WO2023137346A2 - Designed cytokine compositions and methods of use - Google Patents

Designed cytokine compositions and methods of use Download PDF

Info

Publication number
WO2023137346A2
WO2023137346A2 PCT/US2023/060508 US2023060508W WO2023137346A2 WO 2023137346 A2 WO2023137346 A2 WO 2023137346A2 US 2023060508 W US2023060508 W US 2023060508W WO 2023137346 A2 WO2023137346 A2 WO 2023137346A2
Authority
WO
WIPO (PCT)
Prior art keywords
cell
designed
cytokine
sequence
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2023/060508
Other languages
English (en)
French (fr)
Other versions
WO2023137346A3 (en
Inventor
Scott BOYKEN
Marc Lajoie
Thaddeus M. DAVENPORT
Howell MOFFETT
Brian WEITZNER
Andrew Howen NG
Paul Joseph SAMPLE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Outpace Bio Inc
Original Assignee
Outpace Bio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Outpace Bio Inc filed Critical Outpace Bio Inc
Priority to KR1020247026696A priority Critical patent/KR20240164594A/ko
Priority to CN202380027065.2A priority patent/CN119053616A/zh
Priority to IL314226A priority patent/IL314226A/en
Priority to EP23740805.9A priority patent/EP4463469A4/en
Priority to US18/727,646 priority patent/US20250223330A1/en
Priority to MX2024008642A priority patent/MX2024008642A/es
Priority to AU2023208031A priority patent/AU2023208031A1/en
Priority to JP2024541803A priority patent/JP2025502205A/ja
Priority to CA3248134A priority patent/CA3248134A1/en
Priority to TW112101435A priority patent/TW202434618A/zh
Publication of WO2023137346A2 publication Critical patent/WO2023137346A2/en
Publication of WO2023137346A3 publication Critical patent/WO2023137346A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/55IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the disclosure relates to the fields of immunology, gene therapy, protein design, cell signaling, biologies and cellular therapies.
  • IL-2 has shown promise as an anti-cancer immunotherapy, but efficacy and safety have been diminished by dose-limiting toxicity due to preferential stimulation of Treg cells and doselimiting toxicity due to IL-2Ra binding.
  • the disclosure provides a non-naturally occurring designed cytokine as a solution to this unmet need in the art.
  • the disclosure provides non-naturally occurring designed cytokines having enhanced function and improved stability when compared to wild type IL-2.
  • Non-naturally occurring designed cytokines of the disclosure also referred to herein as IL-2/15 cytokines named fortheir dual functionality of signaling through both the IL-2 and IL-15 receptors, reduce preferential Treg stimulation, potentiates T cell subtype targeting, stabilizes protein folding, and reduces immunogenicity.
  • designed cytokines eliminate preferential Treg stimulation.
  • designed cytokines eliminate immunogenicity.
  • designed cytokines provide enhanced function and improved stability with reduced post-translational modifications compared to the post-translational modifications made to wild type IL-2.
  • designed cytokines provide enhanced function and improved stability without post-translational modifications.
  • the disclosure provides a Designed Cytokine comprising alpha helices Hl, H2,H3, and H4, wherein: from an amino terminus to a carboxy terminus, a firstloop (LI) connects Hl and H4; a second loop (L2) connects H4 and H2; a third loop (L3) connects H2 andH3; and wherein the polypeptide binds to IL-2 receptor Py (IL-2RPY), also referred to as IL-2/15RPy.
  • the designed cytokine does not bind to IL-2 receptor alpha (IL-2Ra).
  • the Designed Cytokine comprises one or more of a sequence of SEQ ID NO: 1-350.
  • the polypeptide comprises one or more of: (a) a sequence of SEQ ID NO: 1 -350 and (b) a sequence having at least 70% identity to a sequence of (a).
  • the polypeptide comprises a sequence of SEQ ID NO: 1-38 or 150-350.
  • the L3 loop comprises a sequence of QSKNFHLR (SEQ ID NO: 132).
  • the Hl helix comprises a sequence of SEQ ID NO: 39-51.
  • the H2 helix comprises a sequence of SEQ ID NO: 52-77.
  • the H3 helix comprises a sequence of SEQ ID NO: 78-97.
  • the H4 helix comprises a sequence of SEQ ID NO: 98-101.
  • the LI loop comprises a sequence of SEQ ID NO: 102-111.
  • the L2 loop comprises a sequence of SEQ ID NO: 112-131.
  • the polypeptide comprises a sequence of SEQ ID NO: 1-38 or 150-350.
  • the polypeptide comprises the sequence of
  • the polypeptide comprises the sequence of
  • the polypeptide comprises the sequence of Q Q [20] In some embodiments of the Designed Cytokine of the disclosure, the polypeptide comprises the sequence of
  • the polypeptide comprises the sequence of
  • the polypeptide is operably linked to a targeting moiety.
  • the polypeptide comprises a targeting moiety.
  • a fusion protein comprises the polypeptide and a targeting moiety.
  • the targeting moiety binds to a component of a tumor microenvironment (TME).
  • the targeting moiety binds to one or more of T-cell surface glycoprotein CD 8 (also known as cluster of differentiation 8), Programmed cell death protein 1 (PD-1), Programmed death-ligand 1 (PD-L1 ; also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) polypeptide), T-cell immunoreceptor with Ig and ITIM domains (TIGIT), Cytotoxic T-lymphocyte protein 4 (CTLA4), Lymphocyte activation gene 3 protein (LAG3), T-cell immunoglobulin mucin receptor 3 (TIM3).
  • the targeting moiety binds CD8.
  • the targeting moiety binds PD-1.
  • the targeting moiety bindsPD-Ll .
  • the targeting moiety comprises an antibody, an antibody mimetic, or a functional fragment thereof.
  • the targeting moiety comprises one or more of a monoclonal antibody, an antigen-binding fraction (Fab), a single-chain variable fraction (scFv), a domain antibody, one or more of a heavy chain (VH) and a light chain (VL) domain of an immunoglobulin (Ig) polypeptide or gene encoding the same, a heavy -chain antibody (a VH or a VHH), a camelid or camelid-like structured antibody, and a nanobody.
  • the targeting moiety comprises a scFv.
  • the targeting moiety comprises a VHH.
  • the polypeptide is operably linked to a tether.
  • the polypeptide comprises a tether.
  • a fusion protein comprises the polypeptide and a tether.
  • the tether comprises one or more of a nucleic acid sequence, an amino acid sequence, a small molecule.
  • the tether comprises a sequence isolated or derived from a transmembrane sequence.
  • the tether comprises the sequence [24]
  • the polypeptide is operably linked to a second cytokine or a second Designed Cytokine.
  • the polypeptide comprises a second cytokine or a second Designed Cytokine.
  • a fusion protein comprises the polypeptide and a second cytokine or a second Designed Cytokine.
  • the second cytokine comprises a sequence isolated or derived from one or more of an IL -2 polypeptide, an IL- 12 polypeptide, an IL- 15 polypeptide, an IL- 18 polypeptide, an IL-21 polypeptide, an IL-23 polypeptide, an interferon alpha polypeptide, an interferon beta polypeptide, an interferon gamma polypeptide, and an interferon omega polypeptide.
  • the polypeptide comprises a first targeting moiety and the second cytokine comprises a second targeting moiety.
  • the first targeting moiety and the second targeting moiety are identical. In some embodiments, the first targeting moiety and the second targeting moiety are not identical.
  • the second Designed Cytokine comprises a sequence of any one or more of SEQ ID NO: 1 -38 or 150-350.
  • the polypeptide comprises a first targeting moiety and the second Designed Cytokine comprises a second targeting moiety.
  • the first targeting moiety and the second targeting moiety are identical. In some embodiments, the first targeting moiety and the second targeting moiety are not identical.
  • the polypeptide comprises a first tether and the second cytokine comprises a second tether.
  • the first tether and the second tether are identical. In some embodiments, the first tether and the second tether are not identical.
  • the polypeptide comprises a first tether and the second Designed Cytokine comprises a second tether.
  • the first tether and the second tether are identical. In some embodiments, the first tether and the second tether are not identical.
  • the disclosure provides a nucleic acid encoding the designed cytokine of the disclosure or a fusion protein comprising the designed cytokine of the disclosure.
  • the nucleic acid further comprises a regulatory element capable of driving expression of the designed cytokine.
  • the regulatory element comprises a promoter.
  • the promoter comprises a minimal promoter.
  • the minimal promoter comprises a sequence isolated or derived from one or more of minimal promoter- 1 (“minPl”), YB-TATA and human beta globin.
  • the minPl comprises a sequence of A
  • the minimal promoter comprises the sequence of .
  • the minimal promoter comprises the sequence of In some embodiments, the promoter is inducible.
  • the regulatory element comprises a response element.
  • the regulatory element comprises a noncoding or an untranslated sequence isolated or derived from one or more of NF AT, NFkB, REL, RELA, IRF2, GAT A3 and ATF3.
  • the regulatory element comprises a noncoding or an untranslated sequence isolated or derived from a GATA3 gene.
  • the regulatory element comprises a noncoding or an untranslated sequence isolated or derived from RELA.
  • the response element comprises a repeated sequence.
  • the disclosure provides a vector comprising a nucleic acid of the disclosure.
  • the vector comprises an expression vector.
  • the vector comprises a delivery vector.
  • the vector further comprises a sequence encoding an exogenous receptor.
  • the exogenous receptor comprises an antigen binding moiety.
  • the exogenous receptor comprises a T Cell Receptor (TCR).
  • TCR T Cell Receptor
  • the exogenous receptor comprises a chimeric antigen receptor (CAR).
