antagonizing agent may be or comprise an oligonucleotide that binds to a primary transcript and alters its splicing pattern so that level and/or activity of a particular spliced form (e.g., mature mRNA) is suppressed, which may, in turn achieved decreased level of a product (e.g., a polypeptide) that is or is encoded by such particular spliced form.
  • a product e.g., a polypeptide
  • Antibody agent refers to an agent that specifically binds to a particular antigen (e.g., that may be or comprise an epitope of a protein of interest - e.g., a MuSK protein).
  • the term encompasses any polypeptide or polypeptide complex that includes immunoglobulin structural elements sufficient to confer specific binding.
  • exemplary antibody agents include, but are not limited to monoclonal antibodies or polyclonal antibodies.
  • an antibody agent may include one or more constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies.
  • an antibody agent may include one or more sequence elements are humanized, primatized, chimeric, etc, as is known in the art.
  • the term “antibody agent” is used to refer to one or more of the art- known or developed constructs or formats for utilizing antibody structural and functional features in alternative presentation.
  • an antibody agent utilized in accordance with the present invention is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi- specific antibodies (e.g., Zybodies®, etc); antibody fragments such as Fab fragments, Fab’ fragments, F(ab’)2 fragments, Fd’ fragments, Fd fragments, and isolated CDRs or sets thereof; single chain Fvs; polypeptide-Fc fusions; single domain antibodies (e.g., shark single domain antibodies such as IgNAR or fragments thereof); cameloid antibodies; masked antibodies (e.g., Probodies®); Small Modular ImmunoPharmaceuticals (“SMIPs TM” ); single chain or Tandem diabodies (TandAb®); VHHs; Anticalins®; Nanobodies® minibodies; BiTE®s; ankyrin repeat proteins or DARPINs®; Avimers®; DARTs; TCR-
  • an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
  • an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc], or other pendant group [e.g., poly-ethylene glycol, etc.].
  • an antibody agent is or comprises a polypeptide whose amino acid sequence includes one or more structural elements recognized by those skilled in the art as a complementarity determining region (CDR); in some embodiments an antibody agent is or comprises a polypeptide whose amino acid sequence includes at least one CDR (e.g., at least one heavy chain CDR and/or at least one light chain CDR) that is substantially identical to one found in a reference antibody. In some embodiments an included CDR is substantially identical to a reference CDR in that it is either identical in sequence or contains between 1-5 amino acid substitutions as compared with the reference CDR.
  • CDR complementarity determining region
  • an included CDR is substantially identical to a reference CDR in that it shows at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with the reference CDR. In some embodiments an included CDR is substantially identical to a reference CDR in that it shows at least 96%, 96%, 97%, 98%, 99%, or 100% sequence identity with the reference CDR. In some embodiments an included CDR is substantially identical to a reference CDR in that at least one amino acid within the included CDR is deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical with that of the reference CDR.
  • an included CDR is substantially identical to a reference CDR in that 1-5 amino acids within the included CDR are deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical to the reference CDR. In some embodiments an included CDR is substantially identical to a reference CDR in that at least one amino acid within the included CDR is substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical with that of the reference CDR. In some embodiments an included CDR is substantially identical to a reference CDR in that 1-5 amino acids within the included CDR are deleted, added, or substituted as compared with the reference CDR but the included CDR has an amino acid sequence that is otherwise identical to the reference CDR.
  • an antibody agent is or comprises a polypeptide whose amino acid sequence includes structural elements recognized by those skilled in the art as an immunoglobulin variable domain.
  • an antibody agent is a polypeptide protein having a binding domain which is homologous or largely homologous to an immunoglobulin-binding domain.
  • Antibody refers to an immunoglobulin or a derivative thereof containing an immunoglobulin domain capable of binding to an antigen (e.g., that may be or comprise an epitope of a protein of interest - e.g., a MuSK protein).
  • the antibody can be of any species, e.g., human, rodent, rabbit, goat, chicken, etc.
  • the antibody may be a member of any immunoglobulin class, including any of the human classes: IgG, IgM, IgA, IgD, and IgE, or subclasses thereof such as IgG1, IgG2, etc.
  • the antibody is a fragment such as an Fab’, F(ab’) 2 , scFv (single-chain variable) or other fragment that retains an antigen binding site, or a recombinantly produced scFv fragment, including recombinantly produced fragments. See, e.g., Allen, T., Nature Reviews Cancer, Vol.2, 750-765, 2002, and references therein.
  • the antibody can be monovalent, bivalent or multivalent.
  • the antibody may be a chimeric or “humanized” antibody in which, for example, a variable domain of rodent origin is fused to a constant domain of human origin, thus retaining the specificity of the rodent antibody.
  • the domain of human origin need not originate directly from a human in the sense that it is first synthesized in a human being. Instead, “human” domains may be generated in rodents whose genome incorporates human immunoglobulin genes. See, e.g., Vaughan, et al., (1998), Nature Biotechnology, 16: 535-539.
  • the antibody may be partially or completely humanized.
  • An antibody may be polyclonal or monoclonal, though for purposes of the present invention monoclonal antibodies are generally preferred.
  • monoclonal or polyclonal antibodies can be purified from blood or ascites fluid of an animal that produces the antibody (e.g., following natural exposure to or immunization with the molecule or an antigenic fragment thereof), can be produced using recombinant techniques in cell culture or transgenic organisms, or can be made at least in part by chemical synthesis.
  • the antibody can act as an antagonist, e.g., by binding to a target antigen, resulting in a decreased level or activity of said antigen.
  • the antibody can act as an agonist, e.g., by binding to a target antigen, resulting in an increased level or activity of said antigen.
  • Antisense is used herein to refer to a nucleic acid whose nucleotide sequence is complementary to part or all of a sequence found in a coding strand nucleic acid.
  • a “coding strand” nucleic acid is one whose sequence includes part or all of an open reading frame or other stretch of residues that encodes part or all of a polypeptide.
  • a coding strand may include both coding and non-coding sequences (e.g., to give but one example, may be a transcript, such as a primary transcript. that includes both intron and exon sequences).
  • an oligonucleotide may be considered or referred to as an “antisense” oligonucleotide when some or all of its sequence is complementary to non-coding portion(s) of its target strand.
  • an antisense oligonucleotide binds to coding sequences in a target sense strand; in some embodiments, an antisense oligonucleotide binds to non-coding sequences in a target coding strand.
  • an antisense oligonucleotide binds to both coding and non-coding sequences in a target coding strand.
  • an antisense oligonucleotide is characterized in that, when bound to its target sequence in a coding strand (e.g., a transcript), it alters post-transcriptional processing (e.g., one or more of modification, splicing, 5’ cap formation, and/or 3’ end formation, 5’ cap formation, and/or 3’ end formation, transport, and/or translation) of such coding strand.
  • a coding strand e.g., a transcript
  • post-transcriptional processing e.g., one or more of modification, splicing, 5’ cap formation, and/or 3’ end formation, 5’ cap formation, and/or 3’ end formation, transport, and/or translation
  • an antisense oligonucleotide alters splicing of its target coding strand,
  • an antisense-coding strand complex is or can be degraded, e.g., by RNase H.
  • Binding agent In general, the term “binding agent” is used herein to refer to any entity that binds to a target of interest as described herein. In many embodiments, a binding agent of interest is one that binds specifically with its target in that it discriminates its target from other potential binding partners in a particular interaction context.
  • a binding agent may be or comprise an entity of any chemical class (e.g., polymer, non- polymer, small molecule, polypeptide, carbohydrate, lipid, nucleic acid, etc).
  • a binding agent is a single chemical entity.
  • a binding agent is a complex of two or more discrete chemical entities associated with one another under relevant conditions by non-covalent interactions.
  • a binding agent may comprise a “generic” binding moiety (e.g., one of biotin/avidin/streptavidin and/or a class-specific antibody) and a “specific” binding moiety (e.g., an antibody or aptamers with a particular molecular target) that is linked to the partner of the generic biding moiety.
  • a “generic” binding moiety e.g., one of biotin/avidin/streptavidin and/or a class-specific antibody
  • a “specific” binding moiety e.g., an antibody or aptamers with a particular molecular target
  • binding agents are or comprise polypeptides (including, e.g., antibodies or antibody fragments).
  • binding agents are or comprise small molecules.
  • binding agents are or comprise nucleic acids (e.g., antisense oligonucleotides). In some embodiments, binding agents are aptamers. In some embodiments, binding agents are polymers; in some embodiments, binding agents are not polymers. In some embodiments, binding agents are non-polymeric in that they lack polymeric moieties. In some embodiments, binding agents are or comprise carbohydrates. In some embodiments, binding agents are or comprise lectins. In some embodiments, binding agents are or comprise peptidomimetics. In some embodiments, binding agents are or comprise scaffold proteins. In some embodiments, binding agents are or comprise mimeotopes. In some embodiments, binding agents are or comprise stapled peptides.
  • binding agents are or comprise nucleic acids (e.g., antisense oligonucleotides). In some embodiments, binding agents are aptamers. In some embodiments, binding agents are polymers; in some embodiments, binding agents are not polymers. In some embodiments, binding agents are non-poly
  • binding agents are or comprise nucleic acids, such as DNA or RNA (e.g., antisense oligonucleotides).
  • nucleic acids such as DNA or RNA (e.g., antisense oligonucleotides).
  • “complementary” refers to the capacity for precise pairing between particular bases, nucleosides, nucleotides or nucleic acids. For example, adenine (A) and uridine (U) are complementary; adenine (A) and thymidine (T) are complementary; and guanine (G) and cytosine (C), are complementary and are referred to in the art as Watson-Crick base pairings.
  • nucleotide at a certain position of a first nucleic acid sequence is complementary to a nucleotide located opposite in a second nucleic acid sequence when the strands are aligned in anti-parallel orientation, the nucleotides form a complementary base pair, and the nucleic acids are complementary at that position.
  • the percent complementarity of a first nucleic acid to a second nucleic acid may be evaluated by aligning them in antiparallel orientation for maximum complementarity over a window of evaluation, determining the total number of nt in both strands that form complementary base pairs within the window, dividing by the total number of nt within the window, and multiplying by 100.
  • AAAAAAAA and TTTGTTAT are 75% complementary since there are 12 nt in complementary base pairs out of a total of 16 nt.
  • fractions are rounded to the nearest whole number.
  • a position occupied by non-complementary nucleotides constitutes a mismatch, i.e., the position is occupied by a non-complementary base pair.
  • a window of evaluation has the length described herein for duplex portions or target portions.
  • Complementary sequences include base-pairing of a polynucleotide comprising a first nucleotide sequence to a polynucleotide comprising a second nucleotide sequence over the entire length of both nucleotide sequences (if the same length) or over the entire length of the shorter sequence (if different lengths). Such sequences can be referred to as “perfectly complementary” (100% complementarity) with respect to each other herein. Nucleic acids that are at least 70% complementary over a window of evaluation are considered “substantially complementary” over that window. In certain embodiments complementary nucleic acids are at least 75%, at least 80%, at least 85%, at least 90%, or at least 95% complementary over the window of evaluation.
  • first sequence is referred to as "substantially complementary" with respect to a second sequence herein
  • the two sequences may be perfectly complementary or they may comprise one or more unmatched bases upon hybridization, e.g., up to about 5%, 10%, 15%, 20%, or 25% unmatched bases upon hybridization, e.g., 1, 2, 3, 4, 5, or 6 mismatched base pairs upon hybridization for a duplex up to 30 base pairs, while retaining the ability to hybridize under the conditions most relevant to their intended use.
  • two oligonucleotides are designed to form, upon hybridization, one or more single stranded overhangs, such overhangs are not regarded as mismatches or unpaired nucleotides with regard to the determination of percent complementarity.
  • the two strands of a dsRNA comprising one oligonucleotide 21 nucleotides in length and another oligonucleotide 23 nucleotides in length, wherein the longer oligonucleotide comprises a sequence of 21 nucleotides that is perfectly complementary to the shorter oligonucleotide and a 2 nucleotide overhang, may be referred to as “perfectly complementary” herein.
  • “Complementary” sequences, as used herein may include one or more non-Watson-Crick base pairs and/or base pairs formed from non-natural and other modified nucleotides, in so far as the requirements with respect to their ability to hybridize are fulfilled.
  • Such non- Watson-Crick base pairs include, but are not limited to, G:U Wobble or Hoogsteen base pairing.
  • guanine, cytosine, adenine, and uracil can be replaced by other bases without substantially altering the base pairing properties of a polynucleotide comprising a nucleotide bearing such bases, according to the so-called “wobble” rules (see, e.g., Murphy, FV IV & V Ramakrishnan, V., Nature Structural and Molecular Biology 11: 1251 - 1252 (2004)).
  • a nucleotide comprising inosine as its base can base pair with nucleotides containing adenine, cytosine, or uracil.
  • nucleotides containing uracil, guanine, or adenine can be replaced in the nucleotide sequences of an Inhibitory RNA described herein by a nucleotide containing, for example, inosine.
  • Hybridize refers to the interaction between two nucleic acid sequences (which in some embodiments may be part of the same nucleic acid molecule and in other embodiments may be or include part(s) of different nucleic acid molecules) comprising or consisting of complementary portions such that a duplex structure (i.e., an intramolecular or intermolecular duplex) is formed that is stable under the particular conditions of interest, as will be understood by the ordinary skilled artisan.
  • a duplex structure i.e., an intramolecular or intermolecular duplex
  • Consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.
  • Consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.
  • Combination therapy refers to those situations in which a subject is simultaneously exposed to two or more therapeutic regimens (e.g., two or more therapeutic agents).
  • the two or more regimens may be administered simultaneously; in some embodiments, such regimens may be administered sequentially (e.g., all “doses” of a first regimen are administered prior to administration of any doses of a second regimen); in some embodiments, such agents are administered in overlapping dosing regimens.
  • “administration” of combination therapy may involve administration of one or more agent(s) or modality(ies) to a subject receiving the other agent(s) or modality(ies) in the combination.
  • combination therapy does not require that individual agents be administered together in a single composition (or even necessarily at the same time), although in some embodiments, two or more agents, or active moieties thereof, may be administered together in a combination composition, or even in a combination compound (e.g., as part of a single chemical complex or covalent entity).
  • Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
  • comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
  • Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc to be considered comparable.
  • sets of circumstances, individuals, or populations are comparable to one another when characterized by a sufficient number and type of substantially identical features to warrant a reasonable conclusion that differences in results obtained or phenomena observed under or with different sets of circumstances, individuals, or populations are caused by or indicative of the variation in those features that are varied.
  • Domain The term “domain” as used herein refers to a section or portion of an entity.
  • a “domain” is associated with a particular structural and/or functional feature of the entity so that, when the domain is physically separated from the rest of its parent entity, it substantially or entirely retains the particular structural and/or functional feature.
  • a domain may be or include a portion of an entity that, when separated from that (parent) entity and linked with a different (recipient) entity, substantially retains and/or imparts on the recipient entity one or more structural and/or functional features that characterized it in the parent entity.
  • a domain is a section or portion of a molecule (e.g., a small molecule, carbohydrate, lipid, nucleic acid, or polypeptide).
  • a domain is a section of a polypeptide (e.g., the Ig3 domain of a MuSK protein); in some such embodiments, a domain is characterized by a particular structural element (e.g., a particular amino acid sequence or sequence motif, a-helix character, b-sheet character, coiled-coil character, random coil character, etc.), and/or by a particular functional feature (e.g., binding activity, enzymatic activity, folding activity, signaling activity, etc.).
  • a particular structural element e.g., a particular amino acid sequence or sequence motif, a-helix character, b-sheet character, coiled-coil character, random coil character, etc.
  • a particular functional feature e.g., binding activity, enzymatic activity, folding activity, signaling activity, etc.
  • Dosing regimen may be used to refer to a set of unit doses (typically more than one) that are administered individually to a subject, typically separated by periods of time.
  • a given therapeutic agent has a recommended dosing regimen, which may involve one or more doses.
  • a dosing regimen comprises a plurality of doses each of which is separated in time from other doses.
  • individual doses are separated from one another by a time period of the same length; in some embodiments, a dosing regimen comprises a plurality of doses and at least two different time periods separating individual doses.
  • all doses within a dosing regimen are of the same unit dose amount. In some embodiments, different doses within a dosing regimen are of different amounts. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount different from the first dose amount. In some embodiments, a dosing regimen comprises a first dose in a first dose amount, followed by one or more additional doses in a second dose amount same as the first dose amount. In some embodiments, a dosing regimen is correlated with a desired or beneficial outcome when administered across a relevant population (i.e., is a therapeutic dosing regimen).
  • expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5’ cap formation, and/or 3’ end formation); (3) transport of an RNA transcript (e.g., from nucleus to cytoplasm; and/or (4) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.
  • isolated or Partially purified refers, in the case of a nucleic acid or polypeptide, to a nucleic acid or polypeptide separated from at least one other component (e.g., nucleic acid or polypeptide) that is present with the nucleic acid or polypeptide as found in its natural source and/or that would be present with the nucleic acid or polypeptide when expressed by a cell, or secreted in the case of secreted polypeptides.
  • component e.g., nucleic acid or polypeptide
  • a chemically synthesized nucleic acid or polypeptide or one synthesized using in vitro transcription/translation is considered “isolated.”
  • the terms “purified” or “substantially purified” refer to an isolated nucleic acid or polypeptide that is at least 95% by weight the subject nucleic acid or polypeptide, including, for example, at least 96%, at least 97%, at least 98%, at least 99% or more.
  • the antibody, antigen-binding portion thereof, or chimeric antigen receptor (CAR) described herein is isolated.
  • the antibody, antibody reagent, antigen- binding portion thereof, or CAR described herein is purified.
  • Engineered refers to the aspect of having been manipulated by the hand of man.
  • an antibody, antibody reagent, antigen- binding portion thereof, CAR or bispecific antibody is considered to be “engineered” when the sequence of the antibody, antibody reagent, antigen-binding portion thereof, CAR or bispecific antibody is manipulated by the hand of man to differ from the sequence of an antibody as it exists in nature.
  • progeny and copies of an engineered polynucleotide and/or polypeptide are typically still referred to as “engineered” even though the actual manipulation was performed on a prior entity.
  • Fragment A “fragment” of a material or entity as described herein has a structure that includes a discrete portion of the whole, but lacks one or more moieties found in the whole. In some embodiments, a fragment consists of such a discrete portion. In some embodiments, a fragment consists of or comprises a characteristic structural element or moiety found in the whole.
  • a polymer fragment comprises or consists of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more monomeric units (e.g., residues) as found in the whole polymer.
  • monomeric units e.g., residues
  • a polymer fragment comprises or consists of at least about 5%, 10%, 15%, 20%, 25%, 30%, 25%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of the monomeric units (e.g., residues) found in the whole polymer.
  • the whole material or entity may in some embodiments be referred to as the “parent” of the fragment.
  • Gene refers to a DNA sequence in a chromosome that codes for a product (e.g., an RNA product and/or a polypeptide product).
  • a gene includes coding sequence (i.e., sequence that encodes a particular product); in some embodiments, a gene includes non-coding sequence. In some particular embodiments, a gene may include both coding (e.g., exonic) and non-coding (e.g., intronic) sequences. In some embodiments, a gene may include one or more regulatory elements that, for example, may control or impact one or more aspects of gene expression (e.g., cell-type-specific expression, inducible expression, etc.).
  • Gene product or expression product generally refers to an RNA transcribed from the gene (pre-and/or post-processing) or a polypeptide (pre- and/or post-modification) encoded by an RNA transcribed from the gene.
  • a gene product may be or comprise a particular processed form of an RNA transcript (e.g., a particular edited form, a particular splice form, a particular capped form, etc).
  • homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
  • polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar.
  • Identity refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
  • polymeric molecules are considered to be “substantially identical” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
  • Calculation of the percent identity of two nucleic acid or polypeptide sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of a reference sequence.
  • the nucleotides at corresponding positions are then compared. When a position in the first sequence is occupied by the same residue (e.g., nucleotide or amino acid) as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • the percent identity between two nucleotide sequences can be determined using the algorithm of Meyers and Miller (CABIOS, 1989, 4: 11-17), which has been incorporated into the ALIGN program (version 2.0).
  • nucleic acid sequence comparisons made with the ALIGN program use a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent identity between two nucleotide sequences can, alternatively, be determined using the GAP program in the GCG software package using an NWSgapdna.CMP matrix.
  • an appropriate reference measurement may be or comprise a measurement in a particular system (e.g., in a single individual, a single cell, or cell population) under otherwise comparable conditions absent presence of (e.g., prior to and/or after) a particular agent or treatment, or in presence of an appropriate reference agent (e.g., a positive control agent or a negative control agent).
  • an appropriate reference agent e.g., a positive control agent or a negative control agent
  • an appropriate reference measurement may be or comprise a measurement in comparable system known or expected to respond in a particular way, in presence of the relevant agent or treatment.
  • an “improvement”, “increase”, “reduction”, etc typically refers to a statistically significant change.
  • those skilled in the art will understand from context what magnitude of change may be relevant.
  • a change may be a “fold” change – i.e., so that a “changed” value represents a 1.1, 1.2, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50 or more (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1), e.g., 1.5, 1.6, 1.7.1.8, etc.)-fold difference relative to the relevant reference.
  • a “change” may be a “percentage” change, so that a “changed” value represents a1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% increase or decrease, including all integers and decimal points in between), relative to the relevant reference.
  • Linked when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another to form a molecular structure that is sufficiently stable so that the moieties remain associated under the conditions in which the linkage is formed and, preferably, under the conditions in which the new molecular structure is used, e.g., physiological conditions.
  • the linkage is a covalent linkage.
  • the linkage is noncovalent.
  • Moieties may be linked either directly or indirectly. When two moieties are directly linked, they are either covalently bonded to one another or are in sufficiently close proximity such that intermolecular forces between the two moieties maintain their association.
  • linker When two moieties are indirectly linked, they are each linked either covalently or noncovalently to a third moiety, which maintains the association between the two moieties.
  • linkage between the two linked moieties is indirect, and typically each of the linked moieties is covalently bonded to the linker.
  • the linker can be any suitable moiety that reacts with the two moieties to be linked within a reasonable period of time, under conditions consistent with stability of the moieties (which may be protected as appropriate, depending upon the conditions), and in sufficient amount, to produce a reasonable yield.
  • Internucleotidic linkage refers generally to the phosphorus-containing linkage between nucleotide units of an oligonucleotide, and is interchangeable with “inter-sugar linkage” and “phosphorus atom bridge,” as used above and herein.
  • an internucleotidic linkage is a phosphodiester linkage, as found in naturally occurring DNA and RNA molecules.
  • an internucleotidic linkage is a “modified internucleotidic linkage” wherein each oxygen atom of the phosphodiester linkage is optionally and independently replaced by an organic or inorganic moiety.
  • an internucleotidic linkage is a phosphotriester linkage, phosphorothioate diester linkage ( ), or modified phosphorothioate triester linkage.
  • the internucleotidic linkage may exist as an anion or cation at a given pH due to the existence of acid or base moieties in the linkage.
  • an internucleotide linkage may be a chiral linkage.
  • Nanoparticle As used herein, the term “nanoparticle” refers to a particle having a diameter of less than 1000 nanometers (nm). In some embodiments, a nanoparticle has a diameter of less than 300 nm, as defined by the National Science Foundation.
  • a nanoparticle has a diameter of less than 100 nm as defined by the National Institutes of Health.
  • nanoparticles are micelles in that they comprise an enclosed compartment, separated from the bulk solution by a micellar membrane, typically comprised of amphiphilic entities which surround and enclose a space or compartment (e.g., to define a lumen).
  • a micellar membrane is comprised of at least one polymer, such as for example a biocompatible and/or biodegradable polymer.
  • a nucleic acid is a compound and/or substance that is or can be incorporated into an oligonucleotide chain via a phosphodiester linkage.
  • nucleic acid refers to an individual nucleic acid residue (e.g., a nucleotide and/or nucleoside); in some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising individual nucleic acid residues.
  • a "nucleic acid” is or comprises RNA; in some embodiments, a "nucleic acid” is or comprises DNA.
  • a nucleic acid is, comprises, or consists of one or more natural nucleic acid residues. In some embodiments, a nucleic acid is, comprises, or consists of one or more nucleic acid analogs. In some embodiments, a nucleic acid analog differs from a nucleic acid in that it does not utilize a phosphodiester backbone. For example, in some embodiments, a nucleic acid is, comprises, or consists of one or more "peptide nucleic acids", which are known in the art and have peptide bonds instead of phosphodiester bonds in the backbone, are considered within the scope of the present invention.
  • a nucleic acid has one or more phosphorothioate and/or 5'-N-phosphoramidite linkages rather than phosphodiester bonds.
  • a nucleic acid is, comprises, or consists of one or more natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxy guanosine, and deoxycytidine).
  • a nucleic acid is, comprises, or consists of one or more nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo- pyrimidine, 3 -methyl adenosine, 5-methylcytidine, C-5 propynyl-cytidine, C-5 propynyl- uridine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5- propynyl-uridine, C5 -propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, 2- thiocytidine, methylated bases, inter
  • a nucleic acid comprises one or more modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) as compared with those in natural nucleic acids.
  • a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or protein.
  • a nucleic acid includes one or more introns.
  • nucleic acids are prepared by one or more of isolation from a natural source, enzymatic synthesis by polymerization based on a complementary template (in vivo or in vitro), reproduction in a recombinant cell or system, and chemical synthesis.
  • a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 20, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000 or more residues long.
  • a nucleic acid is partly or wholly single stranded; in some embodiments, a nucleic acid is partly or wholly double stranded.
  • a nucleic acid has a nucleotide sequence comprising at least one element that encodes, or is the complement of a sequence that encodes, a polypeptide. In some embodiments, a nucleic acid has enzymatic activity.
  • Oligonucleotide refers to a polymer or oligomer of nucleotide monomers, containing any combination of nucleobases, modified nucleobases, sugars, modified sugars, phosphate bridges, or modified phosphorus atom bridges (also referred to herein as “internucleotidic linkage”, defined further herein).
  • Oligonucleotides can be single-stranded or double-stranded.
  • a single-stranded oligonucleotide can have double-stranded regions and a double-stranded oligonucleotide can have single-stranded regions.
  • Example oligonucleotides include, but are not limited to structural genes, genes including control and termination regions, self-replicating systems such as viral or plasmid DNA, single-stranded and double-stranded siRNAs and other RNA interference reagents (RNAi agents or iRNA agents), shRNA, antisense oligonucleotides, ribozymes, microRNAs, microRNA mimics, supermirs, aptamers, antimirs, antagomirs, Ul adaptors, triplex-forming oligonucleotides, G-quadruplex oligonucleotides, RNA activators, immuno-stimulatory oligonucleotides, and decoy oligonucleotides.
  • RNAi agents or iRNA agents RNA interference reagents
  • shRNA RNA interference reagents
  • antisense oligonucleotides ribozymes
  • microRNAs microRNA mimics
  • supermirs supermirs
  • Double-stranded and single-stranded oligonucleotides that are effective in inducing RNA interference are also referred to as siRNA, RNAi agent, or iRNA agent, herein.
  • these RNA interference inducing oligonucleotides associate with a cytoplasmic multi-protein complex known as RNAi-induced silencing complex (RISC).
  • RISC RNAi-induced silencing complex
  • single-stranded and double-stranded RNAi agents are sufficiently long that they can be cleaved by an endogenous molecule, e.g., by Dicer, to produce smaller oligonucleotides that can enter the RISC machinery and participate in RISC mediated cleavage of a target sequence, e.g.
  • operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
  • a control element “operably linked” to a functional element is associated in such a way that expression and/or activity of the functional element is achieved under conditions compatible with the control element.
  • “operably linked” control elements e.g., promoters, enhancers, etc.
  • control elements act in trans- or cis- with the coding functional element of interest.
  • the term “patient” refers to any organism to which a provided composition (e.g., an agonizing agent such as an ASO) is or may be administered, e.g., for experimental, diagnostic, prophylactic, cosmetic, and/or therapeutic purposes. Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans). In some embodiments, a patient is a human. In some embodiments, a patient is suffering from or susceptible to one or more disorders or conditions. In some embodiments, a patient displays one or more symptoms of a disorder or condition. In some embodiments, a patient has been diagnosed with one or more disorders or conditions.
  • a provided composition e.g., an agonizing agent such as an ASO
  • Typical patients include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and/or humans).
  • a patient is a human.
  • a patient is suffering from or susceptible to one or more disorders or conditions.
  • the disorder or condition is Alzheimer’s disease or other disease characterized by neurodegeneration. In some embodiments, the disorder or condition is muscular dystrophy or other disease characterized by neuromuscular dysfunction. In some embodiments, the patient is receiving or has received certain therapy to diagnose and/or to treat a disease, disorder, or condition.
  • pharmaceutical composition refers to an active agent (e.g., MuSK-targeting oligonucleotide), formulated together with one or more pharmaceutically acceptable carriers. In some embodiments, active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
  • compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous, intraperitoneal, intrathecal, intravenous, intraventricular or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
  • oral administration for example,
  • compositions or vehicles which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydrox
  • compositions that are appropriate for use in pharmaceutical contexts, i.e., salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge, et al. describes pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 66: 1-19 (1977).
  • pharmaceutically acceptable salt include, but are not limited to, nontoxic acid addition salts, which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • nontoxic acid addition salts which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • pharmaceutically acceptable salts include, but are not limited to, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palm
  • a provided compound comprises one or more acidic groups, e.g., an oligonucleotide, and a pharmaceutically acceptable salt is an alkali, alkaline earth metal, or ammonium (e.g., an ammonium salt of N(R) 3 , wherein each R is independently defined and described in the present disclosure) salt.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • a pharmaceutically acceptable salt is a sodium salt.
  • a pharmaceutically acceptable salt is a potassium salt.
  • a pharmaceutically acceptable salt is a calcium salt.
  • pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl having from 1 to 6 carbon atoms, sulfonate and aryl sulfonate.
  • a provided compound comprises more than one acid groups, for example, an oligonucleotide may comprise two or more acidic groups (e.g., in natural phosphate linkages and/or modified internucleotidic linkages).
  • a pharmaceutically acceptable salt, or generally a salt, of such a compound comprises two or more cations, which can be the same or different.
  • all ionizable hydrogen e.g., in an aqueous solution with a pKa no more than about 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2; in some embodiments, no more than about 7; in some embodiments, no more than about 6; in some embodiments, no more than about 5; in some embodiments, no more than about 4; in some embodiments, no more than about 3 in the acidic groups are replaced with cations.
  • each internucleotidic linkage e.g., phosphate group
  • independently exists in its salt form e.g., if sodium salt, ⁇ O ⁇ P(O)(ONa) ⁇ O ⁇ .
  • a pharmaceutically acceptable salt is a sodium salt of an oligonucleotide.
  • a pharmaceutically acceptable salt is a sodium salt of an oligonucleotide, wherein each acidic phosphate and modified phosphate group, if any, exists as a salt form (all sodium salt).
  • Polypeptide As used herein, the term “polypeptide,” which is interchangeably used herein with the term “protein,” refers to a polymer of at least three amino acid residues. In some embodiments, a polypeptide comprises one or more, or all, natural amino acids. In some embodiments, a polypeptide comprises one or more, or all non- natural amino acids. In some embodiments, a polypeptide comprises one or more, or all, D- amino acids. In some embodiments, a polypeptide comprises one or more, or all, L-amino acids.
  • a polypeptide comprises one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide’s N-terminus, at the polypeptide’s C-terminus, or any combination thereof.
  • a polypeptide comprises one or more modifications such as acetylation, amidation, aminoethylation, biotinylation, carbamylation, carbonylation, citrullination, deamidation, deimination, eliminylation, glycosylation, lipidation, methylation, pegylation, phosphorylation, sumoylation, or combinations thereof.
  • a polypeptide may participate in one or more intra- or inter-molecular disulfide bonds.
  • a polypeptide may be cyclic, and/or may comprise a cyclic portion.
  • a polypeptide is not cyclic and/or does not comprise any cyclic portion.
  • a polypeptide is linear.
  • a polypeptide may comprise a stapled polypeptide.
  • a polypeptide participates in non- covalent complex formation by non-covalent or covalent association with one or more other polypeptides (e.g., as in an antibody).
  • a polypeptide has an amino acid sequence that occurs in nature.
  • a polypeptide has an amino acid sequence that does not occur in nature. In some embodiments, a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man. In some embodiments, the term “polypeptide” may be appended to a name of a reference polypeptide, activity, or structure; in such instances it is used herein to refer to polypeptides that share the relevant activity or structure and thus can be considered to be members of the same class or family of polypeptides.
  • exemplary polypeptides within the class whose amino acid sequences and/or functions are known; in some embodiments, such exemplary polypeptides are reference polypeptides for the polypeptide class or family.
  • a member of a polypeptide class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference polypeptide of the class; in some embodiments with all polypeptides within the class).
  • a member polypeptide shows an overall degree of sequence homology or identity with a reference polypeptide that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
  • a conserved region that may in some embodiments comprise a characteristic sequence element
  • Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
  • a useful polypeptide may comprise a fragment of a parent polypeptide.
  • a useful polypeptide as may comprise a plurality of fragments, each of which is found in the same parent polypeptide in a different spatial arrangement relative to one another than is found in the polypeptide of interest (e.g., fragments that are directly linked in the parent may be spatially separated in the polypeptide of interest or vice versa, and/or fragments may be present in a different order in the polypeptide of interest than in the parent), so that the polypeptide of interest is a derivative of its parent polypeptide.
  • the polypeptide described herein or a nucleic acid encoding such a polypeptide
  • a “functional fragment” is a fragment or segment of a peptide which retains at least 50% of the wildtype reference polypeptide’s activity according to the assays described below herein.
  • a functional fragment can comprise conservative substitutions of the sequences disclosed herein.
  • the polypeptide described herein can be a variant of a sequence described herein.
  • the variant is a conservatively modified variant. Conservative substitution variants can be obtained by mutations of native nucleotide sequences, for example.
  • a “variant,” as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions or substitutions.
  • Variant polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a variant protein or fragment thereof that retains activity.
  • a wide variety of PCR-based site-specific mutagenesis approaches are known in the art and can be applied by the ordinarily skilled artisan.
  • variants naturally occurring or otherwise
  • alleles homologs
  • conservatively modified variants and/or conservative substitution variants of any of the particular polypeptides described are encompassed.
  • amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide.
  • Prevent or prevention refers to reducing the risk of developing the disease, disorder and/or condition and/or to delaying onset of one or more characteristics or symptoms of the disease, disorder or condition. Prevention may be considered complete when onset of a disease, disorder or condition has been delayed for a predefined period of time.
  • Recombinant is intended to refer to polypeptides that are designed, engineered, prepared, expressed, created, manufactured, and/or or isolated by recombinant means, such as polypeptides expressed using a recombinant expression vector transfected into a host cell; polypeptides isolated from a recombinant, combinatorial human polypeptide library; polypeptides isolated from an animal (e.g., a mouse, rabbit, sheep, fish, etc.) that is transgenic for or otherwise has been manipulated to express a gene or genes, or gene components that encode and/or direct expression of the polypeptide or one or more component(s), portion(s), element(s), or domain(s) thereof; and/or polypeptides prepared, expressed, created or isolated by any other means that involves splicing or ligating selected nucleic acid sequence elements to one another, chemically synthesizing selected sequence elements, and/or otherwise generating a nucleic acid that encode
  • one or more of such selected sequence elements is found in nature. In some embodiments, one or more of such selected sequence elements is designed in silico. In some embodiments, one or more such selected sequence elements results from mutagenesis (e.g., in vivo or in vitro) of a known sequence element, e.g., from a natural or synthetic source such as, for example, in the germline of a source organism of interest (e.g., of a human, a mouse, etc.).
  • mutagenesis e.g., in vivo or in vitro
  • a known sequence element e.g., from a natural or synthetic source such as, for example, in the germline of a source organism of interest (e.g., of a human, a mouse, etc.).
  • small molecule means a low molecular weight organic and/or inorganic compound.
  • a “small molecule” is a molecule that is less than about 5 kilodaltons (kD) in size. In some embodiments, a small molecule is less than about 4 kD, 3 kD, about 2 kD, or about 1 kD. In some embodiments, the small molecule is less than about 800 daltons (D), about 600 D, about 500 D, about 400 D, about 300 D, about 200 D, or about 100 D. In some embodiments, a small molecule is less than about 2000 g/mol, less than about 1500 g/mol, less than about 1000 g/mol, less than about 800 g/mol, or less than about 500 g/mol. In some embodiments, a small molecule is not a polymer.
  • a small molecule does not include a polymeric moiety. In some embodiments, a small molecule is not and/or does not comprise a protein or polypeptide (e.g., is not an oligopeptide or peptide). In some embodiments, a small molecule is not and/or does not comprise a polynucleotide (e.g., is not an oligonucleotide). In some embodiments, a small molecule is not and/or does not comprise a polysaccharide; for example, in some embodiments, a small molecule is not a glycoprotein, proteoglycan, glycolipid, etc.). In some embodiments, a small molecule is not a lipid.
  • a small molecule is a modulating agent (e.g., is an inhibiting agent or an activating agent).
  • a small molecule is biologically active.
  • a small molecule is detectable (e.g., comprises at least one detectable moiety).
  • a small molecule is a therapeutic agent.
  • certain small molecule compounds have structures that can exist in one or more steroisomeric forms.
  • such a small molecule may be utilized in accordance with the present disclosure in the form of an individual enantiomer, diastereomer or geometric isomer, or may be in the form of a mixture of stereoisomers; in some embodiments, such a small molecule may be utilized in accordance with the present disclosure in a racemic mixture form.
  • certain small molecule compounds have structures that can exist in one or more tautomeric forms.
  • such a small molecule may be utilized in accordance with the present disclosure in the form of an individual tautomer, or in a form that interconverts between tautomeric forms.
  • certain small molecule compounds have structures that permit isotopic substitution (e.g., 2 H or 3 H for H;, 11 C, 13 C or 14 C for 12C; , 13 N or 15 N for 14N; 17 O or 18 O for 16O; 36 Cl for XXC; 18 F for XXF; 131I for XXXI; etc).
  • such a small molecule may be utilized in accordance with the present disclosure in one or more isotopically modified forms, or mixtures thereof.
  • reference to a particular small molecule compound may relate to a specific form of that compound.
  • a particular small molecule compound may be provided and/or utilized in a salt form (e.g., in an acid-addition or base- addition salt form, depending on the compound); in some such embodiments, the salt form may be a pharmaceutically acceptable salt form.
  • a small molecule compound is one that exists or is found in nature, that compound may be provided and/or utilized in accordance in the present disclosure in a form different from that in which it exists or is found in nature.
  • a preparation of a particular small molecule compound that contains an absolute or relative amount of the compound, or of a particular form thereof, that is different from the absolute or relative (with respect to another component of the preparation including, for example, another form of the compound) amount of the compound or form that is present in a reference preparation of interest is distinct from the compound as it exists in the reference preparation or source.
  • a preparation of a single stereoisomer of a small molecule compound may be considered to be a different form of the compound than a racemic mixture of the compound; a particular salt of a small molecule compound may be considered to be a different form from another salt form of the compound; a preparation that contains only a form of the compound that contains one conformational isomer ((Z) or (E)) of a double bond may be considered to be a different form of the compound from one that contains the other conformational isomer ((E) or (Z)) of the double bond; a preparation in which one or more atoms is a different isotope than is present in a reference preparation may be considered to be a different form; etc.
  • Specific binding refers to an ability to discriminate between possible binding partners in the environment in which binding is to occur.
  • a binding agent that interacts with one particular target when other potential targets are present is said to "bind specifically" to the target (e.g., a target amino acid or nucleic acid sequence on a target protein/gene of interest) with which it interacts.
  • specific binding is assessed by detecting or determining degree of association between the binding agent and its partner; in some embodiments, specific binding is assessed by detecting or determining degree of dissociation of a binding agent-partner complex; in some embodiments, specific binding is assessed by detecting or determining ability of the binding agent to compete an alternative interaction between its partner and another entity.
  • specific binding is assessed by performing such detections or determinations across a range of concentrations.
  • Specificity is a measure of the ability of a particular ligand to distinguish its binding partner from other potential binding partners.
  • Subject refers an organism, typically a mammal (e.g., a human, in some embodiments including prenatal human forms).
  • a subject is suffering from a relevant disease, disorder or condition (e.g., Alzheimer’s disease (AD), muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction).
  • a subject is susceptible to a disease, disorder, or condition.
  • a subject displays one or more symptoms or characteristics of a disease, disorder or condition. In some embodiments, a subject does not display any symptom or characteristic of a disease, disorder, or condition. In some embodiments, a subject is someone with one or more features characteristic of susceptibility to or risk of a disease, disorder, or condition. In some embodiments, a subject is a patient. In some embodiments, a subject is an individual to whom diagnosis and/or therapy is and/or has been administered. [0154] Substantially: As used herein, the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
  • Substantial identity refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially identical” if they contain identical residues in corresponding positions.
  • amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. Exemplary such programs are described in Altschul et al., Basic local alignment search tool, J. Mol.
  • two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of their corresponding residues are identical over a relevant stretch of residues.
  • the relevant stretch is a complete sequence.
  • the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 or more residues.
  • Suffering from An individual who is “suffering from” a disease, disorder, and/or condition (e.g., muscular dystrophy or other disease characterized by neuromuscular dysfunction) has been diagnosed with and/or displays one or more symptoms of a disease, disorder, and/or condition.
  • Susceptible to An individual who is “susceptible to” a disease, disorder, and/or condition (e.g., Alzheimer’s disease (AD), muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction) is one who has a higher risk of developing the disease, disorder, and/or condition than does a member of the general public.
  • AD Alzheimer’s disease
  • an individual who is susceptible to a disease, disorder and/or condition may not have been diagnosed with the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may exhibit symptoms of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition may not exhibit symptoms of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
  • Symptoms are reduced: According to the present invention, “symptoms are reduced” when one or more symptoms of a particular disease, disorder or condition (e.g., Alzheimer’s disease (AD), muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction) is reduced in magnitude (e.g., intensity, severity, etc.) and/or frequency. For purposes of clarity, a delay in the onset of a particular symptom is considered one form of reducing the frequency of that symptom.
  • a “target gene”, as used herein, refers to a gene whose expression is to be modulated, e.g., through modifying splice activity (e.g., by inducing exon- skipping).
  • target portion refers to a contiguous portion of the nucleotide sequence of a target gene.
  • a target portion or target region is one or more exons within the target gene sequence.
  • a target portion may be from about 8-36 nucleotides in length, e.g., about 10-20 or about 15-30 nucleotides in length.
  • a target portion length may have specific value or subrange within the afore-mentioned ranges.
  • a target portion may be between about 15-29, 15-28, 15-27, 15-26, 15-25, 15-24, 15-23, 15-22, 15-21, 15-20, 15-19, 15-18, 15-17, 18-30, 18-29, 18-28, 18-27, 18-26, 18-25, 18-24, 18-23, 18-22, 18-21, 18-20, 19-30, 19-29, 19- 28, 19-27, 19-26, 19-25, 19-24, 19-23, 19-22, 19-21, 19-20, 20-30, 20-29, 20-28, 20-27, 20- 26, 20-25, 20-24, 20-23, 20-22, 20-21, 21-30, 21-29, 21-28, 21-27, 21-26, 21-25, 21-24, 21-23, or 21-22 nucleotides in length.
  • Therapeutic agent refers to any agent that, when administered to a subject, has a therapeutic effect and/or elicits a desired biological and/or pharmacological effect.
  • a therapeutic agent is any substance that can be used to alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition (e.g., one or more symptoms or features of Alzheimer’s disease (AD), muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction).
  • AD Alzheimer’s disease
  • muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction
  • therapeutically effective amount means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that elicits a desired biological response when administered as part of a therapeutic dosing regimen.
  • a therapeutically effective amount of a substance is an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
  • the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
  • the pharmacological methods for dosage determination may be used in the therapeutic context.
  • the amount of a composition administered to the subject will depend on the type and severity of the disease and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It will also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
  • the effective amount of compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
  • the terms "effective amount” and “therapeutically-effective amount” include an amount sufficient to prevent or ameliorate a manifestation of disease or medical condition, such as Alzheimer’s disease (AD), Parkinson’s disease, or another disease characterized by neurodegeneration, reduced mobility, metabolism, and quality of life resulting from muscle wasting in cancer patients, elderly patients, and many others with no history of neuromuscular dysfunction, in addition to muscular dystrophies such as Becker, Congenital, Distal, Duchenne, Emery-Dreifuss, Facioscapulohumeral, Limb-girdle, Myotonic, Oculopharyngeal Muscular Dystrophy. It will be appreciated that there will be many ways known in the art to determine the effective amount for a given application.
  • the pharmacological methods for dosage determination may be used in the therapeutic context.
  • the amount of a composition administered to the subject will depend on the type and severity of the disease and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It will also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
  • the compositions can also be administered in combination with one or more additional therapeutic compounds.
  • a therapeutically effective amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically effective amount.
  • Treating refers to providing treatment, i.e., providing any type of medical or surgical management of a subject.
  • the treatment can be provided in order to reverse, alleviate, inhibit the progression of, prevent or reduce the likelihood of a disease, disorder, or condition, or in order to reverse, alleviate, inhibit or prevent the progression of, prevent or reduce the likelihood of one or more symptoms or manifestations of a disease, disorder or condition.