  • the antigen is expressed on or secreted within one or more of a tumor cell, a cancer cell, a component of a TME, and a TME.
  • a vector is a non -viral vector.
  • a non-viral vector comprises one or more of a plasmid, a nucleic acid, a polymer, a micelle, a polymersome, an exosome, a lysosome, a nanoparticle, and any combination thereof.
  • a vector is a viral vector.
  • the viral vector comprise a sequence isolated or derived from a sequence of a virus, a lentivirus or a lentiviral vector.
  • the disclosure provides a cell comprising a designed cytokine of the disclosure.
  • the disclosure provides a cell comprising a nucleic acid of the disclosure.
  • the disclosure provides a cell comprising a vector of the disclosure.
  • the cell is a mammalian cell.
  • the cell is a human cell.
  • the cell is a primary cell.
  • the cell is a cultured cell.
  • the cultured cell is an immortalized cell.
  • the cell is ex vivo or in vitro.
  • the cell is in vivo.
  • the cell is an immune cell.
  • the cell is a stem cell or a precursor cell capable of producing the immune cell.
  • the stem cell is a hematopoietic stem cells (HSC), an induced pluripotent stem cell (iPSC) or a dedifferentiated immune cell.
  • the immune cell is a T lymphocyte (T cell), a B lymphocyte (B cell), a macrophage or a natural killer (NK) cell.
  • the immune cell is a T cell.
  • the T cell is an alpha beta T cell.
  • the T cell is a gamma delta T cell.
  • the immune cell is aNK cell.
  • the disclosure provides a composition comprising a designed cytokine of the disclosure.
  • the disclosure provides a composition comprising a nucleic acid of the disclosure.
  • the disclosure provides a composition comprising a vector of the disclosure.
  • the disclosure provides a composition comprising a cell of the disclosure.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising one or more of (1) a designed cytokine of the disclosure, a nucleic acid of the disclosure, a vector of the disclosure, and a cell of the disclosure and (2) a pharmaceutically acceptable carrier.
  • the disclosure provides a use of a designed cytokine of the disclosure, a nucleic acid of the disclosure, a vector of the disclosure, a cell of the disclosure or a pharmaceutical composition of the disclosure in the manufacture of a medicament for the treatment of a disease or condition.
  • the disease or disorder comprises a cancer or a subtype thereof.
  • the cancer or the subtype thereof comprises a liquid cancer.
  • the cancer or the subtype thereof comprises a hematological cancer.
  • the cancer or the subtype thereof comprises a solid cancer.
  • the disclosure provides a designed cytokine of the disclosure, a nucleic acid of the disclosure, a vector of the disclosure, a cell of the disclosure or a pharmaceutical composition of the disclosure for use in the treatment of a disease or condition.
  • the disease or disorder comprises a cancer or a subtype thereof.
  • the cancer or the subtype thereof comprises a liquid cancer.
  • the cancer or the subtype thereof comprises a hematological cancer.
  • the cancer or the subtype thereof comprises a solid cancer.
  • the disclosure provides a method of treating a disease or disorder comprising administering to a subject an effective amount of a designed cytokine of the disclosure, a nucleic acid of the disclosure, a vector of the disclosure, a cell of the disclosure or a pharmaceutical composition of the disclosure, wherein a severity of a sign or symptom of the disease or disorder is decreased, thereby treating the disease or disorder.
  • the disease or disorder comprises a cancer or a subtype thereof.
  • the cancer or the subtype thereof comprises a liquid cancer.
  • the cancer or the subtype thereof comprises a hematological cancer.
  • the cancer or the subtype thereof comprises a solid cancer.
  • the disclosure provides a method of preventing a disease or a disorder, comprising administering to a subject an effective amount of a designed cytokine of the disclosure, a nucleic acid of the disclosure, a vector of the disclosure, a cell of the disclosure or a pharmaceutical composition of the disclosure, wherein an onset or a relapse of a sign or symptom of the disease or disorder is delayed or inhibited, thereby preventing the disease or disorder.
  • the disease or disorder comprises a cancer or a subtype thereof.
  • the cancer or the subtype thereof comprises a liquid cancer.
  • the cancer or the subtype thereof comprises a hematological cancer.
  • the cancer or the subtype thereof comprises a solid cancer.
  • FIG. 1 A is a schematic diagram depicting a naturally occurring form of IL-2 (left) and an exemplary non -naturally occurring designed cytokine of the disclosure, in which one or more loops are redesigned to alter binding of the designed cytokine to the naturally -occurring or endogenous IL-2 receptor beta (IL-2RP) or IL-2 receptor gamma (IL-2Ry, also known as the common gamma chain receptor), but not IL-2 receptor alpha (IL-2Ra).
  • IL-2RP IL-2 receptor beta
  • IL-2Ry also known as the common gamma chain receptor
  • IL-2Ra IL-2 receptor alpha
  • exemplary non-naturally occurring designed cytokines of the disclosure contain a sequence isolated or derived from a helix of an IL-2 cytokine with the connectivity of the designed cytokine either according to the 1 -4-2-3 plan depicted herein or according to a structure of four helices connected by loops lacking the capacity to bind and/or activate the IL-2 receptor alpha by lacking an interface for binding to the IL-2 receptor alpha.
  • FIG. IB is a series of schematic diagram depicting on the left half, an updated diagram highlighting the interactions with each subunit of the IL-2 receptor that allow for IL-15 functionality and on the right half, a diagram according to FIG. 1 A, showing a correspondence between the abstract schematic and the ribbon schematic.
  • FIG. 2 is a schematic diagram depicting T cell subtype-specific IL-2 WT signaling. As shown in FIG. 1 A-B, designed cytokines of the disclosure signal through one or more of th e beta and gamma subunits of the IL-2 Receptor.
  • FIG. 3 A is a schematic diagram showing that designed cytokines of the disclosure, as beta/gamma binders, may target specific cell subtypes. Moreover, designed cytokines of the disclosure may be linked to or may comprise a targeting moiety. While the targeting moiety may bind to any target, including, but not limited to, an antigen present or expressed within a cell or other component of a tumor microenvironment (TME) such as CD8 or PDL1 .
  • TEE tumor microenvironment
  • FIG. 3B is a schematic diagram showing that designed cytokines of the disclosure, may target specific cell subtypes, as a result of (1) being designed as beta/gamma binders, (2) targeted to a cellular subtype, (3) tethered to a T cell or subtype thereof (e.g., alpha-beta, gamma-delta, CD8+, CD4+, natural killer T cell (NKT cell)), or any combination thereof.
  • Targeted designed cytokines may be linked to or comprise a targeting moiety, which may bind to any target, including, but not limited to, an antigen present or expressed within a cell or other component of a tumor microenvironment (TME) such as CD8 or PDL1 .
  • TAE tumor microenvironment
  • Tethered designed cytokines may be linked to or comprise a tether, which may comprise a nucleic acid, an amino acid, a small molecule or any combination thereof, and which may link the designed cytokine to cell (e.g., T-cell, NK cell or other immune cell) expressing the designed cytokine or to any component of that cell.
  • a targeting moiety may be advantageous to localize the designed cytokine or a cell expressing it to a solid tumor or to a TME for localized signaling from the designed cytokine (as opposed to systemic signaling from the designed cytokine).
  • the use of a tether may be advantageous to minimize bystander activity of cells proximal to either the target cell or to the cell expressing the designed cytokine. In some embodiments, the use of a tether may be advantageous for the treatment of liquid or hematological tumors. In some embodiments, the use of a tether may be advantageous for use with T cells, wherein the bystander cell may be a Natural Killer (NK) cell.
  • NK Natural Killer
  • FIG. 4 is a schematic diagram showing that designed cytokines of the disclosure lack an interface to bind and/or activate the alpha subunit of the IL-2 Receptor. Moreover, the ablation of this interface retains native interfaces for binding IL-2 Receptor beta and IL-2 Receptor gamma subunits that are shared between the IL-2 and IL-15 Receptors.
  • the design of short and structured loops between helices increases protein stability when compared to the loop length, loop structure and/or protein stability of wild type (WT) IL-2.
  • FIG. 5 A is a pair of graphs demonstrating that of thirty -eight (38) designed cytokines tested alone with a WT IL-2 and a negative control, the common structural arrangement of the designed cytokines ablates IL-2 Receptor alpha biding in all designed cytokines (top) while retaining signaling through the beta and gamma subunits of the IL-2 Receptor (the gamma subunit being shared with the IL-15 Receptor).
  • FIG. 5B is a series graphs demonstrating that designed cytokines of the disclosure bind to IL-2/15 R ⁇ with very low nanomolar affinity.
  • affinity measured nanomolar (nm) concentration
  • WT IL2 top
  • a designed cytokine bottom
  • IL-IRa left
  • IL-2/15R0y right
  • Compositions of either WT IL-2 or a designed cytokine were tested at between 0.9 nM and 3000 nM to generate these plots.
  • FIG. 6 is a series graphs demonstrating that activity of designed cytokines of the disclosure may be tuned over a wide range.
  • designed cytokines may be “tuned” to perform optimally either within a desired cell type, a desired TME, a desired target cell, and/or a desired cytokine receptor (e.g., a ratio of activity between IL-2 and IL-15).
  • An initial design of a designed cytokine may comprise a sequence of the disclosure or a sequence having at least 70% identity thereto.
  • An optimized design of a designed cytokine may comprise a sequence of the disclosure or a sequence having at least 70% identity thereto.
  • An optimized design of a designed cytokine may comprise a sequence derived from a sequence of the disclosure that is generated according to the teachings provided by the disclosure.