  • Treating can include administering an agent to the subject following the development of one or more symptoms or manifestations indicative of Alzheimer’s disease (AD), muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction, e.g., in order to reverse, alleviate, reduce the severity of, and/or inhibit or prevent the progression of the condition and/or to reverse, alleviate, reduce the severity of, and/or inhibit or one or more symptoms or manifestations of the condition.
  • AD Alzheimer’s disease
  • a muscular dystrophy or other disease characterized by neurodegeneration or neuromuscular dysfunction e.g., in order to reverse, alleviate, reduce the severity of, and/or inhibit or prevent the progression of the condition and/or to reverse, alleviate, reduce the severity of, and/or inhibit or one or more symptoms or manifestations of the condition.
  • a composition of the disclosure can be administered to a subject who has developed Alzheimer’s disease, muscular dystrophy or other disease characterized by neurodegeneration, neuromuscular dysfunction or is at increased risk of developing such a disorder relative to a member of the general population.
  • a composition of the disclosure can be administered prophylactically, i.e., before development of any symptom or manifestation of the condition. Typically in this case the subject will be at risk of developing the condition.
  • Variant As used herein in the context of molecules, e.g., nucleic acids (e.g., ASOs), proteins, or small molecules, the term “variant” refers to a molecule that shows significant structural identity with a reference molecule but differs structurally from the reference molecule, e.g., in the presence or absence or in the level of one or more chemical moieties as compared to the reference entity. In some embodiments, a variant also differs functionally from its reference molecule. In general, whether a particular molecule is properly considered to be a “variant” of a reference molecule is based on its degree of structural identity with the reference molecule.
  • any biological or chemical reference molecule has certain characteristic structural elements.
  • a variant, by definition, is a distinct molecule that shares one or more such characteristic structural elements but differs in at least one aspect from the reference molecule.
  • a polypeptide may have a characteristic sequence element comprised of a plurality of amino acids having designated positions relative to one another in linear or three-dimensional space and/or contributing to a particular structural motif and/or biological function;
  • a nucleic acid may have a characteristic sequence element comprised of a plurality of nucleotide residues having designated positions relative to on another in linear or three-dimensional space.
  • a variant polypeptide or nucleic acid may differ from a reference polypeptide or nucleic acid as a result of one or more differences in amino acid or nucleotide sequence and/or one or more differences in chemical moieties (e.g., carbohydrates, lipids, phosphate groups) that are covalently components of the polypeptide or nucleic acid (e.g., that are attached to the polypeptide or nucleic acid backbone).
  • moieties e.g., carbohydrates, lipids, phosphate groups
  • a variant polypeptide or nucleic acid shows an overall sequence identity with a reference polypeptide or nucleic acid that is at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, or 99%.
  • a variant polypeptide or nucleic acid does not share at least one characteristic sequence element with a reference polypeptide or nucleic acid.
  • a reference polypeptide or nucleic acid has one or more biological activities.
  • a variant polypeptide or nucleic acid shares one or more of the biological activities of the reference polypeptide or nucleic acid.
  • a variant polypeptide or nucleic acid lacks one or more of the biological activities of the reference polypeptide or nucleic acid. In some embodiments, a variant polypeptide or nucleic acid shows a reduced level of one or more biological activities as compared to the reference polypeptide or nucleic acid. In some embodiments, a polypeptide or nucleic acid of interest is considered to be a “variant” of a reference polypeptide or nucleic acid if it has an amino acid or nucleotide sequence that is identical to that of the reference but for a small number of sequence alterations at particular positions.
  • a variant polypeptide or nucleic acid comprises about 10, about 9, about 8, about 7, about 6, about 5, about 4, about 3, about 2, or about 1 substituted residues as compared to a reference.
  • a variant polypeptide or nucleic acid comprises a very small number (e.g., fewer than about 5, about 4, about 3, about 2, or about 1) number of substituted, inserted, or deleted, functional residues (i.e., residues that participate in a particular biological activity) relative to the reference.
  • a variant polypeptide or nucleic acid comprises not more than about 5, about 4, about 3, about 2, or about 1 addition or deletion, and, in some embodiments, comprises no additions or deletions, as compared to the reference.
  • a variant polypeptide or nucleic acid comprises fewer than about 25, about 20, about 19, about 18, about 17, about 16, about 15, about 14, about 13, about 10, about 9, about 8, about 7, about 6, and commonly fewer than about 5, about 4, about 3, or about 2 additions or deletions as compared to the reference.
  • a reference polypeptide or nucleic acid is one found in nature.
  • a reference polypeptide or nucleic acid is a human polypeptide or nucleic acid.
  • vector refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
  • viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
  • certain vectors are capable of directing the expression of genes to which they are operatively linked.
  • Such vectors are referred to herein as "expression vectors”.
  • Standard techniques may be used for recombinant DNA, oligonucleotide synthesis, and tissue culture and transformation (e.g., electroporation, lipofection).
  • Enzymatic reactions and purification techniques may be performed according to manufacturer's specifications or as commonly accomplished in the art or as described herein.
  • the foregoing techniques and procedures may be generally performed according to conventional methods well known in the art and as described in various general and more specific references that are cited and discussed throughout the present specification. See e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989)), which is incorporated herein by reference for any purpose.
  • Neurogenesis occurs in distinct regions of the adult mammalian brain.
  • Neural stem cells are the endogenous source of new neurons and are active throughout life in virtually all mammals, including humans (Eriksson et al., 1998; Ernst et al., 2014; Moreno- Jiménez et al., 2019; Spalding et al., 2013).
  • Extensive work in rodent models shows that neurogenesis supports learning and memory, sensory functions, and mood regulation (Enwere et al., 2004; Gage, 2019; Imayoshi et al., 2008; Zhang et al., 2008b).
  • NSCs reside in two neurogenic niches: the subgranular zone (SGZ) in the dentate gyrus of the hippocampus and the subventricular zone (SVZ) lining the lateral ventricles.
  • SGZ subgranular zone
  • SVZ subventricular zone
  • NSCs in the SVZ generate astrocytes and oligodendrocytes that support the existing circuitry as well as neurons in the olfactory bulb that are critical for olfactory discrimination.
  • NSCs in the dentate gyrus give rise to granule neurons important for learning and memory.
  • the majority of NSCs in the human brain are located in the hippocampus. Most hippocampal NSCs reside in a state of dormancy, termed quiescence.
  • quiescent NSCs For neurogenesis to occur, quiescent NSCs must become activated in response to extrinsic or intrinsic cues. Newly born neurons functionally integrate into the local circuitry within the hippocampus and contribute to cognitive functions. The capacity of quiescent NSCs to activate declines during healthy and pathological aging and this loss precedes the decline in cognition (Enwere et al.2004; Giachino et al.2014; Capilla- Gonzalez et al.2014). [0166] Recent work indicates that endogenous or exogenous NSCs may be a valuable source of new neurons for the millions of individuals suffering from cognitive decline or brain injury.
  • AHN Autism Activation of NSCs
  • AD Alzheimer’s Disease
  • AHN is critical for normal learning and memory. AHN is abundant in healthy aged humans but is reduced from the earliest stages of Alzheimer’s Disease (AD). AHN occurs throughout life in humans and is dramatically reduced in AD (Moreno-Jimenez et al., 2019; Steiner et al., 2019). Work in animal models has underscored the role of AHN in improving cognition in the face of AD pathology.
  • AHN AHN is critical for learning and memory. Newborn dentate granule cells are hyperexcitable and exhibit robust synaptic plasticity. Thus, dysregulation of the quiescent state and/or a failure to integrate into the mature circuitry are thought to contribute to the age- associated decline in neurogenesis and cognitive performance in aging and dementia.
  • AHN in Humans Although AHN has been established in rodents and other species for decades, the existence of this process in human has been controversial until quite recently.
  • AD Alzheimer's Disease devastates the hippocampus, a brain region necessary for encoding memories.
  • the hippocampus is one of the two sites of adult neurogenesis in the brain.
  • a large number of animal studies have shown that these adult-born neurons are necessary for learning and memory.
  • a recent crucial study provided convincing evidence for robust neurogenesis in the adult human brain.
  • the level of adult neurogenesis in AD brain is greatly diminished compared to age-matched controls.
  • AD Alzheimer's et al.
  • the hippocampus is one of the earliest and most affected brain regions in AD and its atrophy is a hallmark of disease progression (Allison et al., 2019).
  • work in both rodents and humans has demonstrated that hippocampal-dependent learning is impaired in the Alzheimer’s setting (Crews et al., 2010).
  • AHN levels in AD patients are only 30% of those observed in age-matched controls (Moreno-Jiménez et al., 2019).
  • AHN diseases associated with impaired AHN
  • diseases and disorders associated with progressive memory loss such as Frontotemporal Dementia (Terreros-Roncal et al., 2019), stroke (Lindvall et al., 2015).
  • Impaired AHN is also associated with psychiatric disorders such as major depressive disorder (MDD), bipolar disorder, schizophrenia, post-traumatic stress disorder (PTSD), substance-related and addictive disorders (Yun et al., 2016), and other diseases such as Temporal-Lobe Epilepsy (Cook et al., 1992) , Hippocampal Sclerosis (Tai et al.2018), Niemann Pick Type C (Hong et al., 2015), and Diabetes-mediated hippocampal neuronal loss (Ho et al, 2013; Gold et al., 2007).
  • MDD major depressive disorder
  • bipolar disorder schizophrenia
  • PTSD post-traumatic stress disorder
  • substance-related and addictive disorders Yun et al., 2016
  • other diseases such as Temporal-Lobe Epilepsy (Cook et al., 1992) , Hippocampal Sclerosis (Tai et al.2018), Niemann Pick Type C (Hong et al., 2015), and Diabetes-mediated hippoc
  • Subventricular Zone Neurogenesis In addition to the hippocampus (i.e., the subgranular zone (SGZ) in the dentate gyrus of the hippocampus), NSCs reside in the subventricular zone (SVZ) lining the lateral ventricles. NSCs in the SVZ generate astrocytes and oligodendrocytes that support the existing circuitry as well as neurons in the olfactory bulb that are critical for olfactory discrimination.
  • SGZ subgranular zone
  • SVZ subventricular zone lining the lateral ventricles.
  • astrocytes and oligodendrocytes that support the existing circuitry as well as neurons in the olfactory bulb that are critical for olfactory discrimination.
  • the present disclosure recognizes that strategies to compensate for the degeneration of neurons in the SVZ through enhancing endogenous neurogenesis have the potential to open a new pathway for treating diseases specifically associated with striatal neurogenesis such as Parkinson’s disease (which could benefit both from increasing AHN and striatal neurogenesis in the SVZ; Pitcher et al.2012; Sterling et al.2013) and Huntington’s disease (Sassone et al., 2018).
  • Parkinson’s disease which could benefit both from increasing AHN and striatal neurogenesis in the SVZ; Pitcher et al.2012; Sterling et al.2013
  • Huntington’s disease Huntington’s disease
  • MuSK is a receptor tyrosine kinase comprised extracellularly of three Ig and one CRD/Fz domain and an intracellular tyrosine domain (TK; Fig.1).
  • MuSK neuromuscular junction
  • NMJ neuromuscular junction
  • agrin-LRP4 binding to the Ig1 domain triggers MuSK TK activity and synapse differentiation
  • NSCs neural stem cells
  • the brain harbors neural stem cells (NSCs) that generate neurons and glial cells throughout life (Moreno-Jiménez et al., 2019; Steiner et al., 2019).
  • BMPs regulate at least two important NSC decision points: 1) quiescence, where proliferating stem cells exit the cell cycle and return to replenish a reserve pool that can supply fresh stem cells; and; 2) differentiation into mature progeny (Mira et al., 2010).
  • the present disclosure contemplates that manipulating the BMP pathway in NSCs is an attractive target for regulating neurogenesis in the adult brain.
  • MuSK is also a BMP co-receptor that binds BMP and its receptors ALK3 and 6, upregulates BMP signaling and shapes the composition of the transcriptional response in myogenic cells (Yilmaz et al., 2016).
  • This BMP signaling pathway neither regulates nor requires MuSK TK activity nor is it activated by agrin-LRP4.
  • the MuSK Ig3 domain is necessary for high affinity BMP binding but is dispensable for agrin-LRP4 TK activation.
  • the Ig3 domain is endogenously alternatively spliced, including in the brain (Garcia-Osta et al., 2006; Hesser et al., 1999). Since BMP signaling induces NSC quiescence and can inhibit integration of newborn neurons we have found that restraining BMP drive by reducing MuSK-BMP signaling could increase neurogenesis (Fig.1).
  • Yilmaz et al.2016 discloses that the 'Ig3' domain of MuSK is required for high affinity binding of BMPs.
  • the major species of MuSK expressed endogenously is full length.
  • This Ig3 domain can be alternatively spliced endogenously, creating an isoform termed “ ⁇ g3MuSK”. This splicing entails the coordinated removal of exons 6 and 7 from the MuSK pre-mRNA.
  • MuSK Ig3 domains i.e., of MuSK Ig3 domain polypeptides
  • MuSK HUMAN_Ig3_Domain ARILRAPESHNVTFGSFVTLHCTATGIPVPTITWIENGNAVSSGSIQESVKDRVIDSRLQ LFITKPGLYTCIATNKHGEKFSTAKAAATIS (SEQ ID NO: 116)
  • MuSK MOUSE Ig3 Domain ARILRAPESHNVTFGSFVTLRCTAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQ LFITKPGLYTCIATNKHGEKFSTAKAAATVS SEQ ID NO: 117
  • the present disclosure provides compositions such as MuSK-targeting oligonucleotides that regulate MuSK alternative splicing as a strategy for increasing AHN in AD.
  • Satellite cells account for about 5% of muscle nuclei and are distributed along mature, multinucleated myofibers, usually in a state of quiescence. When muscle is injured, satellite cells usually proliferate before either returning to quiescence or differentiating. Upon differentiation, satellite cells become committed myoblasts that fuse into myotubes, eventually forming mature myofibers in a process termed myogenesis. Bone morphogenetic protein (BMP) signaling regulates satellite cell dynamics and muscle regeneration both in vivo and in vitro by modulating transcriptional outputs. BMP signaling is not detectable in quiescent satellite cells, it is upregulated in proliferating satellite cells, and it is downregulated during differentiation.
  • BMP Bone morphogenetic protein
  • Muscle-Specific Kinase also known as Muscle-Associated Receptor Tyrosine Kinase
  • NMJ neuromuscular junction
  • MuSK has three extracellular Immunoglobulin(Ig)-like domains and a cysteine-rich frizzled (CRD /Fz) domain, as well as an intracellular tyrosine kinase (TK) domain.
  • Ig1, TK and potentially the CRD/Fz domains are required for NMJ formation and maintenance.
  • the Ig1 and TK domains are essential for agrin-LRP4 signaling directing synaptic differentiation. For this reason, global deletion MuSK mice are neo-natal lethal.
  • Two isoforms of MuSK that exist in vivo are: full- length (FL) MuSK and a naturally-occurring splice variant that lacks the Ig3 domain ( ⁇ Ig3- MuSK).
  • FL MuSK mRNA levels are 10X higher than mRNA of ⁇ Ig3-MuSK but the two are expressed coordinately.
  • the present disclosure provides compositions such as MuSK-targeting oligonucleotides that regulate MuSK alternative splicing as a strategy for increasing muscle regeneration.
  • MuSK is activated by a nerve-derived proteoglycan called agrin.
  • Agrin has been characterized for its role in the development of the neuromuscular junction during embryogenesis. Agrin is named based on its involvement in the aggregation of acetylcholine receptors during synaptogenesis. In humans, this protein is encoded by the AGRN gene. The agrin protein has nine domains homologous to protease inhibitors.
  • MuSK is expressed in muscle and is upregulated during muscle regeneration. Data suggest that MuSK is implicated in BMP signaling in myogenesis.
  • MuSK can act as a BMP co-receptor that binds BMP2, BMP4, and BMP7 as well as the Type I BMP receptors ALK3 and ALK6. See, for example, Yilmaz et al., Sci. Signal.9:ra87, doi: 10.1126/scisignal.aaf0890, 2016, incorporated herein by reference.
  • the Ig3 domain of MuSK is required for high-affinity binding to BMP. MuSK upregulates BMP signaling as measured by BMP4-dependent phosphorylation of SMAD1/5/8.
  • MuSK-BMP signaling shapes the magnitude and composition of BMP-induced transcriptome in myoblasts and myotubes and this role is independent of any MuSK tyrosine kinase activity.
  • MuSK is a BMP co-receptor that potentiates BMP signaling and regulates myogenic factors, such as myogenic factor 5 (Myf5), in immortalized myogenic cells.
  • Myf5 myogenic factor 5
  • Activated satellite cells express MuSK protein and disruption of MuSK-BMP signaling alters satellite cell proliferation in regenerating muscle in vivo.
  • previous studies have suggested the role of the MuSK-BMP pathway in satellite cells and muscle regeneration and that targeting MuSK-BMP pathway enhances muscle growth (see e.g., PCT Publication No.
  • MuSK-Targeting Oligonucleotides e.g., MuSK Ig3 targeting oligonucleotides.
  • the disclosure provides, among other things, oligonucleotides and compositions thereof that target regions spanning exon 6 and/or exon 7 of MuSK to induce exon-skipping of exon 6 and/or exon 7.
  • Such alternative splicing activity leads to an increased expression of ⁇ Ig3- MuSK.
  • the present disclosure also describes regions within the MuSK transcript at or near exon 6 and/or exon 7 that are particularly useful as target sequences for oligonucleotides in inducing exon skipping of exon 6 and/or exon 7, thereby generating and ⁇ Ig3- MuSK transcripts. [0189] In some embodiments, the present disclosure also provides specific oligonucleotides and combinations thereof that induce alternative splicing activity of MuSK and generate ⁇ Ig3- MuSK transcripts.
  • compositions comprising one or more MuSK-targeting oligonucleotides that induce exon skipping of MuSK exons 6 and/or 7, and can be administered to a subject in a therapeutically effective amount to increase neurogenesis and/or muscle regeneration in the subject.
  • the disclosure includes compositions and methods related to one or more nucleotide sequences that are, comprise, or encode an oligonucleotide that binds to and inhibits expression of messenger RNA (mRNA) produced by a target gene (e.g., MuSK).
  • mRNA messenger RNA
  • Oligonucleotides can be single stranded (e.g., an antisense oligonucleotide) or double stranded nucleic acid.
  • an oligonucleotide comprises a double stranded RNA duplex such as microRNA (miRNA) or small interfering RNA (siRNA).
  • miRNA microRNA
  • siRNA small interfering RNA
  • an oligonucleotide is an siRNA or miRNA, or a vector comprising a nucleotide sequence encoding an siRNA or miRNA.
  • an oligonucleotide is an antisense oligonucleotide (ASO), or a vector comprising a nucleotide sequence encoding an ASO.
  • ASO antisense oligonucleotide
  • Ig Immunoglobulin
  • Ig3 extracellular Immunoglobulin-like domains
  • CCD /Fz cysteine-rich frizzled domain
  • TK intracellular tyrosine kinase
  • the oligonucleotides may target the MuSK sequence of human MuSK or one or more non-human species, e.g., a non-human primate MuSK, e.g., Macaca fascicularis MuSK (Gene ID 102127677), or e.g., chlorocebus sabaeus (Gene ID: 103219025), or murine MuSK (Gene ID: 18198).
  • a MuSK-targeting oligonucleotide comprises an antisense strand that is complementary to a target portion that is identical in the human and/or murine MuSK transcripts.
  • an oligonucleotide comprises a sequence that is complementary to a target portion of a human MuSK transcript that differs by 1, 2, or 3 nucleotides from a sequence in a murine or human MuSK transcript. It will be appreciated that an oligonucleotide that alters splicing of human MuSK may also alter splicing (i.e., induce exon skipping) of non-primate MuSK, e.g., rat or mouse MuSK, particularly if conserved regions of MuSK transcript are targeted.
  • the amino acid and nucleotide sequences of human MuSK are known in the art and can be found in publicly available databases, for example, the National Center for Biotechnology Information (NCBI) Reference Sequence (RefSeq) database, where the genomic nucleotide sequence is listed under RefSeq accession numbers NG_016016.2 (SEQ ID NO: 77) and forms of the mRNA/protein sequences are listed under NM_005592.4/NP_005583.1 (muscle, skeletal receptor tyrosine-protein kinase isoform 1), NM_001166280.2/ NP_001159752.1 (muscle, skeletal receptor tyrosine-protein kinase isoform 2), NM_001166281.2/NP_001159753.1 (muscle, skeletal receptor tyrosine-protein kinase isoform 3) and NM_001369398.1/NP_001356327.1 (muscle, skeletal receptor tyrosine-protein
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a target portion of a MuSK transcript, e.g., MuSK mRNA (e.g., complementary to a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a target portion of SEQ ID NO: 77, e.g., Bld25/hu7-10 (SEQ ID NO: 63), Bld26/hu73 (SEQ ID NO: 64), etc.).
  • a target portion of a MuSK transcript e.g., MuSK mRNA (e.g., complementary to a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a target portion of SEQ ID NO: 77, e.g., Bld25/h
  • the target portion comprises a region that corresponds to positions 83776-83800 and/or 83854-83878 of SEQ ID No: 77 or a corresponding region of a different version of the genomic sequence MuSK.
  • the target portion may be 15 – 30 nucleotides long, e.g., 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides long, although shorter and longer target portions are also contemplated.
  • a target portion of a MuSK transcript comprises a sequence of ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126), or a region within or a portion thereof.
  • a target portion comprises a sequence that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to at least 10 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to at least 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 18 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 21 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 22 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to at least 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 24 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to at least 35 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to at least 15 consecutive bases and no more than 30 consecutive bases of region 1, SEQ ID: 126. [0197] In some embodiments, a target portion comprises a sequence that is identical to 10 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 11 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 12 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 13 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to 14 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 16 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 17 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 18 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 19 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 21 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 24 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 25 consecutive bases of region 1, SEQ ID: 126.
  • a target portion comprises a sequence that is identical to 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 27 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 28 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, a target portion comprises a sequence that is identical to 30 consecutive bases of region 1, SEQ ID: 126.
  • a target portion of a MuSK transcript comprises a sequence of GGGGAGAAGTTCAGTACTGCCAAGGCTGCAGCCACCATCAGCATAGCAGGTAGG ATGCCCCTTCACATTTG (region 2, SEQ ID 211), or a region within or a portion thereof.
  • a target portion comprises a sequence that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to at least 10 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to at least 15 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 18 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 19 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 20 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 21 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 22 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to at least 23 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 24 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 25 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 30 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to at least 35 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to 10 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 11 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 12 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 13 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 14 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 15 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to 16 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 17 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 18 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 19 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 20 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 21 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to 22 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to23 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 24 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 25 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 26 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 27 consecutive bases of region 2, SEQ ID: 211.
  • a target portion comprises a sequence that is identical to 28 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 29 consecutive bases of region 2, SEQ ID: 211. In some embodiments, a target portion comprises a sequence that is identical to 30 consecutive bases of region 2, SEQ ID: 211. [0200] In some embodiments, the target portion comprises a sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of the sequences listed below in Table 1. Table 1:
  • MuSK-targeting oligonucleotide(s) as described herein can reduce the level of full-length MuSK transcript or full-length MuSK protein in a subject or in a biological sample (e.g., a blood, serum or plasma sample, or a sample comprising hepatocytes) compared to a level before the administration of the composition.
  • a biological sample e.g., a blood, serum or plasma sample, or a sample comprising hepatocytes
  • the level of full-length MuSK transcript or full-length MuSK protein is reduced by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, or at least 90%, relative to a level before the administration.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a target portion of a MuSK transcript, e.g., MuSK mRNA.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a target portion of a MuSK transcript, e.g., MuSK mRNA.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126) that includes at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 95% identical to a portion of SEQ ID: 126 that includes at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 10 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 18 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 21 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 24 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 27 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 28 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes at least 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126) that includes 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 95% identical to a portion of SEQ ID: 126 that includes 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 10 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 18 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 21 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 24 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 27 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 28 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 126 that includes 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a sequence of ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATT GACTCAAGAC (region 1, SEQ ID: 126).