  • Top plot cell proliferation was assessed by measuring the percentage of phosphorylated Signal transducer and activator of transcription 5 (STAT5) of CD8+ T cells following stimulation with antigen as a function of concentration of either WT IL-2 or designed cytokine provided (concentration measured as nanograms per milliliter (ng/ml)).
  • STAT5 phosphorylated Signal transducer and activator of transcription 5
  • Designed Cytokines of the disclosure maybe “optimized” as shown in the top right plot to have a desired activity profile.
  • FIG. 7 is a series graphs demonstrating that Designed Cytokines do not have a regulatory T cell (Treg) preference when compared to WT IL-2, however, Designed Cytokines retain NK and CD8+ T cell activity.
  • WT IL-2 top plots
  • Designed Cytokine bottom plots
  • STAT5 phosphorylated Signal transducer and activator of transcription 5
  • FIG. 8 is a graph demonstrating in vitro cell proliferation in the presence of 1 nanomolar (nM) WT IL-2 or Designed Cytokine.
  • the measure on the Y -axis is a relative scale in which the cell expansion, measured as shown in FIG. 7, is normalized to WT activity (held at a value of
  • PBMCs peripheral blood mononuclear cells
  • NK cells activated CD8+ T cells
  • Designed Cytokines eliminate the Treg preference shown by WT IL-2 while retaining the ability to proliferate NK and CD8+ T cells.
  • FIG. 9 is a series graphs demonstrating that Designed Cytokines do not have a regulatory T cell (Treg) preference when compared to WT IL-2, however, Designed Cytokines retain NK and CD8+ T cell activity.
  • WT IL-2 top
  • Designed Cytokines bottom
  • PBMCs left
  • isolated NK cells middle
  • CD3/28-activated T cells in nanomolar (nM) concentrations to measure fold expansion.
  • nM nanomolar
  • FIG. 10 is a schematic diagram and a graph demonstrating the enhanced activity of T cells expressing both a CAR and a Designed Cytokine of the disclosure.
  • the schematic diagram depicts the experimental design that was used to generate the data displayed the graph.
  • the fold expansion of cells mock transfected, transfected with only a chimeric antigen receptor (CAR), transfected with a CAR in combination with a WT IL-2 construct, or transfected with a CAR and a construct providing a Designed Cytokine of the disclosure were repeatedly stimulated by plate-bound antigen and, following each round, the fold expansion was assessed.
  • CAR chimeric antigen receptor
  • FIG. 11 is a schematic diagram and a graph demonstrating that T-cell activation induced secretion of Designed Cytokines using inducible promoters capable of driving expression, conditionally, of the Designed Cytokine in response to antigen receptor signaling (e.g., CAR or TCR) or cell state (stimulated T cell).
  • antigen receptor signaling e.g., CAR or TCR
  • cell state e.g., T cell state
  • FIG. 12 is a schematic diagram and a graph demonstrating that, when compared to WT IL-2, incorporating short and structured loops within the Designed Cytokines increases the protein stability of the Designed Cytokine.
  • the schematic diagram on the left depicts the structural differences of the loops in WT IL-2 versus the Designed Cytokines of the disclosure.
  • the graph depicts protein unfolding/instability (measured by intrinsic fluorescence) as a function of function of increasing molar concentrations of guanidine hydrochloride ([GdnHCl (M)]), an agent that denatures/unfolds proteins.
  • WT IL-2 internal is meant to describe a WT IL-2 having an identical sequence to commercially available WT IL-2 proteins, that was synthesized by the applicant.
  • FIG. 13 is a graph demonstrating that two exemplary Designed Cytokines of the disclosure exhibit IL- 15 -like effects on NK cells in vitro.
  • the activity of a commercially purchased WT IL-2 and the internally generated WT IL-2 were compared.
  • a WT IL-15 polypeptide was used as a positive control and for a basis of comparison for IL-15 -like, as opposed to IL-2 -like effects.
  • FIG. 14A is a series of schematic diagrams demonstrating that, in some embodiments, Designed Cytokines of the disclosure may be fused to a targeting moiety, or, described from another perspective, a fusion protein may comprise a Designed Cytokine and a targeting moiety.
  • the right-most diagram depicts signaling in trans.
  • FIG. 14B is a graph demonstrating that the use of the targeting moiety to localize the physical presence and/or signaling activity of the Designed Cytokine to, for example, a TME, does not impair any activity, receptor binding of or signaling from the Designed Cytokine.
  • the percentage of total cells that bind Designed Cytokines are shown as a function of the nanomolar (nM) protein concentration the targeting moiety bound to the Designed Cytokine.
  • FIG. 14C is a series of graphs demonstrating the use of targeting moieties with four exemplary Designed Cytokines of the disclosure.
  • the cell proliferative activity of each Targeted Designed Cytokine is measured as a percentage of phosphorylated PSTAT5+ cells as a function of the nanomolar concentration of the Targeted Designed Cytokine provided.
  • the labels, “VHH-1” as opposed to “VHH-2” are meant to depict two VHH targeting moieties having distinct sequences.
  • FIG. 15 is a series of schematic diagrams of two exemplary Designed Cytokines of the disclosure, contrasted against WT IL-2, demonstrating the structural differences between IL-2 and each Designed Cytokine. Moreover, the diagrams reflect structural modifications to each Designed Cytokine that result in functional changes to the protein. While each Designed Cytokine contains a helical initiator (e.g., a lysine (L)) at the front to the H4 helix, the “conjugation” Designed Cytokine which more easily conjugates with, for example, a targeting moiety, has an extended H2 helix and a shorter loop between the H4 and H2 helices.
  • a helical initiator e.g., a lysine (L)
  • FIG. 16 is a series of graphs demonstrating that Designed Cytokine No. 201 shows no detectable binding to IL2Ra whereas WT IL-2 binds to IL2Ra with nanomolar affinity.
  • FIG. 17A is a graph depicting two replicate experiments (the previous experiment shown in FIG. 6) side-by-side to demonstrate that activities of exemplary Designed Cytokines may be tuned over a wide range.
  • FIG. 17B is a graph depicting the later replicate of the experiments shown in FIG 6 and FIG 17 A.
  • FIG. 18 is a series of graphs demonstrating the binding affinity (by Octet) of either WT IL-2 (left-hand plots) and two exemplary Designed Cytokines (middle and right-hand plots) to IL-2Rpy.
  • FIG. 19 is a series of graphs demonstrating the cell proliferative capacity of three exemplary Designed Cytokines when compared to WT IL-2 in three cell types (NK cells, Treg cells and CD8+ T cells).
  • FIG. 20 is a pair of schematic diagrams and coordinating pairs of graphs demonstrating the cis versus trans targeting of Designed Cytokines of the disclosure by varying the binding preferences of the targeting moieties.
  • PD-1 and CD8 mediate cis-targeting of activated T cells by Designed Cytokines of the disclosure.
  • PD-L1 mediates cis-targeting on activated cells and trans presentation of Designed Cytokines of the disclosure.
  • FIG. 21 A is a schematic diagram showing the experimental design used to generate data provided in FIGS. 2 IB and 21C. Briefly, CAR-T cells were sequentially challenged with Hl 975 tumor cells in the presence of recombinant Designed Cytokine, Designed Cytokine + binding domain to target (added separately at equimolar ratios), or targeted Designed Cytokine: Targeted Designed Cytokine No. 169 is fused to a VHH binding domain that binds either PD-L1, PD-1, or CD8.
  • FIG. 2 IB is a pair of graphs, corresponding to two distinct T-cell donors, demonstrating the killing activity of PDL1 -targeted Designed Cytokines of the disclosure.
  • FIG. 21 C is a pair of graphs, corresponding to two distinct T -cell donors, demonstrating the killing activity of PDL1 -targeted Designed Cytokines of the disclosure.
  • FIG. 2 ID is a pair of graphs, corresponding to two distinct T-cell donors, demonstrating the killing activity of CD8-targeted Designed Cytokines of the disclosure.
  • FIG. 22A is a graph demonstrating the cell proliferation activity of Designed Cytokines derived from Designed Cytokine No. 153 in Natural Killer cells.
  • FIG. 22B is a graph demonstrating the cell proliferation activity of Designed Cytokines derived from Designed Cytokine No. 153 in CD8+ T cells.
  • FIG. 23A is a series of schematic diagrams depicting two vector (2 V), single vector (IV) and autoregulation circuits incorporating an Inducible Designed Cytokine.
  • DC is meant to describe a Designed Cytokine.
  • the expression of an Inducible Designed Cytokine is under the control of one or more response elements (RE Array) and a promoter sequence (which may be a minimal promoter sequence (pMin)).
  • RE Array response elements
  • pMin minimal promoter sequence
  • the Marker and the CAR elements in each 2 V and 1 V diagram are under the control of the MND promoter.
  • the expression of the CAR and the Designed Cytokine are under the control of an inducible promoter, which is active during periods of cell stimulation.
  • FIG. 23B is a schematic diagram depicting the experimental design that was used to generate the data shown in FIG. 23C.
  • CAR-T cells containing a vector or circuit depicted in 23 A were stimulated by plate -bound antigen.
  • WT IL-2 in the control or the Secreted Inducible Designed Cytokine was measured in the supernatant.
  • FIG. 23 C is a graph demonstrating that Inducible Designed Cytokines (DCs) show increased expression relative to Control, either CAR only (with no Designed Cytokine) or without antigen stimulation.
  • DCs Inducible Designed Cytokines
  • FIG. 24 is a series of graphs demonstrating that exemplary Inducible Designed Cytokines retain target cell killing activity better than a CAR-only control after three sequential rounds of stimulation.
  • the disclosure provides “designed cytokines” that are non-naturally occurring polypeptides of the disclosure, in accordance with the embodiments illustrated within the drawings and the sequences provided herein, that demonstrate functional benefits of IL-2 and IL-15. Accordingly, the “designed cytokines” may be referred to as “IL-2/15 Polypeptides” or “IL-2/15.” These terms are interchangeable with “designed cytokines.”
  • the disclosure provides designed cytokines, preferably demonstrating one or more of the following attributes: (1 ) reduces or ablates binding of the designed cytokine to the alpha subunit of the IL-2 Receptor (IL-2Ra), optionally without post-translational modifications to the designed IL-2 polypeptide, (2) binds or retains binding of the designed IL-2 polypeptide to the beta and/or gamma subunit of the IL-2 Receptor (IL-2Rp/y), (3) preferentially stimulates or more potently stimulates T cell(s) expressing CD8 (CD8 T cells) more than stimulating regulatory T cell(s) (Treg), (4) preferentially stimulates or more potently stimulates Natural Killer (NK) cells than CD8 T cells, (5) enhances an activity of T cells expressing or secreting a designed IL-2 polypeptide of the disclosure, (6) demonstrates stable folding of the designed IL-2 polypeptide into a protein in vitro or in vivo, (7) demonstrates reduced,
  • designed cytokines of the disclosure may (l) bind to an IL-15 Receptor (IL-15R), a beta subunit, or a gamma subunit thereof and/or (2) compete with an IL- 15 cytokine, includingWT IL-15, for bindingto an IL-15R, a beta subunit, or a gamma subunit thereof.
  • IL-15R IL-15 Receptor
  • beta subunit a beta subunit
  • gamma subunit thereof a gamma subunit thereof
  • designed cytokines of the disclosure (1) localize expression, translation, production and/or secretion of a designed IL-2 polypeptide of the disclosure to a tumor, target cell, and/or tumor microenvironment (TME), (2) target a TME, and/or (3) maintain localization at a TME.
  • TME tumor microenvironment
  • the designed cytokine comprises a targeting moiety.
  • the targeting moiety comprises a nucleic acid, an amino acid, or a combination thereof which specifically binds to a target on or with the lymph node, the tumor, the tumor microenvironment, the site of malignancy or the site of metastasis, or in each case a cell thereof.
  • the fusion protein or the targeting moiety comprises an antibody, an antibody mimetic, or a functional fragment thereof.
  • the targeting moiety comprises an scFv, a VH or a VHH.
  • the targeting moiety comprises an scFv, a VH or a VHH that specifically or selectively binds to T-cell surface glycoprotein CD8 (also known as cluster of differentiation 8), Programmed cell death protein 1 (PD-1), Programmed death-ligand 1 (PD- L1 ; also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7 -Hl) polypeptide), T-cell immunoreceptor with Ig and ITIM domains (TIGIT), Cytotoxic T- lymphocyte protein 4 (CTLA4), Lymphocyte activation gene 3 protein (LAG3), T-cell immunoglobulin mucin receptor 3 (TIM3).
  • T-cell surface glycoprotein CD8 also known as cluster of differentiation 8
  • PD-1 Programmed cell death protein 1
  • PD- L1 also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7 -Hl) polypeptide
  • T-cell immunoreceptor with Ig and ITIM domains T-cell immunoreceptor with I
  • the designed cytokine comprises a “tether” to operably -link the designed cytokine to (1) a cell expressingthe designed cytokine or (2) a cell delivering the designed cytokine to a target cell, an immune synapse and/or a TME.
  • the tether comprises a DNA, RNA, amino acid or any combination thereof.
  • the tether comprises a defined secondary structure.
  • the tether has a rigid structure.
  • the tether has a flexible conformation.
  • the tether has an elastic conformation.
  • the tether comprises a cleavable sequence. In some embodiments, the tether comprises a transmembrane sequence or a membrane anchoring sequence. In some embodiments, the tether is optionally linked to the Designed Cytokine by a linker sequence. In some embodiments, the tether is optionally linked to the Designed Cytokine by a linker sequence comprising a “GS” linker. In some embodiments, the tether comprises a sequence of “PLFIPVAVMVTAFSGLAFIIWLARRLKKGKK.”
  • a construct comprises an inducible promoter capable of expressing a designed cytokine and a sequence encoding a designed cytokine.
  • the construct may further comprise a sequence encoding a targeting moiety.
  • the construct may further comprise a sequence encoding a tether.
  • the construct may further comprise a linker positioned between the sequence encoding the designed cytokine and one or more of a sequence encoding a targeting moiety and a sequence encoding a tether.
  • a fusion protein comprises a designed cytokine and either a targeting moiety or a tether.
  • a linker is positioned between the designed cytokine and either the targeting moiety or the tether.
  • an immune cell expresses a designed cytokine of the disclosure.
  • the immune cell secretesthe designed cytokine.
  • the designed cytokine comprises a tether and contacts to the immune cell.
  • the tethered designed cytokine contacts a plasma membrane of the immune cell or a component thereof.
  • the tethered designed cytokine contacts an exterior surface of the plasma membrane of the immune cell.
  • designed cytokines of the disclosure are capable of being expressed in a vector alone, or in combination, with one or more of an antigen receptor (e.g., a T cell receptor (TCR), a chimeric antigen receptor (CAR), or any combination thereof).
  • the vector comprises a viral vector.
  • the vector comprises a non-viral vector.
  • the vector consists of a single vector.
  • a viral vector comprises a sequence comprising a sequence encoding the designed cytokine and a sequence encoding an antigen receptor (e.g., a T cell receptor (TCR), a chimeric antigen receptor (CAR), or any combination thereof).
  • a single viral vector comprises a sequence comprising a sequence encoding the designed cytokine and a sequence encoding an antigen receptor (e.g., a T cell receptor (TCR), a chimeric antigen receptor (CAR), or any combination thereof).
  • an antigen receptor e.g., a T cell receptor (TCR), a chimeric antigen receptor (CAR), or any combination thereof.
  • the viral vector comprises a sequence isolated or derived from a lentiviral vector.
  • the viral vector comprises a lentiviral vector.
  • the disclosure provides designed cytokines demonstrating functional benefits of IL-2 and IL-15.
  • the disclosure provides designed cytokines, preferably demonstrating one or more of the following attributes: (1) reduces or ablates binding of the designed cytokine to the alpha subunit of the IL-2 Receptor (IL-2Ra), optionally without post-translational modifications to the designed IL-2 polypeptide, (2) binds or retains binding of the designed IL-2 polypeptide to the beta and/or gamma subunit of the IL-2 Receptor (IL-2Rp/y), (3) preferentially stimulates or more potently stimulates T cell(s) expressing CD8 (CD8 T cells) more than stimulating regulatory T cell(s) (Treg), (4) preferentially stimulates or more potently stimulates Natural Killer (NK) cells than CD8 T cells, (5) enhances an activity of T cells expressing or secreting a designed IL-2 polypeptide of the disclosure, (6) demonstrates stable folding of
  • designed cytokines of the disclosure may (l) bind to an IL-15 Receptor (IL-15R), a beta subunit, or a gamma subunit thereof and/or (2) compete with an IL-15 cytokine, includingWT IL-15, for bindingto an IL-15R, a beta subunit, or a gamma subunit thereof.
  • IL-15R IL-15 Receptor
  • beta subunit a beta subunit
  • gamma subunit thereof a gamma subunit thereof
  • Wild type IL-2 and IL-15 both stimulate signaling through IL-2/15RP (also referred to IL-2RP) and common IL-2/15Ry chains (also referred to as IL-2Ry); IL-2 and IL-15 both bind to and activate signaling through the heterodimeric Py receptor complex, IL-2/15 RPy (also referred to as IL-2RPy), and their unique biology is principally driven through respective interactions with IL-2Ra (cis presentation) and IL-15Ra (trans presentation).
  • Designed IL-2 polypeptides of the disclosure also known as IL-2/15 polypeptides of the disclosure agonize the Py receptor pairthatis shared by IL-2 and IL-15, while avoiding IL-2Ra and IL-15Ra. Therefore, designed IL-2/15 polypeptides of the disclosure may demonstrate activities of both IL-2 and IL-15 when expressed by different cell types or when contacting different cell types.
  • IL-2 and IL-15 stimulate diverse types of lymphocytes and natural killer cells. Among the distinct functions between these two cytokines, IL-2 mediates regulatory T cell homeostasis and regulates T helper (TH) differentiation. Moreover, IL-15 mediates expansion of CD8 memory T cells, NK cells, and NK T cells. Designed IL-2/15 polypeptides of the disclosure may demonstrate one or more activities of IL-2 and IL-15 in a particular cell type.
  • Designed Cytokines of the disclosure may be “tuned” or “optimized” with respect to an activity of the cytokine. Designed Cytokines of the disclosure may be “tuned” or “optimized” to demonstrate a preferred ratio of an IL-2 activity to an IL-15 activity. In some embodiments, Designed Cytokines may be tuned to achieve particular thresholds of activity of a wild type IL-2 polypeptide and particular thresholds of activity of a wild type IL-15 polypeptide. In some embodiments, tuning of an IL-2/15 polypeptide of the disclosure does not comprise a change to the structure of a Designed Cytokine (e.g., the 1 -4-2-3 arrangement of its helices).
  • tuning of a Designed Cytokine of the disclosure comprises one or more of (1) modifying a sequence of a Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), (2) modifying a physical length of a folded Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), (3) inserting a new sequence into an existing sequence of a Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), and/or (4) removing a sequence of a Designed Cytokine or a portion thereof (e.g., an alphahelix, a loop, or a combination thereof).
  • a tuned Designed Cytokine of the disclosure comprises a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, or any percentage identity in between when compared to a Designed Cytokine of the disclosure not subjected to the tuning process.