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a sequence of that is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% identical to region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 10 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 18 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 20 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 21 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 22 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 24 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 26 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 27 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 28 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 30 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 35 consecutive bases of region 1, SEQ ID: 126. [0206] In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 10 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 11 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 12 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 13 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 14 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 15 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 16 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 17 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 18 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 19 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 20 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 21 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 22 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 23 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 24 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 25 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 26 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 27 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 28 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 29 consecutive bases of region 1, SEQ ID: 126. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 30 consecutive bases of region 1, SEQ ID: 126.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion sequence GGGGAGAAGTTCAGTACTGCCAAGGCTGCAGCCACCATCAGCATAGCAGGTAGG ATGCCCCTTCACATTTG (region 2, SEQ ID 211) that includes at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a sequence that is at least 95% identical to a portion of SEQ ID: 211 that includes at least 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a sequence that is at least 90% identical to a portion of SEQ ID: 211 that includes 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a sequence that is at least 95% identical to a portion of SEQ ID: 211 that includes 10, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to a portion of sequence GGGGAGAAGTTCAGTACTGCCAAGGCTGCAGCCACCATCAGCATAGCAGGTAGG ATGCCCCTTCACATTTG (region 2, SEQ ID 211). In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 10 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 15 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 18 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 19 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 20 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 21 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 22 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 23 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 24 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 25 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to at least 30 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to at least 35 consecutive bases of region 2, SEQ ID: 211. [0209] In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 10 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 11 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 12 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 13 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 14 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 15 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 16 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 17 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 18 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 19 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 20 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 21 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 22 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 23 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 24 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 25 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 26 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 27 consecutive bases of region 2, SEQ ID: 211.
  • an oligonucleotide comprises a nucleic acid strand that is complementary to 28 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 29 consecutive bases of region 2, SEQ ID: 211. In some embodiments, an oligonucleotide comprises a nucleic acid strand that is complementary to 30 consecutive bases of region 2, SEQ ID: 211.
  • MuSK-targeting oligonucleotides of the disclosure are antisense oligonucleotides comprising a nucleotide sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 1-38, 127-142, 159-167, 177-193 in the following Table 2: Table 2:
  • an oligonucleotide has a sequence that differs from that explicitly set forth in Table 2, for example by substitution of one or more residues, or types of residues, with an alternative residue or residue type– e.g., an analog or otherwise corresponding residue type.
  • one or more “T” residues (or all “T” residues) of a sequence presented in Table 2 is a “U” residue or analog thereof.
  • an oligonucleotide comprises mismatch(es) with the target.
  • the base pair may be ranked on the basis of their propensity to promote dissociation or melting (e.g., on the free energy of association or dissociation of a particular pairing, the simplest approach is to examine the pairs on an individual pair basis, though next neighbour or similar analysis can also be used).
  • A:U is preferred over G:C
  • G:U is preferred over G:C
  • an oligonucleotide can include one or more (e.g., 2, 3, 4, or 5) nucleotides on the 3’ and/or 5’ end that is not complementary to the target sequence.
  • Synthetic oligonucleotides provide useful molecular tools in a wide variety of applications. For example, oligonucleotides are useful in therapeutic, diagnostic, research, and new nanomaterials applications.
  • the use of naturally occurring nucleic acids e.g., unmodified DNA or RNA
  • various synthetic counterparts have been developed to circumvent these shortcomings.
  • oligonucleotides that contain chemical modification, e.g., base modifications, sugar modifications, backbone modifications, etc., which, among other things, render these molecules less susceptible to degradation and improve other properties of oligonucleotides.
  • the present disclosure encompasses the recognition that structural elements of oligonucleotides, such as base sequence, chemical modifications (e.g., modifications of sugar, base, and/or internucleotidic linkages, and patterns thereof), and/or stereochemistry (e.g., stereochemistry of backbone chiral centers (chiral internucleotidic linkages), and/or patterns thereof), can have significant impact on properties, e.g., stability, splicing-altering capabilities, etc.
  • oligonucleotide properties can be adjusted by optimizing chemical modifications (modifications of base, sugar, and/or internucleotidic linkage) and/or stereochemistry (pattern of backbone chiral centers).
  • chemical modifications modifications of base, sugar, and/or internucleotidic linkage
  • stereochemistry pattern of backbone chiral centers.
  • the present disclosure demonstrates that oligonucleotide compositions comprising oligonucleotides with controlled structural elements, e.g., controlled chemical modification, provide unexpected properties, including but not limited to those described herein.
  • compositions comprising oligonucleotides having chemical modifications have improved properties, such as improved splicing-altering capabilities, or improved protein binding profile, and/or improved delivery, etc.
  • the present disclosure provides compositions and methods for altering splicing of transcripts (e.g., MuSK transcripts).
  • the present disclosure provides compositions and methods for improving splicing of transcripts.
  • altered transcript splicing by provided compositions and methods include production of products having desired and/or improved biological functions, and/or knockdown of undesired product by, e.g., modifying splicing products so that undesired biological functions can be suppressed or removed.
  • a splicing product is mRNA.
  • alteration comprises skipping one or more exons.
  • splicing of a transcript is improved in that exon skipping increases levels of mRNA and proteins that have improved beneficial activities compared with absence of exon skipping.
  • splicing of a transcript is improved in that exon skipping lowers levels of mRNA and proteins that have undesired activities compared with absence of exon skipping.
  • a target is knocked down through exon skipping which, by skipping one or more exons, causes premature stop codon and/or frameshift mutations.
  • an oligonucleotide of the disclosure includes one or more natural nucleobase and/or one or more modified nucleobases derived from a natural nucleobase.
  • Examples include, but are not limited to, uracil, thymine, adenine, cytosine, and guanine having their respective amino groups protected by acyl protecting groups, 2- fluorouracil, 2-fluorocytosine, 5-bromouracil, 5-iodouracil, 2,6-diaminopurine, azacytosine, pyrimidine analogs such as pseudoisocytosine and pseudouracil and other modified nucleobases such as 8-substituted purines, xanthine, or hypoxanthine (the latter two being the natural degradation products).
  • Modified nucleobases also include expanded-size nucleobases in which one or more aryl rings, such as phenyl rings, have been added.
  • modified nucleobases are of any one of the following structures, optionally substituted:
  • a modified nucleobase is unsubstituted. In some embodiments, a modified nucleobase is substituted. In some embodiments, a modified nucleobase is substituted such that it contains, e.g., heteroatoms, alkyl groups, or linking moieties connected to fluorescent moieties, biotin or avidin moieties, or other protein or peptides. In some embodiments, a modified nucleobase is a “universal base” that is not a nucleobase in the most classical sense, but that functions similarly to a nucleobase. One representative example of such a universal base is 3-nitropyrrole.
  • an oligonucleotide described herein includes nucleosides that incorporate modified nucleobases and/or nucleobases covalently bound to modified sugars.
  • nucleosides that incorporate modified nucleobases include 4-acetylcytidine; 5-(carboxyhydroxylmethyl)uridine; 2′-O-methylcytidine; 5- carboxymethylaminomethyl-2-thiouridine; 5-carboxymethylaminomethyluridine; dihydrouridine; 2′-O-methylpseudouridine; beta,D-galactosylqueosine; 2′-O- methylguanosine; N 6 -isopentenyladenosine; 1-methyladenosine; 1-methylpseudouridine; 1- methylguanosine; l-methylinosine; 2,2-dimethylguanosine; 2-methyladenosine; 2- methylguanosine; N 7 -methylguanos
  • nucleosides include 6′-modified bicyclic nucleoside analogs that have either (R) or (S)-chirality at the 6′-position and include the analogs described in US Patent No.7,399,845.
  • nucleosides include 5′- modified bicyclic nucleoside analogs that have either (R) or (S)-chirality at the 5′-position and include the analogs described in U.S. Publ. No.20070287831.
  • a nucleobase or modified nucleobase is 5-bromouracil, 5-iodouracil, or 2,6-diaminopurine.
  • a nucleobase or modified nucleobase is modified by substitution with a fluorescent moiety.
  • an oligonucleotide described herein includes one or more modified nucleotides wherein a phosphate group or linkage phosphorus in the nucleotides are linked to various positions of a sugar or modified sugar.
  • the phosphate group or linkage phosphorus can be linked to the 2′, 3′, 4′ or 5′ hydroxyl moiety of a sugar or modified sugar.
  • Nucleotides that incorporate modified nucleobases as described herein are also contemplated in this context.
  • Other modified sugars can also be incorporated within an oligonucleotide molecule.
  • a modified sugar contains one or more substituents at the 2′ position including one of the following: –F; –CF 3 , –CN, –N 3 , –NO, –NO 2 , –OR’, –SR’, or – N(R’) 2 , wherein each R’ is independently as defined above and described herein; —O–(C 1 –C 10 alkyl), –S–(C 1 –C 10 alkyl), –NH–(C 1 –C 10 alkyl), or –N(C 1 –C 10 alkyl) 2 ; —O–(C 2 –C 10 alkenyl), –S–(C 2 –C 10 alkenyl), —NH–(C 2 –C 10 alkenyl), or –N(C 2 –C 10 alkenyl) 2 ; –O–(C 2 –C 10 alkynyl), –S–(C 2 –C 10 alkynyl), –
  • substituents include, and are not limited to, –O(CH 2 ) n OCH 3 , and –O(CH 2 ) n NH 2 or salt thereof, wherein n is from 1 to about 10, –OCH 2 CH 2 OMe (MOE) or salt thereof, –OCH 2 CH 2 N(CH 3 ) 2 (DMAOE) or salt thereof, –OCH 2 CH 2 OCH 2 CH 2 N(CH 3 ) 2 (DMAEOE) or salt thereof.
  • the 2’-OH of a ribose is replaced with a substituent including one of the following: –H, –F; –CF 3 , –CN, –N 3 , –NO, –NO 2 , –OR’, –SR’, or – N(R’) 2 , wherein each R’ is independently as defined above and described herein; —O–(C 1 –C 10 alkyl), –S–(C 1 –C 10 alkyl), –NH–(C 1 –C 10 alkyl), or –N(C 1 –C 10 alkyl) 2 ; –O–(C 2 –C 10 alkenyl), –S–(C 2 –C 10 alkenyl), —NH–(C 2 –C 10 alkenyl), or –N(C 2 –C 10 alkenyl) 2 ; –O–(C 2 –C 10 alkynyl), –S
  • the 2’–OH is replaced with –H (deoxyribose). In some embodiments, the 2’–OH is replaced with –F. In some embodiments, the 2’–OH is replaced with –OR’. In some embodiments, the 2’–OH is replaced with –OMe. In some embodiments, the 2’–OH is replaced with –OCH 2 CH 2 OMe (MOE).
  • Modified sugars also include locked nucleic acids (LNAs). In some embodiments, the locked nucleic acid has the structure indicated below.
  • each sugar of the oligonucleotide is or comprises a modified sugar moiety.
  • each sugar of the oligonucleotide is or comprises a 2’-MOE modified sugar.
  • each sugar of the oligonucleotide is or comprises a 2’-OMe modified sugar.
  • each sugar of the oligonucleotide is or comprises a 2’-OH modified sugar.
  • each sugar of the oligonucleotide is or comprises a 2’-H modified sugar.
  • the present disclosure provides an oligonucleotide comprising 2’-MOE modified sugar, 2’-OMe modified sugar, 2’-OH modified sugar, 2’-H modified sugar, or combinations thereof.
  • a provided oligonucleotide comprises at least one 2’-MOE sugar and at least one 2’-OH sugar (RNA sugar).
  • a provided oligonucleotide comprises at least one 2’-MOE sugar and at least one 2’-H sugar (DNA sugar).
  • the present invention provides an oligonucleotide comprising one or more modified internucleotidic linkages independently having the structure of formula I: wherein: P* is an asymmetric phosphorus atom and is either Rp or Sp configuration; W is O, S or Se; each of X, Y and Z is independently –O–, –S–, –N(–L–R 1 )–, or L; L is a covalent bond or an optionally substituted, linear or branched C 1 –C 10 alkylene, wherein one or more methylene units of L are optionally and independently replaced by an optionally substituted C 1 –C 6 alkylene, C 1 –C 6 alkenylene, –C(R′) 2 –, –Cy–, –O–, –S–, –S–S–, –N(R′)–, –C(O)–, –C(S)–, –C(NR′)–,
  • the internucleotidic linkage having the structure of formula I is , [0233]
  • an oligonucleotide comprises both non-natural internucleotidic linkage as described herein and natural phosphate linkage.
  • each internucleotidic linkages of the oligonucleotide is a non-natural internucleotidic linkage.
  • each internucleotidic linkages of the oligonucleotide is a chiral internucleotidic linkage.
  • each internucleotidic linkages of the oligonucleotide is a phosphorothioate linkage [0234] In some embodiments, each internucleotidic linkages of an oligonucleotide is a natural phosphate linkage. In some embodiments, an oligonucleotide comprises at least one natural phosphate linkage and at least one phosphodithioate linkage. In some embodiments, at least 50% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages. In some embodiments, at least 60% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages.
  • At least 70% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages. In some embodiments, at least 80% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages. In some embodiments, at least 90% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages. In some embodiments, at least 94% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages.
  • At least 95% internucleotidic linkages of an oligonucleotide are phosphodithioate linkages.
  • at least 50% internucleotidic linkages of an oligonucleotide are natural phosphate linkages.
  • at least 60% internucleotidic linkages of an oligonucleotide are natural phosphate linkages.
  • at least 70% internucleotidic linkages of an oligonucleotide are natural phosphate linkages.
  • at least 80% internucleotidic linkages of an oligonucleotide are natural phosphate linkages.
  • At least 90% internucleotidic linkages of an oligonucleotide are natural phosphate linkages. In some embodiments, at least 94% internucleotidic linkages of an oligonucleotide are natural phosphate linkages. In some embodiments, at least 95% internucleotidic linkages of an oligonucleotide are natural phosphate linkages. [0236] Among other things, the present disclosure provides oligonucleotides of various designs, which may comprises various nucleobases and patterns thereof, sugars and patterns thereof, internucleotidic linkages and patterns thereof, and/or additional chemical moieties and patterns thereof as described in the present disclosure.
  • provided oligonucleotides can downregulate the MuSK Ig3 domain protein expression, the MuSK Ig3 domain gene expression, and/or the MuSK Ig3 activation of BMP signaling level, thereby increasing adult hippocampal neurogenesis (AHN) and improving cognition in AD.
  • provided oligonucleotides can downregulate the MuSK Ig3 domain protein expression, the MuSK Ig3 domain gene expression, and/or the MuSK Ig3 activation of BMP signaling level, thereby increasing muscle regeneration.
  • provided oligonucleotides can direct a decrease in the expression, level and/or activity of MuSK Ig3 domain and/or one or more of its products in a cell of a subject or patient. In some embodiments, provided oligonucleotides can direct a decrease in the expression, level and/or activity of MuSK Ig3 domain and/or one or more of its products in a cell of a subject or patient, while the expression, level, and/or activity of all forms of MuSK remains substantially the same. In some embodiments, a cell normally expresses or produces protein encoded by MuSK Ig3 domain.
  • provided MuSK-targeting oligonucleotides can direct a decrease in the expression, level and/or activity of MuSK Ig3 domain gene or a gene product and have a base sequence which consists of, comprises, or comprises a portion (e.g., a span of 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more contiguous bases) of the base sequence of a oligonucleotide disclosed herein, wherein each T can be independently substituted with U and vice versa, and the oligonucleotide comprises at least one non-naturally-occurring modification of a base, sugar and/or internucleotidic linkage.
  • the naturally highly abundant full length MuSK harbors the BMP-binding Ig3 domain and potentiates BMP signaling and thus restrains neurogenesis.
  • ⁇ Ig3-MuSK has lower BMP signaling and promotes AHN and improves cognition.
  • the present disclosure provides exon-skipping MuSK- targeting oligonucleotides that switch MuSK from the AHN restraining full length MuSK to AHN permissive ⁇ Ig3-MuSK splice form.
  • the highly abundant full length MuSK harbors the BMP- binding Ig3 domain and potentiates BMP signaling and affects muscle regeneration.
  • ⁇ Ig3-MuSK has lower BMP signaling and promotes muscle regeneration and/or prevents muscle fibrosis.
  • the present disclosure provides exon- skipping MuSK-targeting oligonucleotides that switch MuSK from the full length MuSK to the muscle-promoting ⁇ Ig3-MuSK splice form.
  • one or more skipped exons are selected from exon 6 and/or 7 of the MuSK gene.
  • exon 6 of MuSK is skipped.
  • exon 7 of MuSK is skipped.
  • both exons 6 and 7 of MuSK are skipped.
  • a MuSK-targeting oligonucleotide described herein can provide exon-skipping of exon 6 and/or 7, but does not provide exon-skipping of exon 3 and/or 4. [0241] In some embodiments, a MuSK-targeting oligonucleotide described herein can provide exon-skipping of exon 6 and/or 7 at a greater level than it provides exon-skipping of exon 3 and/or 4.
  • a MuSK-targeting oligonucleotide described herein provides exon-skipping such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 70% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 80% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 90% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 40%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 30%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 20%.
  • a MuSK-targeting oligonucleotide alters the splicing of MuSK transcripts such that the level of MuSK transcripts including exons 6 and 7 or the level of MuSK protein forms including sequences encoded by exons 6 and 7, or both, decreases by greater than 60% and the level of MuSK transcripts including exons 3 and 4 or the level of MuSK protein forms including sequences encoded by exons 3 and 4, or both, decreases by less than 10%.
  • an active compound is an oligonucleotide that directs skipping of one or more exons in a MuSK gene.
  • an active compound is an oligonucleotide that directs skipping of multiple exons in a MuSK gene. In some embodiments, an active compound is an oligonucleotide that directs skipping of exon 6, exon 7, or both in a MuSK gene. In some embodiments, an active compound is an oligonucleotide that directs skipping of exon 6 in a MuSK gene. In some embodiments, an active compound is an oligonucleotide that directs skipping of exon 7 in a MuSK gene. In some embodiments, an active compound is an oligonucleotide that directs skipping of exons 6 and 7 in a MuSK gene.
  • a plurality of oligonucleotides may be used together.
  • two or more different exon skipping oligonucleotides e.g., at least one that directs skipping of exon 6 and one that directs skipping of exon 7
  • at least one exon skipping oligonucleotide may be used in combination with at least one degrading oligonucleotide (e.g., that targets a transcript for RNase H degradation) which, for example, may target MuSK transcript(s) that include a functional Ig3 domain, or portion thereof.
  • oligonucleotides are provided and/or utilized in salt forms.
  • oligonucleotides are provided as salts comprising negatively- charged internucleotidic linkages (e.g., phosphorothioate internucleotidic linkages, natural phosphate linkages, etc.) existing as their salt forms.
  • oligonucleotides are provided as pharmaceutically acceptable salts.
  • oligonucleotides are provided as metal salts.
  • oligonucleotides are provided as sodium salts.
  • oligonucleotides are provided as metal salts, e.g., sodium salts, wherein each negatively-charged internucleotidic linkage is independently in a salt form (e.g., for sodium salts, ⁇ O ⁇ P(O)(SNa) ⁇ O ⁇ for a phosphorothioate internucleotidic linkage, ⁇ O ⁇ P(O)(ONa) ⁇ O ⁇ for a natural phosphate linkage, etc.).
  • metal salts e.g., sodium salts
  • each negatively-charged internucleotidic linkage is independently in a salt form (e.g., for sodium salts, ⁇ O ⁇ P(O)(SNa) ⁇ O ⁇ for a phosphorothioate internucleotidic linkage, ⁇ O ⁇ P(O)(ONa) ⁇ O ⁇ for a natural phosphate linkage, etc.).
  • individual oligonucleotides within a composition may be considered to be of the same constitution and/or structure even though, within such composition (e.g., a liquid composition), particular such oligonucleotides might be in different salt form(s) (and may be dissolved and the oligonucleotide chain may exist as an anion form when, e.g., in a liquid composition) at a particular moment in time.
  • a composition e.g., a liquid composition
  • particular such oligonucleotides might be in different salt form(s) (and may be dissolved and the oligonucleotide chain may exist as an anion form when, e.g., in a liquid composition) at a particular moment in time.
  • individual internucleotidic linkages along an oligonucleotide chain may be in an acid (H) form, or in one of a plurality of possible salt forms (e.g., a sodium salt, or a salt of a different cation, depending on which ions might be present in the preparation or composition), and will understand that, so long as their acid forms (e.g., replacing all cations, if any, with H+) are of the same constitution and/or structure, such individual oligonucleotides may properly be considered to be of the same constitution and/or structure.
  • H acid
  • salt forms e.g., a sodium salt, or a salt of a different cation, depending on which ions might be present in the preparation or composition
  • an oligonucleotide composition comprises two or more oligonucleotides.
  • an oligonucleotide composition comprises two or more pluralities of oligonucleotides, wherein each plurality is independently a plurality of oligonucleotides as described herein. For example, in some embodiments, each plurality independently shares a same base sequence and the same internucleotidic linkages. In some embodiments, at least two pluralities or each plurality independently targets the same exon(s) of the same transcript (e.g., exons 6 and/or 7 of MuSK).
  • At least two pluralities or each plurality independently targets different exons of the same transcript (e.g., exons 3, 4, 6, and/or 7 of MuSK). In some embodiments, at least two pluralities or each plurality independently targets a different transcript of the same or different nucleic acids. In some embodiments, at least two pluralities or each plurality independently targets transcripts of a different gene. In some embodiments, at least two pluralities or each plurality independently targets different regions on the MuSK transcript. Among other things, such compositions may be utilized to target two or more targets, in some embodiments, simultaneously and in the same system.
  • MuSK-targeting oligonucleotides may be identified, assessed and/or characterized for one or more their physical/chemical properties and/or biological activities. Those skilled in the art will be aware of a variety of approaches, including particular assays, that may be utilized for such identification, assessment, and/or characterization.
  • a MuSK-targeting oligonucleotide as described herein is characterized in that, for example, the MuSK-targeting oligonucleotide, when contacted with a cell expressing MuSK, will increase the level or activity of MuSK ⁇ Ig3 mRNA and/or protein, e.g., relative to another MuSK form or other appropriate reference. In some embodiments, achieving such increase may be considered to represent “agonizing” MuSK ⁇ Ig3.
  • a MuSK-targeting oligonucleotide is characterized by its ability to alter splicing activity of MuSK pre-mRNA in a cell.
  • a cell may be transfected with a MuSK-targeting oligonucleotide, and after a period of incubation, expression of an alternative form of processed form of a MuSK RNA transcript (e.g., where exons 6 and 7 have been skipped), can be measured by RT-PCR.
  • an alternative form of processed form of a MuSK RNA transcript e.g., where exons 6 and 7 have been skipped
  • the efficiency of MuSK exon skipping in cultured cells greater than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 95%.
  • a MuSK-targeting oligonucleotide increases of MuSK ⁇ Ig3 mRNA.
  • a MuSK-targeting oligonucleotide alters splicing of MuSK pre- mRNA. In some aspects, a MuSK-targeting oligonucleotide promotes the skipping of exon 6 and/or exon 7. [0258] Modulation of expression of MuSK ⁇ Ig3 can be measured in a bodily fluid of a subject treated with MuSK MR-targeting oligonucleotide, which may or may not contain cells; tissue; or organ of the animal.
  • samples for analysis such as body fluids (e.g., sputum, serum, CSF), tissues (e.g., biopsy), or organs, and methods of preparation of the samples to allow for analysis are well known to those skilled in the art.
  • body fluids e.g., sputum, serum, CSF
  • tissues e.g., biopsy
  • organs e.g., organs
  • the effects of treatment on a subject can be assessed by measuring biomarkers associated with the target gene expression in one or more biological fluids, tissues or organs, collected from an animal contacted with one or more compositions described in this application.
  • an increase in MuSK ⁇ Ig3 mRNA means that the intracellular level of MuSK ⁇ Ig3 mRNA is higher than a reference level, such as the level of MuSK ⁇ Ig3 mRNA in a control (for example in a subject that is not being administered an MuSK-targeting oligonucleotide).
  • a reference level such as the level of MuSK ⁇ Ig3 mRNA in a control (for example in a subject that is not being administered an MuSK-targeting oligonucleotide).
  • An increase in intracellular MuSK ⁇ Ig3 mRNA can be measured as an increase in the level of MuSK ⁇ Ig3 protein and/or mRNA produced.
  • an increase in MuSK ⁇ Ig3 mRNA can be determined by e.g., methods as described below in the examples, and/or by assay techniques such as RNA solution hybridization, nuclease protection, Northern hybridization, reverse transcription, gene expression monitoring with a microarray, antibody binding, enzyme linked immunosorbent assay (ELISA), nucleic acid sequencing, Western blotting, radioimmunoassay (RIA), other immunoassays, fluorescence activated cell analysis (FACS), or any other technique or combination of techniques that can detect the presence of MuSK ⁇ Ig3 mRNA or protein (e.g., in a subject or a sample obtained from a subject).
  • assay techniques such as RNA solution hybridization, nuclease protection, Northern hybridization, reverse transcription, gene expression monitoring with a microarray, antibody binding, enzyme linked immunosorbent assay (ELISA), nucleic acid sequencing, Western blotting, radioimmunoassay (RIA), other immunoassays, fluorescence activate
  • the level of MuSK ⁇ Ig3 mRNA in a sample obtained from a subject receiving a MuSK-targeting oligonucleotide treatment to a level of MuSK ⁇ Ig3 mRNA in a subject not treated with a MuSK-targeting oligonucleotide
  • the extent to which the MuSK-targeting oligonucleotide treatment increased MuSK ⁇ Ig3 mRNA can be determined.
  • the reference level of MuSK ⁇ Ig3 mRNA is obtained from the same subject prior to receiving MuSK-targeting oligonucleotide treatment.
  • the reference level of MuSK ⁇ Ig3 mRNA is a range determined by a population of subjects not receiving MuSK-targeting oligonucleotide treatment. In some embodiments, the level of full-length MuSK mRNA is compared to the level of MuSK ⁇ Ig3 mRNA.
  • the ratio of the MuSK ⁇ Ig3 mRNA to a full length MuSK mRNA (e.g., MuSK mRNA without exons 6 and 7) in a subject receiving a MuSK-targeting oligonucleotide treatment for example, greater than 1 fold, 1.5-5 fold, 5-10 fold, 10-50 fold, 50-100 fold, about 1.1-, 1.2-, 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 30-, 40-, 50-, 60-, 70-, 80- , 90-, l00-fold or more higher than a reference ratio.
  • an increased level of MuSK ⁇ Ig3 mRNA is, for example, greater than 1 fold, 1.5-5 fold, 5-10 fold, 10-50 fold, 50-100 fold, about 1.1-, 1.2-, 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 30-, 40-, 50-, 60-, 70-, 80-, 90-, 100-fold or more higher than a reference value.
  • the increase of MuSK ⁇ Ig3 mRNA in a subject can be indicated by the increase of MuSK ⁇ Ig3 protein as compared to a reference level.
  • the reference level of MuSK ⁇ Ig3 protein is the MuSK ⁇ Ig3 protein level obtained from a subject having or at risk of having e.g., AD or a disease characterized by neurodegeneration. In some embodiments, the reference level of MuSK ⁇ Ig3 protein is the MuSK ⁇ Ig3 protein level obtained from a subject having or at risk of having e.g., neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting prior to treatment.
  • Methods whereby bodily fluids, organs or tissues are contacted with an effective amount of one or more compositions described herein are also contemplated.
  • Bodily fluids, organs or tissues can be contacted with one or more compositions comprising MuSK-targeting oligonucleotides, resulting in expression of MuSK ⁇ Ig3 and modulation of MuSK expression in the cells of bodily fluids, organs or tissues.
  • An effective amount of can be determined by monitoring the effect on functional MuSK ⁇ Ig3 protein expression of MuSK-targeting oligonucleotides that are administered to a subject or contacted to a cell.
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells, (e.g., comprising NSCs and/or neural progenitor cells (MPCs)), increases the number of cells that are in an activated state (e.g., active proliferation).
  • a population of cells e.g., comprising NSCs and/or neural progenitor cells (MPCs)
  • MPCs neural progenitor cells
  • a MuSK- targeting oligonucleotide or composition comprising the same when administered to a population of cells comprising NSCs, decreases the number of quiescent NSCs in the population and/or increases the number of activated NSCs.
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells, (e.g., comprising satellite cells (SCs), myoblasts, myogenic progenitor cells (MPCs)), increases the number of cells that are in an activated state (e.g., active proliferation).
  • SCs satellite cells
  • MPCs myogenic progenitor cells
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells comprising satellite cells, decreases the number of quiescent satellite cells in the population and/or increases the number of activated satellite cells.
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells comprising NSCs and/or NPCs, increases the number of cells expressing genes associated with early neurons (e.g., Dex) and/or decreases the number of cells expressing genes associated with mature neurons (e.g., Map2), astrocytes (e.g., GFAP and S100b), and/or oligodendrocytes (e.g., CNPase and O4).
  • early neurons e.g., Dex
  • Map2 e.g., astrocytes
  • astrocytes e.g., GFAP and S100b
  • oligodendrocytes e.g., CNPase and O4
  • a MuSK-targeting oligonucleotide when administered to a population of cells comprising NSCs and/or NPCs, increases the level of expression of genes associated with early neurons (e.g., Dex) and/or decreases the level of expression of genes associated with mature neurons (e.g., Map2), astrocytes (e.g., GFAP and S100b), and/or oligodendrocytes (e.g., CNPase and O4) in the population of cells.
  • a population of cells comprises NSCs that have been induced to be NSCs (e.g., from stem cells such as embryonic stems cells or pluripotent stem cells).
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells comprising SCs, MPCs, and/or myoblasts, increases the number of cells expressing genes or myogenic factors (e.g., Pax7, MyoD, myogenin, and MERGE) and/or decreases the number of cells expressing genes associated with the MuSK-BMP signaling pathway (e.g., RGS4, Msx2, Myf5, Ptx3, Id1).
  • myogenic factors e.g., Pax7, MyoD, myogenin, and MERGE
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a population of cells comprising satellite cells and/or myoblasts, increases the level of expression of genes associated with myogenic factors (e.g., Pax7, MyoD, myogenin, and MERGE) and/or decreases the level of expression of genes associated the MuSK-BMP signaling pathway (e.g., RGS4, Msx2, Myf5, Ptx3, Id1) in the population of cells.
  • myogenic factors e.g., Pax7, MyoD, myogenin, and MERGE
  • genes associated the MuSK-BMP signaling pathway e.g., RGS4, Msx2, Myf5, Ptx3, Id1
  • a population of cells comprises satellite cells and/or myoblasts that have been induced to be satellite cells and/or myoblasts (e.g., from stem cells such as embryonic stems cells or pluripotent stem cells).
  • a population of cells is obtained from a healthy subject.
  • a population of cells is obtained from a subject having or at risk of having e.g., AD or a disease characterized by neurodegeneration or a subject suffering from a disease or disorder such as a neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • a MuSK-targeting oligonucleotide or composition comprising the same when contacted with a population of cells from a subject, increases neurogenesis in a subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same is contacted with the population of cells in vivo, for example, by injection into a subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same is contacted with the population of cells ex vivo by obtaining a population of cells from a subject, and neurogenesis is increased when the treated cells are re-introduced into the subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same when contacted with a population of cells from a subject, increases muscle regeneration and/or growth in a subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same is contacted with the population of cells in vivo, for example, by injection into a subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same is contacted with the population of cells ex vivo by obtaining a population of cells from a subject, and muscle regeneration is increased when the treated cells are re-introduced into the subject.
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a subject, will increase neurogenesis and/or growth, and/or improve cognition. Examples of methods to assess these biological effects are detailed, e.g., in the below examples.
  • a MuSK-targeting oligonucleotide or composition comprising the same when administered to a subject, will increase muscle regeneration and/or growth, and/or neuromuscular function, and/or myogenesis. Examples of methods to assess these biological effects are detailed, e.g., in the below examples.
  • a MuSK-targeting oligonucleotide described herein can be synthesized by standard methods known in the art, e.g., by use of an automated synthesizer. Following chemical synthesis (e.g., solid-phase synthesis using phosphoramidite method), oligonucleotide molecules can be deprotected, annealed to ds molecules, and purified (e.g., by gel electrophoresis or HPLC). Protocols for preparation of MuSK-targeting oligonucleotide oligonucleotides are known in the art.
  • the present disclosure provides technologies for preparing chirally controlled oligonucleotides and compositions thereof. In some embodiments, the present disclosure provides technologies for preparing stereopure oligonucleotides and compositions thereof. In some embodiments, provided oligonucleotides and compositions thereof are of high purity. In some embodiments, oligonucleotides of the present disclosure are at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% stereochemically pure at linkage phosphorus of chiral internucleotidic linkages. In some embodiments, oligonucleotides of the present disclosure are prepared stereoselectively and are substantially free of stereoisomers.
  • compositions comprising a plurality of oligonucleotides which share the same base sequence of the same pattern of chiral linkage phosphorus stereochemistry (e.g., comprising one or more of Rp and/or Sp, wherein each chiral linkage phosphorus is independently Rp or Sp), at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of all oligonucleotides in the composition that share the same base sequence as oligonucleotides of the plurality share the same pattern of chiral linkage phosphorus stereochemistry or are oligonucleotides of the plurality.
  • compositions comprising a plurality of oligonucleotides which share the same base sequence of the same pattern of chiral linkage phosphorus stereochemistry, at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of all oligonucleotides in the composition that share the same constitution as oligonucleotides of the plurality share the same pattern of chiral linkage phosphorus stereochemistry or are oligonucleotides of the plurality.
  • MuSK-targeting oligonucleotides can also be formed within a cell by transcription of RNA from an expression construct introduced into the cell (see, e.g., Yu et al., Proc. Natl.
  • An expression construct for in vivo production of oligonucleotide molecules can include one or more antisense encoding sequences operably linked to elements necessary for the proper transcription of the antisense encoding sequence(s), including, e.g., promoter elements and transcription termination signals.
  • Preferred promoters for use in such expression constructs include the polymerase-III HI-RNA promoter (see, e.g., Brummelkamp et al., Science 2002; 296:550-553) and the U6 polymerase-III promoter (see, e.g., Sui et al., Proc. Natl. Acad. Sci.
  • a MuSK-targeting oligonucleotide expression construct can further comprise one or more vector sequences that facilitate the cloning of the expression construct.
  • Standard vectors that can be used include, e.g., pSilencer 2.0-U6 vector (Ambion Inc., Austin, Tex.).
  • Pharmaceutical Compositions [0277] The present disclosure provides pharmaceutical compositions that comprise and/or deliver MuSK-targeting oligonucleotides as described herein.
  • a provided pharmaceutical composition may comprise and/or deliver MuSK-targeting oligonucleotides that, when administered, achieves an increase in level and/or activity of a MuSK polypeptide (e.g., a MuSK ⁇ Ig3 polypeptide, or another MuSK variant polypeptide with disrupted Ig3) that lacks an Ig3 domain functional for interaction with BMP.
  • a MuSK polypeptide e.g., a MuSK ⁇ Ig3 polypeptide, or another MuSK variant polypeptide with disrupted Ig3
  • a provided pharmaceutical composition may comprise and/or deliver a population of cells that has been exposed to a MuSK-targeting oligonucleotide, so that neuronal cell number and/or activity is increased in the population.
  • a pharmaceutical composition will be or comprise an active agent (e.g., a MuSK-targeting oligonucleotide as described herein or a precursor thereof) in combination with one or more pharmaceutically acceptable excipients.
  • an active agent e.g., a MuSK-targeting oligonucleotide as described herein or a precursor thereof
  • components of a particular pharmaceutical composition may be influenced by route of administration of the pharmaceutical composition.
  • the compositions of the disclosure can be formulated for a variety of modes of administration, including systemic and topical or localized administration.
  • compositions of the present invention can be prepared and administered in a wide variety of oral, parenteral, and topical dosage forms.
  • the compositions of the present invention can be administered by injection (e.g. intravenously, intramuscularly, intracutaneously, subcutaneously, intraduodenally, or intraperitoneally).
  • the compositions described herein can be administered by inhalation, for example, intranasally.
  • the composition of the present invention can be administered transdermally. It is also envisioned that multiple routes of administration (e.g., intramuscular, oral, transdermal) can be used to administer the compositions of the invention.
  • a pharmaceutical composition as described herein may be formulated for delivery by a route selected from intravenous injection, intrathecal administration, oral administration, buccal administration, inhalation, nasal administration, topical administration, ophthalmic administration or otic administration.
  • a pharmaceutical composition may be formulated for delivery by intrathecal administration.
  • a pharmaceutical composition may be formulated for delivery by intravenous administration.
  • a pharmaceutical composition may be formulated for delivery by oral administration.
  • oligonucleotides and compositions are delivered to the CNS. In certain embodiments, oligonucleotides and compositions are delivered to the cerebrospinal fluid.
  • oligonucleotides and compositions are administered to the brain parenchyma. In certain embodiments, oligonucleotides and compositions are delivered to an animal/subject by intrathecal administration, or intracerebroventricular administration. Broad distribution of oligonucleotides and compositions, described herein, within the central nervous system may be achieved with intraparenchymal administration, intrathecal administration, or intracerebroventricular administration.
  • parenteral administration is by injection, by, e.g., a syringe, a pump, etc. In certain embodiments, the injection is a bolus injection.
  • the injection is administered directly to a tissue, such as striatum, caudate, cortex, hippocampus and cerebellum.
  • a tissue such as striatum, caudate, cortex, hippocampus and cerebellum.
  • methods of specifically localizing a pharmaceutical agent decreases median effective concentration (EC50) by a factor of 20, 25, 30, 35, 40, 45 or 50.
  • the pharmaceutical agent in an antisense compound as further described herein.
  • the targeted tissue is brain tissue.
  • the targeted tissue is hippocampus tissue.
  • decreasing EC50 is desirable because it reduces the dose required to achieve a pharmacological result in a patient in need thereof.
  • an antisense oligonucleotide is delivered by injection or infusion once every month, every two months, every 90 days, every 3 months, every 6 months, twice a year or once a year.
  • these pharmaceutical compositions may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of an active compound into preparations which can be used pharmaceutically.
  • the preparations formulated for oral administration may be in the form of tablets, dragees, capsules, or solutions.
  • compositions for oral use can be obtained by combining an active compound with solid excipients, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethyl-cellulose (CMC), and/or polyvinylpyrrolidone (PVP: povidone).
  • CMC carboxymethyl-cellulose
  • PVP polyvinylpyrrolidone
  • disintegrating agents may be added, such as the cross-linked polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • Dragee cores are provided with suitable coatings.
  • suitable coatings may be used, which may optionally contain gum arabic, talc, polyvinylpyrrolidone, carbopol gel, polyethylene glycol (PEG), and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dye-stuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
  • compositions that can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin, and a plasticizer, such as glycerol or sorbitol.
  • the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • an active compound may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols (PEGs).
  • PEGs liquid polyethylene glycols
  • stabilizers may be added.
  • the pharmaceutical composition is a tablet, a pill, a capsule, a liquid, an inhalant, a nasal spray solution, a suppository, a suspension, a gel, a colloid, a dispersion, a suspension, a solution, an emulsion, an ointment, a lotion, an eye drop or an ear drop.
  • pharmaceutical composition of the present disclosure may be formulated into liquid or solid dosage forms and administered systemically or locally.
  • the pharmaceutical composition may be delivered, for example, in a timed- or sustained- low release form as is known to those skilled in the art.
  • Suitable routes may include oral, buccal, by inhalation spray, sublingual, rectal, transdermal, vaginal, transmucosal, nasal or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intra-articullar, intra- sternal, intra-synovial, intra-hepatic, intralesional, intracranial, intraperitoneal, intranasal, or intraocular injections or other modes of delivery.
  • the pharmaceutical composition of the disclosure may be formulated and diluted in aqueous solutions, such as in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline buffer.
  • physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
  • Use of pharmaceutically acceptable inert carriers to formulate the compositions herein disclosed for the practice of the disclosure into dosages suitable for systemic administration is within the scope of the disclosure. With proper choice of carrier and suitable manufacturing practice, the compositions of the present disclosure, in particular, those formulated as solutions, may be administered parenterally, such as by intravenous injection.
  • compositions as described herein can be formulated using pharmaceutically acceptable carriers available in the art into dosages suitable for oral administration.
  • Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject (e.g., patient) to be treated.
  • a subject e.g., patient
  • solubilizing, diluting, or dispersing substances such as, saline, preservatives, such as benzyl alcohol, absorption promoters, and fluorocarbons, may be employed.
  • a provided composition may comprise and/or deliver a precursor of an active agent, wherein the precursor becomes or releases active therapeutic agent upon administration.
  • a precursor may be or comprise a prodrug of a small molecule agonizing agent, or a nucleic acid that encodes a protein agonizing agent, etc.
  • a provided pharmaceutical composition comprises or delivers a therapeutically effective amount (e.g., an amount that is effective when administered according to an established protocol) of a provided oligonucleotide (which may, as described herein, be provided in a pharmaceutically acceptable salt form, e.g., as a sodium salt, ammonium salt, etc.); in some embodiments, such a provided pharmaceutical composition includes a relevant oligonucleotide and at least one pharmaceutically acceptable inactive ingredient selected from pharmaceutically acceptable diluents, pharmaceutically acceptable excipients, and pharmaceutically acceptable carriers.
  • a therapeutically effective amount e.g., an amount that is effective when administered according to an established protocol
  • a provided oligonucleotide which may, as described herein, be provided in a pharmaceutically acceptable salt form, e.g., as a sodium salt, ammonium salt, etc.
  • such a provided pharmaceutical composition includes a relevant oligonucleotide and at least one pharmaceutically acceptable inactive ingredient selected from pharmaceutical
  • a salt form of a provided oligonucleotide comprises two or more cations, for example, in some embodiments, up to the number of negatively charged acidic groups (e.g., phosphate, phosphorothioate, etc.) in an oligonucleotide.
  • negatively charged acidic groups e.g., phosphate, phosphorothioate, etc.
  • salts are generally well known to those of ordinary skill in the art, and may include, by way of example but not limitation, acetate, benzenesulfonate, besylate, benzoate, bicarbonate, bitartrate, bromide, calcium edetate, carnsylate, carbonate, citrate, edetate, edisylate, estolate, esylate, fumarate, gluceptate, gluconate, glutamate, glycollylarsanilate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, isethionate, lactate, lactobionate, malate, maleate, mandelate, mesylate, mucate, napsylate, nitrate, pamoate (embonate), pantothenate, phosphate/diphosphate, polygalacturonate, salicy
  • oligonucleotides may be formulated as a number of salts for, e.g., pharmaceutical uses.
  • a salt is a metal cation salt and/or ammonium salt.
  • a salt is a metal cation salt of an oligonucleotide.
  • a salt is an ammonium salt of an oligonucleotide.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • a salt is a sodium salt of an oligonucleotide.
  • pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed with counterions such as hydroxide, carboxylate, sulfate, phosphate, nitrate, sulfonate, phosphorothioate, etc.
  • a salt of an oligonucleotide may contain more than one cations, e.g., sodium ions, as there may be more than one anions within an oligonucleotide.
  • provided oligonucleotides, and compositions thereof may be effective over a wide dosage range. For example, in the treatment of adult humans, dosages from about 0.01 to about 1000 mg, from about 0.5 to about 100 mg, from about 1 to about 50 mg per day, and from about 5 to about 100 mg per day are examples of dosages that may be used.
  • the present disclosure provides technologies (e.g., compositions, methods, etc.) for combination therapy, for example, with other therapeutic agents and/or medical procedures.
  • provided oligonucleotides and/or compositions may be used together with one or more other therapeutic agents.
  • provided compositions comprise provided oligonucleotides, and one or more other therapeutic agents.
  • the one or more other therapeutic agents may have one or more different targets, and/or one or more different mechanisms toward targets, when compared to provided oligonucleotides in the composition.
  • a therapeutic agent is an oligonucleotide.
  • a therapeutic agent is a small molecule drug.
  • a therapeutic agent is a protein.
  • a therapeutic agent is an antibody. A number of a therapeutic agent may be utilized in accordance with the present disclosure.
  • provided oligonucleotides or compositions thereof are administered prior to, concurrently with, or subsequent to one or more other therapeutic agents and/or medical procedures.
  • provided oligonucleotides or compositions thereof are administered concurrently with one or more other therapeutic agents and/or medical procedures. In some embodiments, provided oligonucleotides or compositions thereof are administered prior to one or more other therapeutic agents and/or medical procedures. In some embodiments, provided oligonucleotides or compositions thereof are administered subsequent to one or more other therapeutic agents and/or medical procedures. In some embodiments, provide compositions comprise one or more other therapeutic agents.
  • pharmaceutically acceptable carriers can be either solid or liquid. Solid form preparations include powders, tablets, pills, capsules, cachets, suppositories, and dispersible granules.
  • a solid carrier can be one or more substance that may also act as diluents, flavoring agents, binders, preservatives, tablet disintegrating agents, or an encapsulating material.
  • the carrier is a finely divided solid in a mixture with the finely divided active component.
  • the active component is mixed with the carrier having the necessary binding properties in suitable proportions and compacted in the shape and size desired.
  • the powders and tablets preferably contain from 5% to 70% of the therapeutic agent.
  • Suitable carriers are magnesium carbonate, magnesium stearate, talc, sugar, lactose, pectin, dextrin, starch, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose, a low melting wax, cocoa butter, and the like.
  • the term “preparation” is intended to include the formulation of the active therapeutic agent with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
  • cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
  • a low melting wax such as a mixture of fatty acid glycerides or cocoa butter
  • the active component is dispersed homogeneously therein, as by stirring.
  • the molten homogeneous mixture is then poured into convenient sized molds, allowed to cool, and thereby to solidify.
  • Liquid form preparations include solutions, suspensions, and emulsions, for example, water or water/propylene glycol solutions.
  • liquid preparations can be formulated in solution in aqueous polyethylene glycol solution.
  • compositions of the invention are injectable, sterile solutions, preferably oily or aqueous solutions, as well as suspensions, emulsions, or implants, including suppositories.
  • carriers for parenteral administration include aqueous solutions of dextrose, saline, pure water, ethanol, glycerol, propylene glycol, peanut oil, sesame oil, polyoxyethylene-block polymers, and the like. Ampoules are convenient unit dosages.
  • the compositions of the invention can also be incorporated into liposomes or administered via transdermal pumps or patches.
  • compositions suitable for use in the present invention include those described, for example, in Pharmaceutical Sciences (17th Ed., Mack Pub. Co., Easton, PA) and WO 96/05309, which is herein incorporated by reference.
  • Aqueous solutions suitable for oral use can be prepared by dissolving the active component in water and adding suitable colorants, flavors, stabilizers, and thickening agents as desired.
  • Aqueous suspensions suitable for oral use can be made by dispersing the finely divided active component in water with viscous material, such as natural or synthetic gums, resins, methylcellulose, sodium carboxymethylcellulose, and other well-known suspending agents.
  • viscous material such as natural or synthetic gums, resins, methylcellulose, sodium carboxymethylcellulose, and other well-known suspending agents.
  • solid form preparations that are intended to be converted, shortly before use, to liquid form preparations for oral administration.
  • Such liquid forms include solutions, suspensions, and emulsions. These preparations may contain, in addition to the active component, colorants, flavors, stabilizers, buffers, artificial and natural sweeteners, dispersants, thickeners, solubilizing agents, and the like.
  • the pharmaceutical preparation is preferably in unit dosage form. In such form the preparation is subdivided into unit doses containing appropriate quantities of the active component.
  • the unit dosage form can be a packaged preparation, the package containing discrete quantities of preparation, such as packeted tablets, capsules, and powders in vials or ampoules. Also, the unit dosage form can be a capsule, tablet, cachet, or lozenge itself, or it can be the appropriate number of any of these in packaged form.