  • a tuned Designed Cytokine of the disclosure comprises a sequence isolated or derived from an IL-15 sequence.
  • the disclosure provides Designed Cytokine (formerly known as “IL-2/15 polypeptides”) that may be “tuned” or “optimized” with respect to any activity of the cytokine, to demonstrate a threshold of activity in one or more cell types.
  • tuning or optimizing a Designed Cytokine of the disclosure for use in a cell type does not comprise a change to the structure of the Designed Cytokine (e.g., the 1 -4-2-3 arrangement of its helices).
  • optimizing a Designed Cytokine of the disclosure for use in a cell type comprises one or more of (1) modifying a sequence of a Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), (2) modifying a physical length of a folded Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), (3) inserting a new sequence into an existing sequence of a Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof), and/or (4) removing a sequence of a Designed Cytokine or a portion thereof (e.g., an alpha helix, a loop, or a combination thereof).
  • an optimized Designed Cytokine of the disclosure comprises a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, or any percentage identity in between when compared to a Designed Cytokine of the disclosure not subjected to the optimizing process.
  • an optimized Designed Cytokine of the disclosure comprises a sequence isolated or derived from an IL- 15 sequence.
  • Designed Cytokines may be used in combination with or operably linked to a second cytokine or a second Designed Cytokine.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be independently modified, regulated and/or targeted.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be coordinated in one or more of modification, regulation and/or targeting.
  • a Designed Cytokine of the disclosure may be used in combination with any cytokine, whether naturally occurring or modified.
  • a Designed Cytokine of the disclosure may be used in combination with one or more of an IL-2 polypeptide, an IL- 12 polypeptide, an IL- 15 polypeptide, an IL- 18 polypeptide, an IL-21 polypeptide, an IL-23 polypeptide, and an interferon polypeptide (including, but not limited to, an interferon alpha, beta, gamma and/or omega polypeptide).
  • a Designed Cytokine of the disclosure maybe used in combination with an IL-2 polypeptide.
  • a Designed Cytokine of the disclosure may be used in combination with an IL-12 polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an IL-15 polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an IL-18 polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be usedin combination with an IL-21 polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an IL-23 polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an interferon alpha polypeptide.
  • a Designed Cytokine of the disclosure may be used in combination with an interferon beta polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an interferon gamma polypeptide. In some embodiments, a Designed Cytokine of the disclosure may be used in combination with an interferon omega polypeptide.
  • the second cytokine comprises a wild type sequence. In some embodiments, the second cytokine does not comprise a wild type sequence. In some embodiments, the second cytokine comprises one or more modifications to alter an activity of the cytokine towards one or more cytokine receptors.
  • a Designed Cytokine of the disclosure may be used in combination with a second Designed Cytokine of the disclosure to generate a combination of a first Designed Cytokine and a second Designed Cytokine.
  • a Designed Cytokine may be expressed with a second cytokine or a second Designed Cytokine of the disclosure.
  • the expression may be simultaneous.
  • the expression may be sequential.
  • the expression may deregulated or inducible with the use of an inducible promoter of the disclosure.
  • a Designed Cytokine may be secreted with a second cytokine or a second Designed Cytokine of the disclosure.
  • the secretion may be simultaneous.
  • the secretion may be sequential.
  • the secretion maybe regulated or inducible with the use of an inducible promoter of the disclosure.
  • a Designed Cytokine may be operably linked to a second cytokine or a second Designed Cytokine of the disclosure.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be operably linked via a linker sequence.
  • the linker sequence comprises a nucleic acid, an amino acid, a small molecule or any combination thereof.
  • the linker is rigid.
  • the linker is flexible.
  • a linker sequence may comprise a “GS” sequence of any length.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be operably linked via a targeting moiety of the disclosure.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be operably linked to the same targeting moiety.
  • a composition comprising a Designed Cytokine and a second cytokine or a second Designed Cytokine may comprise the same targeting moiety.
  • a Designed Cytokine may comprise a first targeting moiety and a second cytokine or a second Designed Cytokine may comprise a second targeting moiety.
  • the first targeting moiety and the second targeting moiety bind the same target. In some embodiments, the first targeting moiety and the second targeting moiety do not bind the same target. In some embodiments, the first targeting moiety and the second targeting moiety are identical. In some embodiments, the first targeting moiety and the second targeting moiety not identical.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be operably linked via a tether of the disclosure.
  • a Designed Cytokine and a second cytokine or a second Designed Cytokine may be operably linked to the same tether.
  • a composition comprising a Designed Cytokine and a second cytokine or a second Designed Cytokine may comprise the same tether.
  • a Designed Cytokine may comprise a first tether and a second cytokine or a second Designed Cytokine may comprise a second tether.
  • the first tether and the second tether bind the same target. In some embodiments, the first tether and the second tether do not bind the same target. In some embodiments, the first tether and the second tether are identical. In some embodiments, the first tether and the second tether not identical.
  • a Designed Cytokine is operably linked to one or more of an IL-2 polypeptide, an IL- 12 polypeptide, an IL- 15 polypeptide, an IL- 18 polypeptide, an IL-21 polypeptide, an IL-23 polypeptide, and an interferon polypeptide (including, but not limited to, an interferon alpha, beta, gamma and/or omega polypeptide).
  • a Designed Cytokine is operably linked to an IL-21 polypeptide.
  • Designed Cytokines target, localize to or remain active at one or more of a target cell, a target cell type, an organ, a lymph node, a tumor (including, but not limited to, liquid tumors, hematological cancers, and solid tumors), a biological microenvironment, a tumor microenvironment (TME), a site of malignancy, a site of metastasis, a site of vascularization of a tumor, and any combination thereof.
  • TEE tumor microenvironment
  • a fusion protein comprises a Designed Cytokine that targets, localizes to or remains active at one or more of a target cell, a target cell type, an organ, a lymph node, a tumor (including, but not limited to, liquid tumors, hematological cancers, and solid tumors), a biological microenvironment, a tumor microenvironment (TME), a site of malignancy, a site of metastasis, a site of vascularization of a tumor, and any combination thereof.
  • a Designed Cytokine comprises a targeting moiety.
  • a Designed Cytokine is operably linked to a targeting moiety.
  • a Designed Cytokine is operably linked to a targeting moiety by one or more of a covalent bond, a noncovalentbond, hybridization, dimerization, complex formation, a linker and a tether.
  • a Designed Cytokine is operably linked to a targeting moiety by a linker comprising one or more of a nucleic acid sequence, an amino acid sequence, a small molecule (organic or inorganic) and any combination thereof.
  • a Designed Cytokine is operably linked to a targeting moiety by a tether comprising one or more of a nucleic acid sequence, an amino acid sequence, a small molecule (organic or inorganic) and any combination thereof.
  • a Designed Cytokine is operably linked to a targeting moiety by a tether that is attached to a component of one or more of a target cell, a target cell type, an organ, a lymph node, a tumor (including, but not limited to, liquid tumors, hematological cancers, and solid tumors), a biological microenvironment, a tumor microenvironment (TME), a site of malignancy, a site of metastasis, a site of vascularization of a tumor, and any combination thereof.
  • a Designed Cytokine is operably linked to a targeting moiety by a tether that is attached to a component of an immune cell expressing or secreting the Designed Cytokine.
  • a targeting moiety comprises a nucleic acid, an amino acid, or a combination thereof which specifically binds to a component of one or more of a target cell, a target cell type, an organ, a lymph node, a tumor (including, but not limited to, liquid tumors, hematological cancers, and solid tumors), a biological microenvironment, a tumor microenvironment (TME), a site of malignancy, a site of metastasis, a site of vascularization of a tumor, and any combination thereof.
  • a targeting moiety comprises a binding domain, a protein scaffold, an antibody, an antibody mimetic, and/or a functional fragment thereof.
  • a targeting moiety comprises a sequence, which may be isolated or derived from any species, including but not limited to, human, non -human primate, rodent (including, but not limited to, mouse), andcamelid species.
  • a targeting moiety comprises a sequence, which may be humanized, chimeric, recombinant, non -naturally occurring, modified (for example, to include synthetic nucleic acids or synthetic amino acids), optimized (for example, to reduce immunogenicity and/or aggregation during manufacturing).
  • a targeting moiety comprises an antibody, including, but not limited to, a monoclonal antibody, an antigen-binding fraction (Fab), a singlechain variable fraction (scFv), a domain antibody, one or more of a heavy chain (VH) and a light chain (VL) domain of an immunoglobulin (Ig) polypeptide or gene encoding the same, a heavychain antibody (a VH or a VHH), a camelid or camelid-like structured antibody, and a nanobody.
  • a targeting moiety comprises an scFv, a VH or a VHH.
  • a targeting moiety comprises an scFv, a VH or a VHH that specifically or selectively binds to a target including, but not limited to, T-cell surface glycoprotein CD8 (also known as cluster of differentiation 8), Programmed cell death protein 1 (PD-1), Programmed death-ligand 1 (PD-L1 ; also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) polypeptide), T-cell immunoreceptor with Igand ITIM domains (TIGIT), Cytotoxic T- lymphocyte protein 4 (CTLA4), Lymphocyte activation gene 3 protein (LAG3), and T-cell immunoglobulin mucin receptor 3 (TIM3).
  • T-cell surface glycoprotein CD8 also known as cluster of differentiation 8
  • PD-1 Programmed cell death protein 1
  • PD-L1 also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) polypeptide
  • T-cell immunoreceptor with Igand ITIM domains T
  • a targeting moiety comprises an antibody mimetic, including, but not limited to, one or more of an engineered protein scaffold, a monobody, an affibody molecule, an adnectin molecule, an affimer molecule, an affitin molecule, an affilin molecule, an alphabody molecule, an anticalin molecule, an aptamer molecule, an atrimer molecule, an avimer molecule, a DARPin molecule, a fynomer, an armadillo repeat protein molecule, a Kunitz domain inhibitor molecule, a knottin molecule, a designed ankyrin repeat protein molecule, a nanofittin molecule and a centyrin molecule.
  • an engineered protein scaffold including, but not limited to, one or more of an engineered protein scaffold, a monobody, an affibody molecule, an adnectin molecule, an affimer molecule, an affitin molecule, an affilin
  • a targeting moiety comprises an antibody mimetic that specifically or selectively binds to a target including, but not limited to, T-cell surface glycoprotein CD8 (also known as cluster of differentiation 8), Programmed cell death protein 1 (PD-1), Programmed death-ligand 1 (PD-L1 ; also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) polypeptide), T-cell immunoreceptor with Ig and ITIM domains (TIGIT), Cytotoxic T- lymphocyte protein 4 (CTLA4), Lymphocyte activation gene 3 protein (LAG3), and T-cell immunoglobulin mucin receptor 3 (TIM3).
  • T-cell surface glycoprotein CD8 also known as cluster of differentiation 8
  • PD-1 Programmed cell death protein 1
  • P-L1 also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) polypeptide
  • T-cell immunoreceptor with Ig and ITIM domains T-cell immunoreceptor with Ig and ITIM
  • the disclosure provides a nucleic acid encoding a non-naturally occurring polypeptide of the disclosure.
  • a promoter or an inducible promoter capable of driving expression in a mammalian cell controls expression of the nucleic acid encoding a Designed Cytokine of the disclosure.
  • an inducible promoter of the disclosure comprises a minimal promoter.
  • a minimal promoter of the disclosure comprises a sequence isolated or derived from one or more of minimal promoter- 1 (“minPl”), YB-TATA and human beta globin.
  • the minimal promoter comprises one or more of “minPl” having a sequence of “minP2” having a sequence of
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to one or more of BACH2, BARX1, BATF, ELF1, ELF2, Elf4, Elkl, ERF, ETV1, Flil, FOXP1, GABPA, GATA3, IRF1, IRF2, IRF5, IRF7, IRF9, MAF, MAFF, Maz, Mef2d, MLX, MYB, NF AT, NFATC3, NFkB, NR4A1, Nur77, PATZ1, REL, RELA, RORa, RORg, RORgt, STAT2, Tbox, TFEB, TOX, USF1, ZBTB2, ZKSCAN3, ZNF12, ZNF140, ZNF263, ZNF282, ZNF304, ZNF398, ZNF708, and ZNF75D.
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to NF AT, NFkB, REL, RELA, IRF2, GATA3 and ATF3.
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to NF AT.
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to NFkB.
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to REL.
  • an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to RELA. In some embodiments, an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to IRF2. In some embodiments, an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to GATA3. In some embodiments, an inducible promoter of the disclosure comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to ATF3.
  • an inducible promoter of the disclosure comprises a response element and/or an enhancer sequence.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to one or more of BACH2, BARX1, BATF, ELF1, ELF2, Elf4, Elkl, ERF, ETV1, Flil, FOXP1, GABPA, GAT A3, IRF1, IRF2, IRF5, IRF7, IRF9, MAF, MAFF, Maz, Mef2d, MLX, MYB, NF AT, NFATC3, NFkB, NR4A1, Nur77, PATZ1, REL, RELA, RORa, RORg, RORgt, STAT2, Tbox, TFEB, TOX, USF1, ZBTB2, ZKSCAN3, ZNF12, ZNF140, ZNF263, ZNF282, ZNF304, ZNF398, ZNF708, and ZNF75D.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from a coding or noncoding sequence of a gene related to one or more of NF AT, NFkB, REL, RELA, IRF2, GAT A3 and ATF3.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from NF AT.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from NFkB.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from REL.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from RELA.
  • the response element and/or an enhancer sequence comprises a sequence isolated or derived from IRF2. In some embodiments, the response element and/or an enhancer sequence comprises a sequence isolated or derived from GATA3. In some embodiments, the response element and/or an enhancer sequence comprises a sequence isolated or derived from ATF3.
  • an inducible promoter of the disclosure comprises two or more response elements and/or an enhancer sequences. In some embodiments, an inducible promoter of the disclosure comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 response elements and/or an enhancer sequences. In some embodiments, the repeated response elements and/or enhancer sequences are identical. In some embodiments, the repeated response elements and/or enhancer sequences are not identical.
  • an inducible promoter of the disclosure does not comprise the combination of: (1) a Nuclear factor of activated T-cells (NF AT) sequence, a Interferon Regulatory Factor 4 (IRF4) sequence, a activating protein 1 (AP-l)-IRF composite elements (AICE) sequence, or a Interferon Stimulation Response Element (ISRE) sequence; and (2) a human beta globin sequence.
  • NF AT Nuclear factor of activated T-cells
  • IRF4 Interferon Regulatory Factor 4
  • AICE activating protein 1
  • ISRE Interferon Stimulation Response Element
  • the AICE sequences may be derived from the untranslated region of IRF4, IRF8, and/or BATF.
  • an ISRE sequence comprises a consensus sequence of “YAGTTTC(A/T)YTTTYCC” in which " Y" is either C or T.
  • an inducible promoter of the disclosure does not comprise the combination of: (1) an NF AT sequence and (2) a YB -TATA sequence. In some embodiments, an inducible promoter of the disclosure does not comprise the sequence of
  • an inducible promoter of the disclosure comprises one or more transcription factor binding motif(s).
  • an inducible promoter of the disclosure comprises a concatemer of two or more repeated sequences, wherein the repeated sequences may comprise the one or more transcription factor binding motif(s).
  • the two or more repeated sequences are identical.
  • the two or more repeated sequences are not identical.
  • a concatemer comprises a linking sequence positioned between the repeated sequences.
  • the linking sequence may comprise one or more of: TACGCT, TGATCT, TGCTTT, and TGCCCGT.
  • an inducible promoter of the disclosure comprising a concatemer binds more than one unique transcription factor.
  • an inducible promoter of the disclosure comprising a concatemer binds the same transcription factor at more than one site.
  • an inducible promoter of the disclosure comprising one or more transcription factor binding motifs, optionally, organized as a concatemer comprises a sequence according to the consensus sequences provided in Table 16.
  • an inducible promoter of the disclosure comprising one or more transcription factor binding motifs, optionally, organized as a concatemer, comprises a sequence selected from any one or more of the sequences in Table 18.
  • an inducible promoter of the disclosure comprising a concatemer comprises a sequence according to any one or more of the sequences of Table 19.
  • an inducible promoter of the disclosure comprises a pairing of an enhancer sequence and a promoter sequence (an E-P Pairing).
  • an inducible promoter of the disclosure comprising one or more E-P Pairings comprises a sequence of Table 17.
  • designed cytokines of the disclosure are operably coupled to any of the nucleic acid constructs disclosed in U.S. Provisional Application Nos. 63/479,176, 63/479,177, and 63/479, 178, which are hereby incorporated by reference in their entireties.
  • the disclosure provides a non-naturally occurring Designed Cytokine (formerly referred to as aninterleukin-2/15 (IL-2/15) polypeptide) comprising alpha helices Hl, H2, H3, andH4, wherein, from an amino terminus to a carboxy terminus, a first loop (LI) connects Hl andH4; a second loop (L2) connects H4 andH2; a third loop (L3) connects H2 andH3.
  • the Designed Cytokine binds to the beta (P) and/or gamma (y) subunits of the IL- 2 receptor.
  • the Designed Cytokine binds to IL-2 receptor p/y heterodimer (IL-2Rp/y) as a heterodimeric receptor.
  • the Designed Cytokine comprises one or more of a sequence of SEQ ID NO: 1 -350.
  • the Designed Cytokine comprises one or more of a sequence of SEQ ID NO: 1 -38 or 150-350.
  • the Designed Cytokine comprises a sequence isolated or derived from an IL-2 polypeptide.
  • the IL-2 polypeptide is a wild type polypeptide.
  • the IL-2 polypeptide comprises the sequence of SEQ ID NO: 500 below.
  • a Designed Cytokine of the disclosure may be used combination with an IL-2 polypeptide, including an IL-2 polypeptide having the sequence of SEQ ID NO: 500 below.
  • Native human comprises the sequence of (SEQ ID NO: 500):
  • hIL-2 has four helices connected by long irregular loops.
  • TheN-terminal helix (Hl) interacts with both the beta and gamma subunits, the third helix (H3) interacts with the beta subunit, and the C-terminal helix (H4) with the gamma subunit;
  • the alpha subunit interacting surface is formed by the irregular second helix (H2) and two longloops, one connecting Hl to H2 and the other connecting H3 and H4.
  • the Designed Cytokine comprises a sequence isolated or derived from an IL- 15 polypeptide.
  • the IL-15 polypeptide is a wild type polypeptide.
  • the IL-15 polypeptide comprises the sequence of SEQ IDNO: 501 below.
  • a Designed Cytokine of the disclosure may be used combination with an IL-15 polypeptide, including an IL- 15 polypeptide having the sequenceof SEQ ID NO: 501 below.
  • Native human IL- 15 comprises the sequenceof (UniProtKB Accession No. P40933 and SEQ ID NO: 501 ; signal sequence; IL-15 chain; glycosylation site; disulfide bond).
  • hIL-15 has a similar structure to hIL-2, however hIL-15 has less than 20% sequence identity with hIL-2.
  • a Designed Cytokine of the disclosure may be used combination with an IL- 12 polypeptide, including an IL- 12 polypeptide, subunit A, having the sequence of MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQT LEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFM MALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETV PQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS.