  • an appropriate patient or population is one suffering from and/or susceptible to a disease, disorder or a condition associated with neurodegeneration (e.g., AD) or that otherwise would benefit from increased neurogenesis.
  • an appropriate patient or population is one suffering from and/or susceptible to a disease, disorder such as neuromuscular dysfunction, a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting or that otherwise would benefit from increased muscle regeneration).
  • such neurodegenerative disease, disorder, or condition is one or more of Alzheimer’s Disease (AD), Parkinson’s disease, dementia (e.g., Frontotemporal dementia), stroke, Major Depressive Disorder (MDD), bipolar disorder, Schizophrenia, Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking), Temporal-Lobe Epilepsy, Hippocampal Sclerosis, Niemann Pick Type C, Diabetes-mediated hippocampal neuronal loss, brain injury (e.g., traumatic and/or anoxic brain injury), and Huntington’s disease.
  • AD Alzheimer’s Disease
  • Parkinson’s disease dementia
  • dementia e.g., Frontotemporal dementia
  • stroke e.g., Frontotemporal dementia
  • MDD Major Depressive Disorder
  • MDD Major Depressive Disorder
  • Schizophrenia e.g., Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette
  • population may additionally or alternatively be suffering from and/or susceptible to a disease or disorder of the lung.
  • a disease or disorder is one or more of idiopathic pulmonary fibrosis (IPF), acute respiratory distress syndrome (ARDS), pneumonia, and lung complications due to viral infections.
  • IPF idiopathic pulmonary fibrosis
  • ARDS acute respiratory distress syndrome
  • pneumonia a disease or disorder of the lung.
  • an appropriate patient or population is model organisms. In some embodiments, an appropriate patient or population is humans.
  • a human has an age in a range of from about 0 months to about 6 months old, from about 6 to about 12 months old, from about 6 to about 18 months old, from about 18 to about 36 months old, from about 1 to about 5 years old, from about 5 to about 10 years old, from about 10 to about 15 years old, from about 15 to about 20 years old, from about 20 to about 25 years old, from about 25 to about 30 years old, from about 30 to about 35 years old, from about 35 to about 40 years old, from about 40 to about 45 years old, from about 45 to about 50 years old, from about 50 to about 55 years old, from about 55 to about 60 years old, from about 60 to about 65 years old, from about 65 to about 70 years old, from about 70 to about 75 years old, from about 75 to about 80 years old, from about 80 to about 85 years old, from about 85 to about 90 years old, from about 90 to about 95 years old or from about 95 to about 100 years old.
  • a human is a human infant. In some embodiments, a human is a human toddler. In some embodiments, a human is a human child. In some embodiments, a human is a human adult. In yet other embodiments, a human is an elderly human.
  • an appropriate patient or population may be characterized by one or more criterion such as age group, gender, genetic background, preexisting clinical conditions, prior exposure to therapy. [0319] In some embodiments, an appropriate patient or population is one suffering from e.g., neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • an appropriate patient or population is one suffering that has received surgery or experienced injury, trauma and/or prolonged immobilization (e.g., from bed-rest or casting).
  • an appropriate patient or population is one suffering from sarcopenia.
  • an appropriate patient or population is one suffering from or at risk of muscle fibrosis resulting from a disease or condition including, but not limited to, trauma, heritable disease, muscle disorder, and aging. Trauma can result from, for example, radiation treatment, crush injury, laceration, and amputation.
  • an appropriate patient or population is one suffering from or at risk of heritable disease associated with muscle fibrosis such as Congenital Muscular Dystrophy, Duchenne Muscular Dystrophy, Becker’s Muscular Dystrophy, Amyotrophic Lateral Sclerosis (ALS), age- associated sarcopenia, Distal muscular dystrophy, Emery-Dreifuss muscular dystrophy, Facioscapulohumeral muscular dystrophy, Limb-girdle muscular dystrophy, Myotonic muscular dystrophy, and Oculo-pharyngeal muscular dystrophy.
  • an appropriate patient or population maybe defined by those in accordance with the screening tools for diseases or disorders associated with Alzheimer’s disease.
  • an appropriate patient or population maybe defined by those in accordance with the screening tools for other diseases characterized by neurodegeneration, e.g., Parkinson’s disease, dementia (e.g., Frontotemporal dementia), stroke, Major Depressive Disorder (MDD), bipolar disorder, Schizophrenia, Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and lifelong cigarette smoking), Temporal-Lobe Epilepsy, Hippocampal Sclerosis, Niemann Pick Type C, Diabetes-mediated hippocampal neuronal loss, brain injury (e.g., traumatic and/or anoxic brain injury), and Huntington’s disease.
  • Parkinson Parkinson’s disease
  • dementia e.g., Frontotemporal dementia
  • stroke e.g., Frontotemporal dementia
  • MDD Major Depressive Disorder
  • MDD Major Depressive Disorder
  • Schizophrenia e.g., Post-Traumatic Stress Disorder (PTSD), substance-related and addictive disorders (e.g., chronic cocaine use and life
  • an appropriate patient or population maybe defined by those in accordance with the screening tools for diseases or disorders associated with muscle fibrosis and/or muscle wasting. In some embodiments, an appropriate patient or population maybe defined by those in accordance with the screening tools and methods for diagnosing a disease associated with muscle fibrosis and/or muscle wasting. [0322] In some embodiments, an appropriate patient or population may be defined according to the results obtained in structural imaging (e.g., magnetic resonance imaging (MRI), computed tomography (CT), ultrasound etc.). In some embodiments, an appropriate patient or population may be defined according to the results of cognitive tests. In some embodiments, an appropriate patient or population may be defined according to the results of neurological tests.
  • structural imaging e.g., magnetic resonance imaging (MRI), computed tomography (CT), ultrasound etc.
  • an appropriate patient or population may be defined according to the results of cognitive tests.
  • an appropriate patient or population may be defined according to the results of neurological tests.
  • the cognitive tests involve one or more tests of Motor Screening Task (MOT), Reaction Time (RTI), Paired Associates Learning (PAL), Spatial Working Memory (SWM), Pattern Recognition Memory (PRM), Delayed Matching to Sample (DMS), Rapid Visual Information Processing (RVP). Rapid Visual Information Processing (RVP), Delayed Matching to Sample (DMS), Match to Sample Visual Search (MTS).
  • MOT Motor Screening Task
  • RTI Reaction Time
  • PAL Paired Associates Learning
  • SWM Spatial Working Memory
  • PRM Pattern Recognition Memory
  • DSS Delayed Matching to Sample
  • RVP Rapid Visual Information Processing
  • Rapid Visual Information Processing Rapid Visual Information Processing
  • Delayed Matching to Sample DMS
  • Match to Sample Visual Search MFS
  • assessments such as measuring muscle enzymes, EMG, muscle biopsy, genetic testing, heart testing (e.g., ECG), assessments of strength and respiratory function.
  • dosage administered to a subject may vary, for example depending on the particular therapeutic and/or formulation employed, the method of administration, the dosing regimen, one or more characteristics of the particular subject being treated, etc..
  • a clinician skilled in the art will determine the therapeutically effective amount of a therapeutic to be administered to a human or other subject in order to treat or prevent a particular medical condition.
  • the precise amount of the therapeutic required to be therapeutically effective will depend upon numerous factors, e.g., such as the specific activity of the therapeutic, and the route of administration, in addition to many subject-specific considerations, which are within those of skill in the art.
  • administration may be ocular, oral, buccal, dermal (which may be or comprise, for example, one or more of topical to the dermis, intradermal, interdermal, transdermal, etc), enteral, intra-arterial, intradermal, intragastric, intramedullary, intramuscular, intranasal, intraperitoneal, intrathecal, intravenous, intraventricular, within a specific organ (e.g., intrahepatic), mucosal, nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
  • a specific organ e.g., intrahepatic
  • mucosal nasal, oral, rectal, subcutaneous, sublingual, topical, tracheal (e.g., by intratracheal instillation), vaginal, vitreal, etc.
  • a MuSK-targeting oligonucleotide composition may be desirable to achieve delivery of a MuSK-targeting oligonucleotide composition to muscle.
  • a MuSK-targeting oligonucleotide composition is delivered via systemic delivery and/or local delivery to muscle (e.g., via intramuscular injection).
  • a MuSK-targeting oligonucleotide composition is administered using a viral vector to effectively deliver a MuSK-targeting oligonucleotide composition in the form of a nucleic acid payload.
  • a viral vector targets certain cell types (e.g., myoblasts, myocytes, myotubes, satellite cells and myofibers).
  • AAV1, AAV6, and AAV9 vectors have been used to target different muscle cell types (See, for example, Arnett et al., Mol Ther Methods Clin Dev.1. pii: 14038, 2014 and Riaz et al., Skeletal Muscle 5 (37) 2015).
  • a MuSK-targeting oligonucleotide composition to the CNS, and, in some embodiments to the brain.
  • systemic administration achieves delivery to CNS (e.g., brain e.g., hippocampus and/or subventricular zone).
  • an agent e.g., an agonizing agent or MuSK-targeting oligonucleotide
  • CNS central nervous system
  • certain viral vectors are known to selectively target neurons, and to effectively deliver genetic payloads to the brain.
  • AAV2/1 vectors have been established to effectively deliver nucleic acid payloads (e.g., gene therapy, encoded RNAs, etc) to neuronal cells in the hippocampus. See, for example, Hammond et al PLoS One 12:e0188830, 2017; Guggenhuber et al PLoS One 5:e15707, 2010; Lawlor et al Mol. Neurodeg.2:11, 2007).
  • certain AAV vectors e.g., AAV2/1 and/or AAV4 vectors
  • AAV2/1 and/or AAV4 vectors have been established to target and effectively deliver nucleic acid payloads to certain cells in the subventricular zone cells.
  • effective delivery may be achieved by local administration to the CNS and/or to the brain, for example by intrathecal and/or intracavitary (e.g., intracerebroventricular) delivery.
  • intrathecal and/or intracavitary e.g., intracerebroventricular
  • intracavitary e.g., intracerebroventricular
  • technologies for local administration to the CNS and/or to the brain have been developed and demonstrated to be effective, for example, for various protein therapeutics (see, for example Calias et al., Pharmacol. & Therap.144:122, 2014), for small molecules (see, for example, Dodou Pharm.
  • Systemic administration technologies including, e.g., oral, parenteral, mucosal, etc
  • Systemic administration that achieves CNS and/or brain delivery may depend on ability to cross the blood brain barrier (BBB).
  • BBB blood brain barrier
  • Certain active agents and/or delivery systems are known to cross the BBB.
  • Recent technologies have been shown to achieve CNS and/or brain delivery even of agents, such as oligonucleotides, that had historically been considered to be particularly challenging in that regard. To give but one example, Min et al.
  • LNAs locked nucleic acids
  • a bridge is introduced that connects the 2′ oxygen and 4′ carbon.
  • This modification substantially elevates the melting temperature of the LNA–DNA and LNA–RNA hybrids, thus allowing the creation of shorter ODN-based compounds with increased bioavailability and reduced manufacturing costs.
  • oligonucleotides are developed to enhance their delivery to target site(s).
  • additional chemical moieties e.g., a carrier or ligand
  • oligonucleotides can be covalently conjugated to lipids (e.g., cholesterol that facilitates interactions with lipoprotein particles in the circulation), peptides (for cell targeting and/or cell penetration), aptamers, antibodies and sugars (e.g., N-acetyl galactosamine to enhance safer delivery to the target site (See Verma, Ann Indian Acad Neurol.201821(1): 3– 8.
  • lipids e.g., cholesterol that facilitates interactions with lipoprotein particles in the circulation
  • peptides for cell targeting and/or cell penetration
  • aptamers e.g., N-acetyl galactosamine to enhance safer delivery to the target site
  • lipid conjugates include, e.g., oligonucleotides bound to Cholesterol, ⁇ -tocopherol (vitamin E), long-chain (>C18) fatty acids, lipoprotein particles (for example, HDL and LDL), etc.
  • conjugation of N- acetylgalactosamine (GalNAc) can enhance the uptake of oligonucleotides into target sites (e.g., hepatocytes).
  • antibody and aptamer conjugates can be used to enhance oligonucleotide delivery.
  • Various receptors have been successfully targeted for oligonucleotide delivery, including, e.g., the HIV gp160 protein, HER2, CD7 (T cell marker), CD71 (transferrin receptor, highly expressed in cardiac and skeletal muscle) and TMEFF2.
  • oligonucleotides have also been conjugated with antibodies against CD44 (a neural stem cell marker), EPHA2 and EGFR193.
  • aptamers can be conjugated to oligonucleotide to enhance its delivery.
  • oligonucleotide can form non-covalent complex with cationic polymers (for example, polyethylenimine), dendrimers, CPPs (for example, MPG-8, PepFect6, RVG-9R228, and Xentry-KALA229) and inorganic methods (for example, calcium phosphate nanoparticles).
  • cationic polymers for example, polyethylenimine
  • CPPs for example, MPG-8, PepFect6, RVG-9R228, and Xentry-KALA22
  • inorganic methods for example, calcium phosphate nanoparticles.
  • lipoplexes and liposomes e.g., lipid nano-particles (LNPs)
  • LNPs lipid nano-particles
  • a MuSK-targeting oligonucleotide is modified to form a bioconjugate (e.g., conjugated with sugar, peptide, antibody, aptamer, lipid, etc.) to enhance its delivery to target site(s).
  • a MuSK-targeting oligonucleotide is formulated as lipoplexes and liposomes (e.g., lipid nano-particles (LNPs)) to enhance its delivery to target site(s).
  • LNPs lipid nano-particles
  • aminoglycosides are shown to improve the delivery of antisense phosphorodiamidate morpholino oligomer (PMO) both in vitro and in vivo (See Wang, et al., Mol Ther Nucleic Acids, 2019; 16: 663–674, doi: 10.1016/j. omtn.2019.04.023).
  • Short cell-penetrating peptides CPPs that can be either directly attached to oligonucleotides through covalent linkages or through the formation of noncovalent nanoparticle complexes can facilitate cellular uptake (See McClorey et al.; Biomedicines 2018, 6(2), 51).
  • ASO fatty acid conjugates are also reported to enhance the functional uptake of antisense oligonucleotide (ASO) in the muscle (See Prakash et al.; Nucleic Acids Research, 47, 2019, 6029–6044).
  • ASO antisense oligonucleotide
  • eteplirsen ExonDys 51
  • DMD Duchenne muscular dystrophy
  • Eteplirsen sold under the brand name Exondys 51 TM , (Sarepta Therapeutics’) causes exon 51 to be spliced out in pre-mRNA, restoring the reading frame in the 13% of patients with amenable frame-shifting mutations (See Crudele et al. Human Molecular Genetics, Volume 28, Issue R1, pp. R102–R107, 2019).
  • Eteplirsen is administered via intravenous infusion over 35 to 60 minutes. In particular, its recommended dosage is 30mg/kg body weight weekly. In a single-dose vial, the pharmaceutical composition is formulated as a 100mg/2mL or 500mg/mL (50mg/mL) solution.
  • Patisiran Onpattro
  • RNAi oligonucleotide therapeutics the first approved RNAi oligonucleotide therapeutic, Patisiran (Onpattro), which is developed by Alnylam Pharma for treatment for TTR (hereditary transthyretin amyloidosis, polyneuropathy), utilizes a nanoparticle delivery system (i.e., lipid nano-particles, LNP formulation); it also includes co- treatment with steroids and antihistamines.
  • Patisiran is administered via intravenous infusion. In particular, for patients weighing less than 100 kg, its recommended dosage is 0.3 mg/kg once every 3 weeks.
  • oligonucleotide therapeutics are typically administered via intravenous infusion to various organs, e.g., eyes, liver, skeletal muscle, spinal cord, etc..
  • an oligonucleotide therapeutic as described herein may be administered intravenously.
  • such oligonucleotide therapeutic may be administered according to a regimen reasonably comparable to that used for eteplirsen [sold under the brand name Exondys 51 TM ].
  • such oligonucleotide therapeutic may be administered according to a regimen reasonably comparable to that used for Patisiran [sold under the brand name Onpattro].
  • a lower dose of an MuSK-targeting oligonucleotide oligonucleotide as described herein is 12 mg.
  • a total of 5 mg to 60 mg per dose of MuSK-targeting oligonucleotide is administered to a subject.
  • a total of 12 mg to 48 mg per dose of MuSK-targeting oligonucleotide is administered to a subject.
  • a total of 12 mg to 36 mg per dose of MuSK- targeting oligonucleotide is administered to a subject. In some aspects, a total of 12 mg per dose of MuSK-targeting oligonucleotide is administered to a subject.
  • nusinersen sold under the brand name Spinraza TM
  • SMA spinal muscular atrophy
  • an oligonucleotide therapeutic as described herein may be administered intrathecally.
  • such oligonucleotide therapeutic may be administered according to a regimen reasonably comparable to that used for nusinersen [sold under the brand name Spinraza TM ].
  • an oligonucleotide therapeutic as described herein may be administered intrathecally.
  • such oligonucleotide therapeutic may be administered according to a regimen reasonably comparable to that used for nusinersen [sold under the brand name Spinraza TM ].
  • An oligonucleotide therapeutic as described herein may be administered according to any of the dosing regimens described herein.
  • MuSK-targeting oligonucleotide compositions as described herein, to promote neurogenesis (e.g., in cell populations that are or comprise neural progenitor cells)
  • the present disclosure provides technologies for enhancing level of neural cells present in a cell population. That is, contacting an original cell population with a MuSK-targeting oligonucleotide composition as described herein can generate a resulting population with an increased level and/or percentage of neural cells as compared with that in the original population; administration of such MuSK-targeting oligonucleotide composition as described herein can achieve such increase.
  • MuSK-targeting oligonucleotide compositions as described herein, promote muscle regeneration (e.g., in cell populations that are or comprise SCs, MPCs, and/or myoblasts), and those skilled in the art reading the present disclosure will appreciate that, among other things, the present disclosure provides technologies for enhancing level of SCs, MPCs, and/or myoblasts present in a cell population.
  • an original cell population may be or comprise NSCs and/or NPCs.
  • an original cell population may be or comprise SCs, MPCs, and/or myoblasts.
  • an original cell population is or comprises embryonic stems cells and/or pluripotent stem cells.
  • embryonic stems cells and/or pluripotent stem cells are or have been differentiated into neural or neural precursor cells, for example using techniques known in the art (see e.g., U.S. Pat.9,631,175).
  • embryonic stems cells and/or pluripotent stem cells are or have been differentiated into myogenic progenitor cells, for example using techniques known in the art (See e.g., Miyagoe-Suzuki et al.., Stem Cells Int.78246142017).
  • administration to a cell population delivers the MuSK-targeting oligonucleotide composition such that it is exposed to (i.e., contacts) a relevant original cell population in vivo (e.g., in a human, and in particular in an adult human, for example into in the brain – e.g., the hippocampus and/or subventricular region of the brain, of such human).
  • a relevant original cell population in vivo e.g., in a human, and in particular in an adult human, for example into in the brain – e.g., the hippocampus and/or subventricular region of the brain, of such human.
  • administration delivers the MuSK- targeting oligonucleotide composition such that it is exposed to (i.e., contacts) a relevant original cell population in vivo (e.g., in a human, and in particular in an adult human, for example into muscle tissue, of such human).
  • a relevant original cell population in vivo e.g., in a human, and in particular in an adult human, for example into muscle tissue, of such human.
  • administration in accordance with the present disclosure contacts a MuSK-targeting oligonucleotide composition with a population of cells (e.g., an original population of cells), that for example, may be or comprise neural progenitor cells, SCs, MPCs, and/or myoblasts, ex vivo.
  • a MuSK- targeting oligonucleotide composition is administered ex vivo (e.g., in vitro) to a population of cells from a subject.
  • a population of cells obtained from a subject.
  • Oligonucleotides that direct exon skipping of MuSK transcript(s) to favor forms that lack functional Ig3, and/or that direct degradation (and/or block translation) of forms that include functional Ig3, may be utilized.
  • a population of cells is contacted with a MuSK- targeting oligonucleotide composition and simultaneously or subsequently stimulated and/or expanded.
  • a population of cells is enriched and/or selected for cells exhibiting characteristics of activated NSCs (e.g., expression of Dex) or satellite cells or for expression of myogenic factors (e.g., Pax7, MyoD, myogenin, and MERGE) or for decreased/lack of expression of genes associated with the MuSK-BMP signaling pathway (e.g., RGS4, Msx2, Myf5, Ptx3, Id1).
  • a resulting population of cells achieved by contacting an original population of cells with a MuSK-targeting oligonucleotide composition ex vivo is then administered to a subject.
  • a resulting population of cells is administered to a subject suffering from or susceptible to a disease or disorder such as a neuromuscular dysfunction, a neurodegenerative disorder (e.g., AD), a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • a resulting population of cells is administered to the subject from whom the original population of cells was obtained.
  • a resulting population of cells is administered to a different subject than the one from which the original population of cells was obtained; in some such embodiments, the original population was obtained from a healthy subject and the resulting population is administered to a subject suffering from or susceptible to a disease or disorder such as a neurodegenerative disorder (e.g., AD), a neuromuscular dysfunction, a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting.
  • a neurodegenerative disorder e.g., AD
  • a neuromuscular dysfunction e.g., a neuromuscular dysfunction
  • a cardiac disorder e.g., myocardial infarction, cardiomyopathy
  • genetic diseases characterized by muscle wasting characterized by muscle wasting.
  • administering a population of cells, contacted with a MuSK-targeting oligonucleotide composition effectively treats a disease or disorder such as a neuromuscular dysfunction, a neurodegenerative disorder (e.g., AD), a cardiac disorder (e.g., myocardial infarction, cardiomyopathy), or genetic diseases characterized by muscle wasting in the subject.
  • a population of stimulated and/or expanded NSCs, SCs, MPCs, and/or myoblasts described herein can be formulated into a cellular therapeutic.
  • a cellular therapeutic includes a pharmaceutically acceptable carrier, diluent, and/or excipient.
  • a cellular therapeutic can be formulated for administration by any suitable route, such as, for example, intravenous, intratumoral, intraarterial, intramuscular, intraperitoneal, intrathecal, epidural, and/or subcutaneous administration routes.
  • the cellular therapeutic is formulated for a parenteral route of administration.
  • a cellular therapeutic is administered to a subject via an infusion.
  • a cellular therapeutic suitable for parenteral administration can be an aqueous or non-aqueous, isotonic sterile injection solution, which can contain anti-oxidants, buffers, bacteriostats, and solutes, for example, that render the composition isotonic with the blood of the intended recipient.
  • An aqueous or nonaqueous sterile suspension can contain one or more suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
  • a single therapeutic cell described herein is capable of expanding and providing a therapeutic benefit.
  • 10 2 or more, e.g., 10 3 or more, 10 4 or more, 10 5 or more, or 10 8 or more, therapeutic cells are administered as a cellular therapeutic.
  • 10 12 or less, e.g., 10 11 or less, 10 9 or less, 10 7 or less, or 10 5 or less, therapeutic cells described herein are administered to a subject as a cellular therapeutic.
  • 10 2 -10 5 , 10 4 -10 7 , 10 3 -10 9 , or 10 5 -10 10 therapeutic cells described herein are administered as a cellular therapeutic.
  • a dose of a cellular therapeutic described herein can be administered to a subject at one time or in a series of subdoses administered over a suitable period of time, e.g., on a daily, semi-weekly, weekly, bi-weekly, semi-monthly, bi-monthly, semi-annual, or annual basis, as needed.
  • a dosage unit comprising an effective amount of a cellular therapeutic may be administered in a single daily dose, or the total daily dosage may be administered in two, three, four, or more divided doses administered daily, as needed.
  • a cellular therapeutic is administered in combination with another therapy.
  • a MuSK-targeting oligonucleotide therapy as described herein is administered in combination with another therapy – e.g., so that a subject is simultaneously or sequentially exposed to both therapies.
  • the dosage of the MuSK-targeting oligonucleotide therapy as described herein and the dosage of another therapy administered in combination, as well as the dosing schedule can depend on various parameters, including, but not limited to, the disease being treated (e.g., a neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder, or a genetic disease characterized by muscle wasting), the subject's general health, and the administering physician's discretion.
  • MuSK-targeting oligonucleotide therapy can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concurrently with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of the other therapy, to a subject in need thereof.
  • 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after the administration
  • MuSK-targeting oligonucleotide therapy and the other therapy are administered 1 minute apart, 10 minutes apart, 30 minutes apart, less than 1 hour apart, 1 hour apart, 1 hour to 2 hours apart, 2 hours to 3 hours apart, 3 hours to 4 hours apart, 4 hours to 5 hours apart, 5 hours to 6 hours apart, 6 hours to 7 hours apart, 7 hours to 8 hours apart, 8 hours to 9 hours apart, 9 hours to 10 hours apart, 10 hours to 11 hours apart, 11 hours to 12 hours apart, no more than 24 hours apart or no more than 48 hours apart. In one embodiment, MuSK-targeting oligonucleotide therapy and the other therapy are administered within 3 hours.
  • MuSK-targeting oligonucleotide therapy and the other therapy are administered at 1 minute to 24 hours apart.
  • a synergistic combination of MuSK-targeting oligonucleotide therapy and the other therapy might allow the use of lower dosages of one or both of these agents and/or less frequent administration of the therapies to a subject suffering from neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder, or genetic diseases characterized by muscle wasting.
  • a synergistic effect might result in the improved efficacy of these agents and/or the reduction of any adverse or unwanted side effects associated with the use of either agent alone.
  • MuSK-targeting oligonucleotide therapy is administered in combination with a standard of care treatment for a relevant disease, disorder, or condition (e.g., a neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder, or genetic diseases characterized by muscle wasting).
  • a relevant disease, disorder, or condition e.g., a neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder, or genetic diseases characterized by muscle wasting.
  • Therapies for DMD include deflazacort (Emflaza; PTC Therapeutics) eteplirsen (Exondys 51; Sarepta Therapeutics), Ataluren (Translarna; PTC Therapeutics), and glucocorticoids such as prednisone.