  • a Designed Cytokine of the disclosure may be used combination with an IL- 12 polypeptide, including an IL- 12 polypeptide, subunit B, having the sequence of
  • a Designed Cytokine of the disclosure may be used combination with an IL- 18 polypeptide, including an IL- 18 polypeptide, having the sequence of
  • a Designed Cytokine of the disclosure may be used combination with an IL-21 polypeptide, including an IL-21 polypeptide, having the sequence of MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPE
  • a Designed Cytokine of the disclosure may be used combination with an IL-23 polypeptide, including an IL-23 polypeptide, subunit A, having the sequence of MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDL ARVFAHGAATLSP.
  • a Designed Cytokine of the disclosure may be used combination with an IL-23 polypeptide, including an IL-23 polypeptide, subunit B, having the sequence of
  • a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 1/13, polypeptide having the sequence of In some embodiments, a Designed Cytokine of the disclosure maybe used combination with an interferon alpha polypeptide, including an interferon alpha 2, polypeptide having the sequence of .
  • a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 4, polypeptide having the sequence of In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 5, polypeptide having the sequence of Q Q In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 6, polypeptide having the sequence of Q Q In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha?, polypeptide having the sequence of In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 8, polypeptide having the sequence of In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interfer
  • a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 14, polypeptide having the sequence of In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha 17, polypeptide having the sequence of . In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon alpha polypeptide, including an interferon alpha21, polypeptide having the sequence of
  • a Designed Cytokine of the disclosure may be used combination with an interferon beta polypeptide, including an interferon beta polypeptide havingthe sequence of
  • a Designed Cytokine of the disclosure may be used combination with an interferon gamma polypeptide, including an interferon gamma polypeptide having the sequence of [132] In some embodiments, a Designed Cytokine of the disclosure may be used combination with an interferon omega polypeptide, including an interferon omega polypeptide having the sequence of
  • Designed Cytokines of the disclosure include, but are not limited to, one or more of the polypeptides provided in any one of Tables 1 -15.
  • Designed Cytokines of the disclosure comprise a polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 99%, or any percentage identity in between with a Designed Cytokine of the disclosure.
  • Designed Cytokines of the disclosure comprise a polypeptide having a sequence of one or more of helix Hl, helix H4, helix H2, helix H3 , of the IL-2/15 polypeptides of the disclosure, optionally, when the order of the helices is Hl, H4, H2 and then H3 in the polypeptide from its amino terminus to its carboxy terminus.
  • IL-2/15 polypeptides of the disclosure comprise a polypeptide having a sequence of one or more of helix Hl, helix H4, helix H2, helix H3, of the Designed Cytokines of the disclosure, when the order of the helices is Hl , H4, H2 and then H3 in the polypeptide from its amino terminus to its carboxy terminus.
  • Designed Cytokines of the disclosure comprise a polypeptide having helix Hl , helix H4, helix H2, helix H3 of the Designed Cytokines of the disclosure, in this order from its amino terminus to its carboxy terminus.
  • Designed Cytokines of the disclosure comprise a polypeptide having helix Hl, helix H4, helix H2, helix H3 of the Designed Cytokines of the disclosure, in this order from its amino terminus to its carboxy terminus and, optionally, a loop connecting each helix having substantially the same topology and/or secondary structure as a loop within a Designed Cytokine of the disclosure.
  • Table 1
  • nucleic acid refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxy cytidine; “DNA molecules”), or any phosphoester analogs thereof, such as phosphorothioatesand thioesters, in either single stranded form, or a double-stranded helix.
  • Single stranded nucleic acid sequences refer to single-stranded DNA (ssDNA) or single -stranded RNA (ssRNA). Double stranded DNA-DNA-DNA
  • Nucleic acid refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms.
  • Nucleic acid includes double-stranded DNA found, inter alia, in linear or circular DNA molecules (e.g., restriction fragments), plasmids, supercoiled DNA and chromosomes.
  • sequences are provided according to the normal convention of writing the sequence left to right in the 5 ’ to 3 ’ direction along the non -transcribed strand of DNA (i.e., the strand having a sequence homologous to the messenger RNA or mRNA). Unless otherwise indicated, all nucleic acid and nucleotide sequences are written left to right in 5 ’ to 3 ’ orientation.
  • Nucleotides are referred to by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, ‘A’ represents adenine, ‘C’ represents cytosine, ‘G’ represents guanine, ‘T’ represents thymine, and ‘U’ represents uracil.
  • Polynucleotide refers to polymers of nucleotides of any length or type, including ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures thereof. This term refers to the primary structure of the molecule. Thus, the term includes triple-, double- and single-stranded deoxyribonucleic acid (“DNA”) and ribonucleic acid (“RNA”). It also includes modified, for example by alkylation and/or by capping, and unmodified forms of the polynucleotide.
  • polynucleotide includes poly deoxyribonucleotides (containing 2-deoxy-D-ribose) and polyribonucleotides (containing D -ribose), including mRNA, whether spliced or unspliced, any other type of polynucleotide which is an N- or C-gly coside of a purine or pyrimidine base, and other polymers containing nucleotide backbones, for example, polyamide (e.g., peptide nucleic acids “PNAs”) and polymorpholino polymers, and other synthetic sequence -specific nucleic acid polymers providing that the polymers contain nucleobasesin a configuration which allows for base pairing and base stacking, such as is found in DNA and RNA.
  • PNAs peptide nucleic acids
  • a polynucleotide comprises a DNA sequence. In some embodiments of the disclosure, a polynucleotide comprises a DNA sequence inserted in a vector or a vector comprising a DNA sequence.
  • a polynucleotide comprises an mRNA.
  • the mRNA is a synthetic mRNA or the mRNA comprises a synthetic nucleotide.
  • a polynucleotide comprises at least one unnatural, non -naturally occurring or modified nucleic acid.
  • the polynucleotide comprises a plurality of unnatural, non-naturally occurring or modified nucleic acids.
  • all nucleic acids of a certain class are unnatural, non-naturally occurring or modified nucleic acids (e.g., all uridines in a polynucleotide can be replaced with an unnatural nucleobase, e.g., 5-methoxy uridine).
  • expression refers to the transcription and/or translation of a particular nucleotide sequence driven by a promoter.
  • expression vector refers to a plasmid, virus, or other nucleic acid designed for polypeptide expression in a cell.
  • the vector or construct is used to introduce a gene into a host cell whereby the vector will interact with polymerases in the cell to express the protein encoded in the vector/construct.
  • the expression vector may exist in the cell extrachromosomally or may be integrated into the chromosome.
  • Expression vectors may include additional sequences which render the vector suitable for replication and integration in prokaryotes, eukaryotes, or preferably both (e.g., shuttle vectors).
  • the polynucleotides of the disclosure may be provided as components of expression vectors.
  • cloning vector refers to a plasmid, virus, or other nucleic acid designed for producing copies of a polynucleotide.
  • Cloning vectors may contain transcription and translation initiation sequences, transcription and translation termination sequences and a polyadenylation signal. Such constructs will typically include a 5' LTR, a tRNA binding site, a packaging signal, an origin of second -strand DNA synthesis, and a 3 ' LTR or a portion thereof.
  • the polynucleotides of the disclosure may be provided as components of cloning vectors, which may be used to produce the polynucleotides of the disclosure.
  • “encoding” or the like refers to the capacity of specific sequences of nucleotides in a polynucleotide (e.g. a gene, cDNA, or mRNA) to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids.
  • a gene, cDNA, or RNA encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
  • Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
  • nucleotide sequence “encoding an amino acid sequence,” e.g., a polynucleotide “encoding” a chimeric polypeptide, definedbelow of the present disclosure, includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence.
  • Amino acids are referred to by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
  • the amino acid residues are abbreviated as follows, where the abbreviations are shown in parentheses: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gin; Q), glycine (Gly; G), histidine (His; H), isoleucine (He; I), leucine (Leu; L), lysine (Ly s; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr;
  • Polypeptide may refer to a sequence of amino acid subunits.
  • a “peptide” can be less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acidslong.
  • Polypeptide refers to proteins, polypeptides, and peptides of any length, size, structure, or function.
  • Polypeptide,” “peptide,” and “protein” are used interchangeably to refer to polymers of amino acids of any length.
  • Polypeptides of the disclosure may comprise naturally or synthetically created or modified amino acids, for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides in which one or more amino acid residues are artificial chemical analogs of a corresponding naturally occurring amino acid (including, for example, synthetic amino acids such as homocysteine, ornithine, p-acetylphenylalanine, D-amino acids, and creatine), as well as other modifications known in the art.
  • synthetic amino acids such as homocysteine, ornithine, p-acetylphenylalanine, D-amino acids, and creatine
  • Polypeptides also include gene products, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing.
  • a polypeptide may comprise a single polypeptide or can be a multi -molecular complex such as a dimer, trimer or tetramer.
  • Polypeptides of the disclosure may comprise single-chain or multi-chain polypeptides. Most commonly disulfide linkages are found in multi-chain polypeptides.
  • polypeptides of the disclosure may comprise L-amino acids + glycine, D-amino acids + glycine (which are resistant to L-amino acid-specific proteases in vivo), or a combination of D- and L-amino acids + glycine.
  • Polypeptides described maybe chemically synthesized or recombinantly expressed.
  • polypeptides of the disclosure can include additional residues at the N -terminus, C- terminus, internal to the polypeptide, or a combination thereof; these additional residues are not included in determining the percent identity of the polypeptides of the disclosure relative to the reference polypeptide.
  • Such residues may be any residues suitable for an intended use, including but not limited to tags.