  • MuSK-targeting oligonucleotide therapy is administered in combination with one or more therapies for DMD.
  • Approved therapies for ALS include Radicava, Rilutek, Tiglutik, and Nuedexta.
  • MuSK-targeting oligonucleotide therapy is administered in combination with one or more therapies for ALS.
  • Approved therapies for cardiomyopathy include but are not limited to angiotensin II-converting enzyme (ACE) inhibitors, angiotensin II receptor blockers (ARBs) and spironolactone.
  • ACE angiotensin II-converting enzyme
  • ARBs angiotensin II receptor blockers
  • MuSK-targeting oligonucleotide therapy is administered in combination with one or more therapies for cardiomyopathy.
  • MuSK-targeting oligonucleotide therapy is administered in combination with one or more therapies that relieves a symptom or characteristic of a relevant disease, disorder or condition, or of a therapy therefor. In some embodiments, MuSK-targeting oligonucleotide therapy is administered in combination with one or more other therapies that relieves a symptom or characteristic so that the side effects associated with said other therapies are relieved.
  • the side effect associated with therapy is characterized by one or more of nausea, vomiting, loss of appetite, muscle cramps and spasms, increased frequency of bowel movements, headache, confusion and dizziness, constipation, fatigue, excessive saliva and phlegm, pain, depression, sleep problems, and uncontrolled outbursts of laughing or crying.
  • Any therapy which is known to be useful, or which has been used, will be used or is currently being used for the treatment or prevention of neuromuscular dysfunction, a neurodegenerative disorder, a cardiac disorder, or genetic diseases characterized by muscle wasting, can be used in combination with the MuSK-targeting oligonucleotide therapy in accordance with the invention described herein.
  • EXEMPLIFICATION Example 1 Design and Screening of MuSK-targeting Oligonucleotides [0385] In this Example, human MuSK-targeting oligonucleotides were designed and tested for their ability to induce exon skipping of the MuSK exon 6 and/or exon 7. Methods A. Cell types [0386] The choice of cell type was based on the expression of MuSK and the relevance of the cell type for the study. Two cell types were retained and tested: [0387] 1. HEK293 (ATCC, CRL-1573) is a cell line commonly used in neuroscience studies because of its ability to differentiate to neurogenic lineage (Shaw et al., 2002). [0388] 2.
  • LHCN-M2 (Evercyte, CkHT-040-231-2) is a cell line that was shown to highly express MuSK (19.8NX according to ProteinAtlas). In HEK293, MuSK expression was variable, and sometimes not high enough to be detected with qPCR. In LHCN-M2, MuSK expression was more consistent and detectable. Therefore, LHCN-M2 was chosen.
  • B. Cell Culture [0389] LHCN-M2 were obtained from Evercyte (CkHT-040-231-2) and were cultured according to their protocol.
  • the cell vessels were pre-coated with 80 ⁇ l/cm2 of 0.1% porcine gelatin (Sigma-Aldrich, Cat# G1890) in water for at least 4h in 37 ⁇ C and up to one week. Before plating the cells, excess gelatin was removed. [0391] For detachment, cells were rinsed twice with PBS (Thermofisher, 14190144) and were incubated with Trypsin-EDTA solution (Sigma, T3924-100ML) (room-temperature; 20 ⁇ l/cm2) for 2 minutes. [0392] Once the cells are detached, about 160 ⁇ l/cm2 of growth medium was added to the trypsin.
  • PBS Thermofisher, 14190144
  • Trypsin-EDTA solution Sigma, T3924-100ML
  • LHCN-M2 cells were grown in MyoUp medium at 37°C in a humidified atmosphere with 5 % CO2. Cells were passaged twice a week when having reached about 30 - 40 % confluence.
  • MyoUp medium DMEM (Thermofisher Cat # 10566016) / M199 (Gibco, Cat# 31150022) (4+1) 15 % Fetal bovine serum (FBS) (Hyclone, SH30071.03) 20 mM Hepes (Sigma Aldrich, Cat# H0887) 3 ⁇ g/ml Zinc sulfate (Sigma, Cat# Z0251) 1.4 ⁇ g/ml Vitamin B12 (Sigma, Cat# V2876) 0.055 ⁇ g/ml Dexamethasone (Sigma Aldrich, Cat# D4902) 2.5 ng/ml HGF (Merck Millipore, Cat# GF116) 10 ng/ml bFGF (Peprotech, Cat# 100-18C) C.
  • FBS Fetal bovine serum
  • ASO Transfection [0395] ASOs were diluted in cell culture grade water to reach a concentration of 100 ⁇ M and were preserved at -20 ⁇ C. [0396] LHCN-M2 cells were plated in gelatin-coated 6 well plates at 35,000 cells/well in 2.25mL. After 2 days, cells reached 60% confluency and were ready to be transfected with the ASOs and lipofectamine RNAiMAX (Invitrogen, 13778150) according to the manufacturer’s protocol: [0397] 24 hours after transfection, cells were rinsed with PBS and the RNA was extracted. D.
  • RNA extraction [0398] To obtain the best RNA extraction ratio, two kits were tested: Zymo Research Quick-RNATM Miniprep Kit (cat# 50444597) and Qiagen RNeasy Plus Mini Kit (cat# 74136). [0399] Cells were seeded in 6-well plates at a density of 45000 cells/well. The RNA was extracted 2 days after seeding. The RNA concentration was measured using a nanodrop (Thermofisher, NanoDrop TM 8000 Spectrophotometer) and the results are given in Table 3. Table 3 Table 3: Yield of RNA extraction from LHCN-M2 cells with ZYMO or QIAGEN extraction kits.
  • RNA extraction 3.82 ⁇ g/well was obtained, while 2.9 ⁇ g/well was obtained with the Qiagen kit. Therefore, the Zymo kit was chosen for the study.
  • the Zymo Research Quick-RNATM Miniprep Kit is used for RNA extraction (cat# 50444597).
  • Zymo Kit Protocol All steps at room temperature and centrifugation at 13,000 x g for 30 seconds, unless specified. 1. Cells are lysed in 400 ⁇ L of RNA Lysis buffer using a cell scraper. 2. Lysates are vortexed for 20s to be homogenized and centrifuged for 30s at 13,000 x g to remove the cell debris. 3.
  • the supernatants are transferred into a Spin-AwayTM Filter (yellow) in a Collection Tube and centrifuged to remove the majority of genomic DNA. 4. 0.5 volume of ethanol (95-100%) is added to the flow-through and well mixed. The samples are transferred into a Zymo-SpinTM IIICG Column (green) in a Collection Tube and centrifuged. 5. The RNA, attached to the column, is DNase treated. (D1) Wash the column with 400 ⁇ l RNA Wash Buffer and centrifuge. Discard the flow-through. (D2) In a nuclease-free tube, 5 ⁇ l DNase I (1 U/ ⁇ l) is added to 75 ⁇ l DNA Digestion Buffer and mix. Mixture is directly added into the column matrix.
  • RNA wash Buffer is added to the column and centrifuged for 1 min to ensure complete removal of the wash buffer. Then, the column is transferred into a 1.5 mL nuclease-free tube. 9. 100 ⁇ l of DNase/RNase-Free Water is added directly to the column matrix and centrifuged. 10. Extracted RNA is usually immediately transcripted to cDNA, or stored at -80°C if necessary.
  • cDNA transcription The reverse transcriptase SuperScriptTM IV VILOTM Master Mix from Thermofisher (11756050) is used. 4 uL of the enzyme is added to 16 uL of RNA (corresponding to ⁇ 550-650 ng). According to the manufacturer’s protocol, the reverse transcription is obtained by the following steps: - 10 min at 25°C to anneal the primers - 10 min at 50°C to perform the reverse transcription - 5 min at 85°C to inactivate the enzyme The cDNA is then diluted by 2 in DNase RNase free water and conserved at -20°C until the qPCR is done. For MuSK analyses, the cDNA was used at this concentration. For housekeeping gene analyses, the cDNA was further diluted by 5. E.
  • SYBR Green qPCR Protocol [0405] To analyze the gene expression, SYBR Green technology was used. Results were normalized to two housekeeping genes (GAPDH and YWHAZ). qPCR was performed in 384-well plates. cDNA was used at 1/2 to analyze MuSK expression and at 1/10 to analyze HKG expressions. Measures were performed in duplicates or triplicates.
  • All ASOs Bld1-Bld38 were designed to include 2’-MOE modification on each sugar and where there is a phosphorothioate internucleotidic linkage between each nucleotide. Sequences were designed so that they would avoid activation of RNase H. All ASOs were 25 nucleotides in length. Alignment of ASOs Bld1-Bld38 to the MuSK genomic sequence along regions including exons 6 and 7 is shown in FIG.4. Antisense oligonucleotides targeting Exon6 i. Alignment to the genetic sequence [0410] The ASOs were designed to be complementary to regions of the MuSK Exon6 genetic sequence, presented in FIG.5. ii.
  • the primers were designed to span either the 3-4 exon/exon junction (named MuSK34) or the 6-7 exon/exon junction (named MuSK67).
  • the MuSK34 primer therefor detects all forms of the MuSK transcript (both the long form (i.e., containing the Ig3 domain and the short form (i.e., MuSK ⁇ Ig3)) while the MuSK67 primer detects only the long form of MuSK and not MuSK ⁇ Ig3.
  • the primer design rationale is shown in FIG.2. Results were normalized to two housekeeping genes, YWHAZ and GAPDH, whose stabilities were assessed using the software BestKeeper and are shown in FIG.7.
  • the qPCR results show that the ASOs Bld7, Bld8, Bld9, Bld11, Bld13, Bld16, Bld15, and Bld18 induced a decrease in the expression of MuSK34 (>75%) and of MuSK67 (>90%).
  • the ASOs Bld13, Bld4, Bld5, Bld6, Bld12 and Bld14 and Bld17 induced a decrease of MuSK34 (between 50-75%) and a higher decrease of MuSK67 (70-85%).
  • the ASOs Bld3 and Bld17 induced slighter effects on MuSK34 and MuSK67 expression (20-50%).
  • a) * represents a phosphorothioate linkage, and each sugar of the oligonucleotides is a 2’-MOE modified sugar.
  • b) a value of 1.0 represents the level of MuSK67 expression for untreated cells.
  • a) * represents a phosphorothioate linkage, and each sugar of the oligonucleotides is a 2’-MOE modified sugar.
  • b) a value of 1.0 represents the level of MuSK67 expression for untreated cells.
  • ASOs Bld29 and Bld31 induced a decrease in the expression of MuSK34 (>75%) and of MuSK67 (>90%).
  • ASOs Bld30, Bld32and Bld34 induced a decrease of MuSK34 (between 40-60%) and a higher decrease of MuSK67 (55-85%).
  • ASO Bld19 induced slighter effects on MuSK34 and MuSK67 expression ( ⁇ 20%).
  • ASOs Bld19, Bld20, Bld24, Bld23 and Bld33 induced an increase in expression of MuSK34 and 67.
  • ASOs Bld25, Bld26, Bld27, Bld28, Bld35 and Bld38 induced a decrease of MuSK67 > 60% at 50nM and a decrease of MuSK34 ⁇ 40% for both concentrations. Therefore, these ASOs were considered good candidates to be tested at additional doses.
  • MuSK34 ⁇ 40 % of the control, MuSK67 ⁇ 20% of the control Purple and grey areas indicate regions that may be targeted to obtain an efficient skipping of exons 6/7 with lower effect on other exons based on the results shown in FIG.11 (i.e., the regions targeted by ASOs hu7-10, hu73, hu717, hu730, hu711 and hu7158). These regions “region 1” and “region 2” are shown in FIG.4.
  • FIG.13 shows relative MuSK expression in response to various doses of the 6 candidate ASOs (Bld25(A), Bld26 (B), Bld27 (C), Bld28 (D), Bld35 (E), Bld38 (F)).
  • MuSK34 (in blue) and MuSK67 (in red) expression was measured by qPCR and each was normalized to the housekeeping genes and to the values obtained for untreated cells. The estimated IC is indicated on each graph. The 5 tested doses were 2.5, 5, 25, 125, 400 nM.
  • the results from the dose response study indicated that ASO Bld35 induced both a decrease of MuSK34 and of MuSK67 of 20-40% and 50-70%, respectively.
  • MuSK34 expression was between 75 and 85% of the control level while MuSK67 was at 50% of the control level, making them potential candidates.
  • ASO Bld38 the inhibition of MuSK67 was limited at 60% of the control level, even at high concentrations (400 nM).
  • ASOs Bld27 and Bld28 a concentration higher than 125 nM induced a decrease in MuSK34 expression > 75%.
  • FIG.19 shows MuSK34 expression in green and MuSK67 expression in red measured by qPCR and normalized to housekeeping genes and to the controls.
  • the Bld25/Bld26 mix resulted in MuSK34 expression at a level of 72% of the control level, while MuSK67 expression was at a level of 6% of the control level.
  • MuSK67 expression was at 8% when inhibited by siRNA (Thermofisher, cat# 4392420, Assay Id s224071) against MuSK at 10nM (data not shown).
  • Example 2 In vivo evaluation of exon-skipping induced by MuSK-Targeting Oligonucleotides
  • Preliminary confirmation of activities for oligonucleotides provided herein have been confirmed by testing corresponding murine oligonucleotide sequences in an established mouse model. See, e.g., Renault et al., 2009, the entirety of which is incorporated herein by reference.
  • the corresponding murine oligonucleotides are further evaluated in vivo in wild-type mice at ages where AHN has declined. Further evaluations such as pharmacodynamic and safety studies are conducted to establish optimal conditions for ASO-mediated MuSK exon skipping in aging wild type mice.
  • Experiment #1 Tolerability, exon skipping and PK
  • Mice are monitored for potential immediate safety signals (e.g. seizures, hindlimb weakness, prolonged lethargy) and animals where these issues do not resolve within the first hours after dosing are euthanized.
  • Mice receiving doses that do not show tolerability signals are monitored daily.
  • Unfixed brains are harvested at 4 weeks.
  • One-half of the brains are sectioned and analyzed by histology for signs of inflammation or other toxicity by a board-certified veterinary pathologist.
  • the hippocampus and cortex from the other half are dissected and further divided for RNA isolation and PK analysis.
  • the level of MuSK alternative splicing i.e., skipping of exons 6-7
  • the level of MuSK alternative splicing are assessed by TaqMan assays and gel-based PCR as described in Examples 1-2. For the latter, gel bands are excised and sequenced to confirm correct skipping.
  • the remaining portion for of cortex are used for HPLC quantification of the ASO (PK). Experiment #2.
  • Neurogenesis (fixed brains) [0456] Neurogenesis Group size: To determine the number of animals required to assess increased neurogenesis, a power analysis using G*Power version 3.1 was performed (Faul et al., 2007). To allow for possible loss of animals during the experiment 6 animals/group are allocated. Analyses is performed using either GraphPad Prism or R. [0457] In this experiment, ASOs are delivered to a second set of animals with at least three non-toxic doses (as determined in Experiment 1). [0458] For these animals EdU is delivered from 3 to 4 weeks post-injection. Animals are perfused, fixed and immunohistochemistry is performed against EdU and DCX to assess the numbers of new neurons (EdU+/DCX+ cells).
  • Aged wild-type mice are dosed by ICV at 11 months of age and are assessed for cognition at 12 months of age. A single dose is performed to promote AHN as determined from Experiment #2 (18 animals per group).
  • mice are evaluated using tests including Novel Object Location task, a hippocampal-dependent spatial learning task, and a Conditioned Fear and a Y-maze to measure spatial working memory (Gotz and Ittner, 2008), two tasks commonly used to test cognition.
  • Pairwise comparisons will be analyzed by using the Student’s t test. Experiments with more than two groups will be analyzed using a Bonferroni correction for multiple comparisons.
  • Female mice Efficacy of ASO treatment on promoting neurogenesis using the optimal dose determined above in female mice is also assessed. [0465] Discussion.
  • Experiments 1-3 are designed such that they will relate the dose delivered to safety, PK, level of MuSK splicing, degree of AHN promotion and cognitive improvement.
  • PK level of MuSK splicing
  • degree of AHN promotion and cognitive improvement [0466] A 4 week period of exposure was utilized since this is the time course over which NSCs are born and mature (Babcock et al., 2021). However, additionally studies with longer exposures, with and without repeat dosing will also be performed.
  • In addition to the HPLC measurement of ASO in the brain hybridization-based method will also be utilized.
  • Example 3 In vivo evaluation of exon-skipping induced by MuSK-Targeting Oligonucleotides in FAD model [0468]
  • FAD Familial Alzheimer’s Disease
  • This experiments aims to determine whether corresponding murine oligonucleotides and the exon-skipping approach is effective in the hostile, inflammatory milieu along with a high plaque burden and neurofibrillary tangles that characterize the AD brain, and whether corresponding oligonucleotides promote AHN in an FAD mouse model.
  • FAD Mouse Model.3xTg is used in this experiment, which harbors transgenes for Tau, PSEN1 and APP FAD alleles (Oakley et al., 2006; Kimura and Ohno, 2009; Belfiore et al., 2019).
  • This model has been characterized and develops both amyloid plaques at 6 months and neurofibrillary tangles by 12 months.
  • AHN is decreased as early as 3 months of age and is essentially undetectable by 12 months.
  • mice are used since they show an earlier and more consistent pathological profile (Belfiore et al., 2019).
  • Example 4 Formulation and Administration of MuSK-Targeting Oligonucleotides
  • A. Formulation [0471] In this Example, human MuSK-targeting oligonucleotides as described herein are formulated into suitable forms to enhance the delivery to target site(s) and are administered to human subject via various means. [0472] In some embodiments, human MuSK-targeting oligonucleotides are formulated into lipid complex, as a homogeneous solution in a single-dose vial. In some embodiments, single-dose vial is 10 mg/5 mL (2 mg/mL). B. Administration 1.
  • MuSK-targeting oligonucleotides are indicated for the treatment of the AD in adults. 2. Dosage and Administration 2.1 Dosing Information [0474] MuSK-targeting oligonucleotides are administered by a healthcare professional. [0475] MuSK-targeting oligonucleotides are administered via intravenous (IV) infusion. Dosing is based on actual body weight. For patients weighing less than 100 kg, the recommended dosage is 0.3 mg/kg once every 3 weeks. For patients weighing 100 kg or more, the recommended dosage is 30 mg once every 3 weeks. [0476] Missed Dose: If a dose is missed, administer MuSK-targeting oligonucleotides as soon as possible.
  • MuSK-targeting oligonucleotides are filtered and diluted prior to intravenous infusion.
  • the diluted solution for infusion is prepared by a healthcare professional using aseptic technique as follows: 1. Remove MuSK-targeting oligonucleotides vial from the refrigerator and allow to warm to room temperature. Do not shake or vortex. 2. Inspect visually for particulate matter and discoloration. Do not use if discoloration or foreign particles are present. 3.
  • MuSK-targeting oligonucleotides are infused as follows: 1. Use a dedicated line with an infusion set containing a 1.2 micron polyethersulfone (PES) in-line infusion filter. Use infusion sets and lines that are DEHP-free. • 2. Infuse the diluted solution of MuSK-targeting oligonucleotides intravenously, via an ambulatory infusion pump, over approximately 80 minutes, at an initial infusion rate of approximately 1 mL/min for the first 15 minutes, then increase to approximately 3 mL/min for the remainder of the infusion. 3. Administer only through a free-flowing venous access line. Monitor the infusion site for possible infiltration during drug administration.
  • PES polyethersulfone
  • Example 5 Design and Screening of 20-mer MuSK-targeting Oligonucleotides
  • additional human MuSK-targeting oligonucleotides were designed based on the lead candidates from Example 1 targeting exon 7 of MuSK.
  • the screen in Example 1 identified 6 lead ASOs that targeted two regions within the MuSK exon 7.
  • one of these regions was identified as a key region to modulate the splicing of Ig3 domain.
  • region 1 corresponds to the core sequence SEQ ID NO: 126 (ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATTGACTCAA GAC) which is located at positions 83841-83905 of the MuSK transcript (SEQ ID NO: 77) (or corresponding regions within other MuSKvariant sequences).
  • additional ASOs are designed to target the region corresponding to SEQ ID NO: 126 (“region 1”) of exon 7 and specifically to include different portions of the sequences of ASOs Bld25 and Bld26. These ASOs were designed to test whether shorter ASOs of 20 nucleotides, rather then 25 nucleotides (as tested in Example 1) would have increased activity.
  • ASOs Human antisense oligonucleotides
  • FIG.17 Human antisense oligonucleotides
  • Table 8 All ASOs in Table 8 were designed to include 2’-MOE modification on each sugar and where there is a phosphorothioate internucleotidic linkage between each nucleotide. All ASOs in Table 8 were 20 nucleotides in length.
  • Example 6 Design and Screening of Additional MuSK-targeting Oligonucleotides targeting Region 1 of Exon 7
  • additional human MuSK-targeting oligonucleotides were designed based on the lead candidates from Example 1 targeting region 1 of exon 7 of MuSK SEQ ID NO: 126 (CTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATTGACTCAAG AC), which is located at positions 83841-83905 of the MuSK transcript (SEQ ID NO: 77) (or corresponding regions within other MuSK variant sequences).
  • Sequences were desined to specifically to include different portions of the sequences of ASOs Bld25 and Bld26.
  • ASOs designed in this Example were produced to be 25 nucleotides in length.
  • the additional oligonucleotides were tested for their ability to induce exon skipping of the MuSK exon 6 and/or exon 7.
  • Design of Human ASOs [0493] Human antisense oligonucleotides (ASOs) were designed as described above and are shown in Fig.19. These ASOs were produced by Microsynth (Switzerland). The ASO sequences are shown below in Table 10.
  • Table 10 [0494] All ASOs in Table 10 were designed to include 2’-MOE modification on each sugar and where there is a phosphorothioate internucleotidic linkage between each nucleotide. All ASOs in Table 10 were 25 nucleotides in length. Screen of Antisense oligonucleotides targeting Exon7 Region 1 [0495] ASO transfection and cell culture, RNA extraction, cDNA transcription, qPCR were performed according to the methods described in Example 1, except as where indicated otherwise. i. Alignment to the genetic sequence [0496] The alignment of the ASOs in Table 10 on the genetic sequence of Exon7 of MuSK is presented in FIG.19. ii.
  • LHCN-M2 cells were plated at 35,000 cells/well in gelatin pre-coated 6-well plates and were transfected 48h after seeding with ASO at 5nM, 12.5 nM, 25nM, 50nM, and 125 nM. Each of the ASOs in Table 10 were tested with Bld25, Bld26, Bld27, Bld28, Bld35 and Bld38 (leads identified in Example 1). 24 h after transfection, cells were observed (data not shown) and the RNA was extracted and analyzed.
  • FIG.22 shows a comparison of Bld25-5 to Bld25 after transfection with ASO for 24hours (Panels A and B) and 48 hours (Panels C and D). Methods described for screen of ASOs in Example 1 were used.
  • ASOs with the modifications used in this Example are shown in Table 11 below.
  • Table 12 Potency Table 13: Selectivity MuSK 34 (IC in nM) [0502]
  • Table 12 shows the concentration at which there is either 50% (IC50) or 75% (IC75) inhibition in total MuSK67 expression.
  • Table 13 shows the IC10 and IC25 values of MuSK34 (nM) of each ASO, and represents concentration in which there is either 10% (IC10) or 25% (IC25) inhibition in total MuSK expression (MuSK34).
  • ASOs performing exon skipping of exon 6 and/or 7, are expected to show lower IC50/IC75 values of MuSK67 and higher IC10/25 values of MuSK34.
  • Results from this screen showed that ASOs Bld25, Bld25-5, Bld26-2, and Bld26 showed the best potency and selectivity (see Tables 12 and 13).
  • Example 7 Design and Screening of Shortened MuSK-targeting Oligonucleotides targeting Region 1 of Exon 7
  • additional human MuSK-targeting oligonucleotides were designed by reducing the size of the lead ASOs identified in Example 1 and Example 6 (Bld25, Bld25-5, Bld26, and Bld26-2).
  • These ASOs target region 1 of exon 7 of MuSK SEQ ID NO: 126 (ACTCTGTCAGGTTTCTTCTGGGTCCATTCAAGAGAGTGTGAAAGACCGAGTGATTGACTCAA GAC) which is located at positions 83841-83905 of the MuSK transcript (SEQ ID NO: 77) (or a corresponding regions within other MuSK variant sequences).
  • ASOs Bld25, Bld25- 5, Bld26- and Bld26-2 were produced to be 21 and 23 nucleotides in length.
  • ASOs designed in this Example were produced to be 21 and 23 nucleotides in length.
  • These ASOs were then tested for their ability to induce exon skipping of the MuSK exon 6 and/or exon 7.
  • Design of Human ASOs [0514] Human antisense oligonucleotides (ASOs) were designed as described above and as shown in FIG.23. The ASOs were produced by Microsynth (Switzerland). The ASO sequences are shown below in Table 14.
  • Table 14 [0515] All ASOs in Table 14 were designed to include 2’-MOE modification on each sugar and where there is a phosphorothioate internucleotidic linkage between each nucleotide. All ASOs in Table 14 were 21 or 23 nucleotides in length. Screen of 21-mer and 23-mer Antisense oligonucleotides targeting Exon7 Region 1 [0516] ASO transfection and cell culture, RNA extraction, cDNA transcription, qPCR were performed according to the methods described in Example 1, except as where indicated otherwise. i. Alignment to the genetic sequence [0517] The alignment of the ASOs in Table 14 on the genetic sequence of Exon7 of MuSK is presented in FIGs.23. ii.
  • LHCN-M2 cells were plated at 35,000 cells/well in gelatin pre-coated 6-well plates and were transfected 48h after seeding with ASO at 5nM, 12.5 nM, 25nM, 50nM, and 125 nM. Each of the ASOs in Table 14 were tested in addition to Bld25, Bld25-5, Bld26, and Bld26-2 (leads identified in Examples 1 and 6). 24 h after transfection, cells were observed (data not shown) and the RNA was extracted and analyzed. [0519] After 24 h of transfection, cells looked healthy in all conditions (data not shown). iii.
  • LHCN-M2 cells were treated for 48h with 10nM of siRNA (Thermofisher, 4392420, assay ID s224071) against MuSK and were then stained for MuSK protein on days 2, 3, 4, and 5 (with MuSK antibodies isolated from patients with a disease involving the natural production of MuSK antibodies followed by goat anti-human (A-2133)) following siRNA treatment.
  • Results for each timepoint in treated and untreated cells are shown in FIG.29. Results show that in the untreated wells, MuSK protein amount increases while cells start to be confluent. In wells treated with siRNA, MuSK protein amount decreases, especially 5 days after the transfection.
  • FIG.29 shows the cells at Day 5 magnified and stained for MuSK (red) (with MuSK antibodies isolated from patients with a disease involving the natural production of MuSK antibodies followed by goat anti-human (A-2133)) and actin phalloidin (green) (ab ab176743 at 1:1000).
  • ASOs as described herein are targeting the Ig3 domain and inducing exon skipping (6,7) to produce MuSK ⁇ Ig3, there needs to be a way to detect MuSK ⁇ Ig3 protein. Timing of the effects of the ASOs/RNA on MuSK protein has been established. An assessment (e.g., Western blot analysis) will be performed. Such an assessment includes assessment of MuSK ⁇ Ig3 protein produced from cells treated with ASOs described herein. A MuSK antibody that targets the MuSK cytoplasmic domain will be utilized for identification of MuSK ⁇ Ig3 protein. Antibodies are produced and tested using the recombinant MuSK cytoplasmic domain.
  • human and murine MuSK protein sequences vary, human MuSK controls should be used for assessment (e.g., by Western Blot). Positive controls (i.e., MuSK ⁇ Ig3 protein and human FL MuSK protein) are used to confirm the forms of MuSK that are present. Plasmids coding for the different WT and D3 (Ig3) isoforms of MuSK protein are obtained. Cells are transfected with the plasmids and positive control isoforms are expressed and obtained.
  • Positive controls i.e., MuSK ⁇ Ig3 protein and human FL MuSK protein
  • Plasmids coding for the different WT and D3 (Ig3) isoforms of MuSK protein are obtained. Cells are transfected with the plasmids and positive control isoforms are expressed and obtained.
  • Human MuSK antibodies targeting the cytoplasmic domain of MuSK and human MuSK positive controls i.e., MuSK ⁇ Ig3 protein and human FL MuSK protein
  • reagents are used in a assessment (e.g., Western Blot) to characterize the MuSK protein produced from cells treated with ASOs described herein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Neurology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurosurgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
PCT/US2023/011286 2022-01-20 2023-01-20 Musk-targeting oligonucleotides Ceased WO2023141302A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
CA3248917A CA3248917A1 (en) 2022-01-20 2023-01-20 OLIGONUCLEOTIDES TARGETING MUSK
US18/730,084 US20250257359A1 (en) 2022-01-20 2023-01-20 Musk-targeting oligonucleotides
EP23743785.0A EP4466360A4 (en) 2022-01-20 2023-01-20 OLIGONUCLEOTIDES TARGETING MUSK
JP2024543383A JP2025503098A (ja) 2022-01-20 2023-01-20 MuSK標的化オリゴヌクレオチド
AU2023210230A AU2023210230A1 (en) 2022-01-20 2023-01-20 Musk-targeting oligonucleotides

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202263301416P 2022-01-20 2022-01-20
US63/301,416 2022-01-20

Publications (1)

Publication Number Publication Date
WO2023141302A1 true WO2023141302A1 (en) 2023-07-27

Family

ID=87349235

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/011286 Ceased WO2023141302A1 (en) 2022-01-20 2023-01-20 Musk-targeting oligonucleotides

Country Status (6)

Country Link
US (1) US20250257359A1 (https=)
EP (1) EP4466360A4 (https=)
JP (1) JP2025503098A (https=)
AU (1) AU2023210230A1 (https=)
CA (1) CA3248917A1 (https=)
WO (1) WO2023141302A1 (https=)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200282074A1 (en) * 2017-09-22 2020-09-10 Avidity Biosciences, Inc. Nucleic acid-polypeptide compositions and methods of inducing exon skipping
WO2020214987A1 (en) * 2019-04-18 2020-10-22 Brown University Neurogenesis
WO2021076883A2 (en) * 2019-10-16 2021-04-22 Brown University Muscle regeneration and growth

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013074636A1 (en) * 2011-11-14 2013-05-23 New York University Muscle specific receptor kinase and modulation thereof

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200282074A1 (en) * 2017-09-22 2020-09-10 Avidity Biosciences, Inc. Nucleic acid-polypeptide compositions and methods of inducing exon skipping
WO2020214987A1 (en) * 2019-04-18 2020-10-22 Brown University Neurogenesis
WO2021076883A2 (en) * 2019-10-16 2021-04-22 Brown University Muscle regeneration and growth

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4466360A4 *

Also Published As

Publication number Publication date
AU2023210230A1 (en) 2024-08-01
CA3248917A1 (en) 2023-07-27
EP4466360A1 (en) 2024-11-27
US20250257359A1 (en) 2025-08-14
JP2025503098A (ja) 2025-01-30
EP4466360A4 (en) 2026-04-08

Similar Documents

Publication Publication Date Title
AU2020202852B2 (en) Di-amino acid repeat-containing proteins associated with ALS
AU2020203573B2 (en) Oligonucleotides for inducing paternal UBE3A expression
KR102620328B1 (ko) 핵 유전자 산출량의 표적화 증강
KR102424855B1 (ko) 접합된 안티센스 화합물 및 그것의 용도
ES2386578T3 (es) Compuestos y procedimientos para modular la expresión de PCSK9
KR102366078B1 (ko) Pkk 발현을 조절하는 조성물 및 방법
KR20210138587A (ko) 개선된 면역요법을 위한 조합 유전자 표적
KR20180016970A (ko) 타우 안티센스 올리고머와 그 용도
KR20180093977A (ko) 상염색체 우성 정신 지체 5 및 드라베 증후군의 치료를 위한 안티센스 올리고머
KR20220012230A (ko) 스플라이싱 및 번역을 조절하기 위한 방법 및 조성물
KR20070105969A (ko) 안질환 치료용 방법 및 조성물
TW202311530A (zh) 用於減少tau表現之組合物及方法
KR20220113743A (ko) 병태 및 질환의 치료를 위한 안티센스 올리고머
KR20230022409A (ko) 병태 및 질환의 치료를 위한 opa1 안티센스 올리고머
AU2016216597B2 (en) Antisense modulation of ptp1b expression
KR102782761B1 (ko) 인간의 앤젤만 증후군에서 부계 ube3a 유전자 발현을 복원하기 위한 조성물 및 방법
KR20200094230A (ko) B형 간염 감염을 치료하기 위한 PAPD5 및 PAPD7 mRNA의 감소용 핵산 분자
KR20230043914A (ko) App 발현을 감소시키기 위한 화합물 및 방법
CN111405901B (zh) 含有miRNA的癌症治疗用医药组合物
US20040115641A1 (en) Modulation of ROCK 1 expression
TW202227102A (zh) 治療脂肪肝病之方法
KR20230095056A (ko) Scn2a에서 기능-상실 돌연변이와 연관된 장애를 치료하기 위한 조성물 및 방법
KR20230005933A (ko) Atxn1을 조정하는 화합물 및 방법
WO2024213890A1 (en) Oligonucleotide decoy
US20250257359A1 (en) Musk-targeting oligonucleotides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23743785

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: AU2023210230

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2024543383

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2023210230

Country of ref document: AU

Date of ref document: 20230120

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2023743785

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023743785

Country of ref document: EP

Effective date: 20240820

WWP Wipo information: published in national office

Ref document number: 18730084

Country of ref document: US