  • chimeric polypeptide may refer to any polypeptide comprised of a first amino acid sequence derived from a first source, bonded, covalently or noncovalently, to a second amino acid sequence derived from a second source, wherein the first and second source are not the same.
  • a first source and a second source that are not the same can include two different biological entities, or two different proteins from the same biological entity, or a biological entity and a non -biological entity.
  • a chimeric protein can include for example, a protein derived from at least 2 different biological sources.
  • the chimeric polypeptide may include sequences from similar proteins derived from two distinct species.
  • the chimeric polypeptide may include sequences from dissimilar proteins derived from the same species.
  • a biological source can include any non-synthetically produced nucleic acid or amino acid sequence (e.g. a genomic or cDNA sequence, a plasmid or viral vector, a native virion or a mutant or analog of any of the above).
  • a synthetic source can include a protein or nucleic acid sequence produced chemically and not by a biological system (e.g. solid phase synthesis of amino acid sequences).
  • a chimeric protein can also include a protein derived from at least 2 different synthetic sources or a protein derived from at least one biological source and at least one synthetic source.
  • a chimeric protein may also comprise a first amino acid sequence derived from a first source, covalently or noncovalently linked to a nucleic acid, derived from any source or a small organic or inorganic molecule derived from any source.
  • the chimeric protein can comprise a linker molecule between the first and second amino acid sequence or between the first amino acid sequence and the nucleic acid, or between the first amino acid sequence and the small organic or inorganic molecule.
  • a “fragment” of a polypeptide, or a “truncated polypeptide” may refers to an amino acid sequence of a polypeptide that is shorter than the sequence of a reference polypeptide (which may be a naturally -occurring sequence).
  • the fragment may comprise an N- and/or C-terminal deletion.
  • the fragment may comprise a deletion of any part of the sequence, whether or not the deletion is contiguous.
  • a polypeptide in which internal amino acids have been deleted with respect to the naturally occurring sequence is also considered a fragment.
  • the various polypeptide components of the disclosure may be provided as fragments or truncated versions of a reference protein.
  • a “functional fragment” may refer to a polypeptide fragment that retains a function of the polypeptide.
  • a functional fragment of a bioactive peptide e.g., an enzyme
  • Polypeptides of the disclosure may be provided as functional fragments or truncated versions.
  • amino acid substitution may refer to replacing an amino acid residue present in a parent or reference sequence with another amino acid residue.
  • the parent or reference sequence comprises a wildtype sequence.
  • An amino acid can be substituted, for example, via chemical peptide synthesis or through recombinant methods known in the art. For example, substituting an amino acid residue with an alternative amino acid residue is conducted by substituting the codon encoding the first amino acid with a codon encoding the second amino acid.
  • Polypeptides of the disclosure may be provided with one or more amino acid substitutions.
  • a “conservative amino acid substitution” is one in which one amino acid residue is replaced with an amino acid residue having a chemically similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including acidic side chains (e.g., aspartic acid, glutamic acid), basic side chains (e.g., lysine, arginine, histidine), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan,
  • acidic side chains e
  • a string of amino acids can be conservatively replaced with a chemically similar string that differs in order and/or composition of side chain family members.
  • the various polypeptide components of the disclosure may be provided with conservative amino acid substitutions.
  • non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, He, Phe or Vai), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Vai, His, He or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala or Ser) or no side chain (e.g., Gly).
  • an electropositive side chain e.g., Arg, His or Lys
  • an electronegative residue e.g., Glu or As
  • the various polypeptide components of the disclosure may be provided with non-conservative amino acid substitutions.
  • the likelihood that one of the foregoing non-conservative substitutions can alter functional properties of the protein is also correlated to the position of the substitution with respect to functionally important regions of the protein: some non-conservative substitutions can accordingly have little or no effect on biological properties.
  • the various polypeptide components of the disclosure may be provided with non -conservative amino acid substitutions that do not significantly alter the functionality of the altered components.
  • identity refers to the overall monomer conservation between polymeric molecules, e.g., between polypeptide molecules or polynucleotide molecules. “Identical” without any additional qualifiers, e.g., protein A is identical to protein B, implies the sequences are 100% identical (100% sequence identity). Describingtwo sequences as, e.g., “70% identical,” is equivalent to describing them as having, e.g., “70% sequence identity.”
  • Calculation of the percent identity of two polypeptide sequences can be performed by aligning the two sequences for optimal comparison purposes. For example, gaps can be introduced in one or both of a first and a second polypeptide sequences for optimal alignment and non -identical sequences can be disregarded for comparison purposes.
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The amino acids at corresponding amino acid positions are then compared.
  • sequence alignments are not limited to binary sequence-sequence comparisons exclusively driven by primary sequence data. It will also be appreciated that sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data.
  • a suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available atwww.tcoffee.org, and alternatively available, e.g., from the European Bioinformatics Institute (EBI) at website ebi.ac.uk/Tools/psa. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
  • Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences.
  • One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of programs available from the U.S. government’s National Center for Biotechnology Information BLAST website (blast.ncbi.nlm.nih.gov).
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the EBI.
  • Sequence alignments can be conducted using methods known in the art such as MAFFT, Clustal (ClustalW, Clustal X or Clustal Omega), MUSCLE, etc.
  • Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity.
  • the percent sequence identity value is rounded to the nearest tenth. For example, values from 80.11 to 80.14 are rounded down to 80.1, while values from 80.15 to 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
  • non-naturally occurring means a polypeptide or a polynucleotide sequence that does not exist in nature.
  • the non- naturally occurring sequence does not exist in nature because the sequence is altered relative to a naturally occurring sequence.
  • the non-naturally occurring sequence does not exist in nature because it is a combination of two known, naturally -occurring, sequences (e.g., chimeric polypeptide) that do not occur together in nature.
  • a non- naturally occurring polypeptide is a chimeric polypeptide.
  • a polypeptide or a polynucleotide is notnaturally occurring because the sequence contains a portion (e.g., a fragment) that cannotbe found in nature, i.e., a novel sequence.
  • Any of the polynucleotides described herein may be provided as non-naturally occurring sequences, e.g., having sequences which are altered relative to native sequences or provided as polynucleotides which are linked to other polynucleotides in a manner that does not exist in nature.
  • polypeptides described herein may be provided as non-naturally occurring sequences, e.g., having sequences which are altered relative to native sequences or provided as polypeptides which are linked to other polypeptides in a manner that does not exist in nature.
  • the term “therapeutically effective” may refer to imparting a beneficial effect on the recipient, e.g., providing some alleviation, mitigation, or decrease in at least one clinical symptom in the subject.
  • Therapeutic effects of the disclosure need notbe complete or curative, as longas some benefitis providedto the subject.
  • a therapeutic regimen that incorporates the polynucleotides, gene therapy vectors or cells of the disclosure with the small molecules of the disclosure may be structured such that the regimen is therapeutically effective as a whole.
  • the term “therapeutically effective amount” refers to a dose or an amount of a nucleic acid, vector, polypeptide, composition, pharmaceutical composition or cell of the disclosure sufficient to impart a therapeutically effective benefit on the recipient.
  • polynucleotides, gene therapy vectors or cells of the disclosure may be administered in a therapeutically effective amount.
  • a subject who has been administered polynucleotides, gene therapy vectors or cells of the disclosure may subsequently be administered a therapeutically effective amount of a small molecule of the disclosure, i.e., an amount sufficient to impart a beneficial effect on the recipient given the previous administration of polynucleotides, gene therapy vectors or cells.
  • stem cell may refer to an undifferentiated or partially differentiated cell that can differentiate into various types of cells and proliferate indefinitely to produce more of the same stem cell.
  • PSC Pluripotent stem cell
  • PSC may refer to a cell that can maintain an undifferentiated state indefinitely and can differentiate into most, if not all cells of the body.
  • the term “Induced pluripotent stem cell” may refer to a pluripotent stem cell that can be generated directly from a somatic cell.
  • multipotent may refer to a cell that can develop into more than one cell type but is more limited than a pluripotent cell.
  • adult stem cells and cord blood stem cells may be considered as multipotent.
  • the term “hematopoietic cell” may refer to a cell that arises from a hematopoietic stem cell (HSC).
  • HSC hematopoietic stem cell
  • Hematopoietic cells of the disclosure include, but is not limited to, myeloid progenitor cells, lymphoid progenitor cells, megakaryocytes, erythrocytes, mast cells, myeloblasts, basophils, neutrophils, eosinophils, macrophages, thrombocytes, monocytes, natural killer cells, T lymphocytes, B lymphocytes and plasma cells.
  • T-lymphocyte or “T-cell” may refer to a hematopoietic cell that normally develops in the thymus.
  • T-lymphocytes or T-cells include, but are not limited to, natural killer T cells, regulatory T cells, helper T cells, cytotoxic T cells, memory T cells, gamma delta T cells, and mucosal invariant T cells.
  • the term “mesenchyme” may refer to a type of animal tissue comprising loose cells embedded in a mesh of proteins and fluid, i.e., the extracellular matrix. Mesenchyme directly gives rise to most of the body’s connective tissues including bones, cartilage, lymphatic system, and circulatory system.
  • the term “mesenchymal cell” may refer to a cell that is derived from a mesenchymal tissue. In some embodiments, cells of the disclosure may be mesenchymal cells. [175] In some embodiments of the disclosure, the term “mesenchymal stromal cell” (MSC) may refer to a spindle shaped plastic-adherent cell isolated from bone marrow, adipose, and other tissue sources, with multipotent differentiation capacity in vitro.
  • MSC mesenchymal stromal cell
  • a mesenchymal stromal cell can differentiate into osteoblasts (bone cells), chondrocytes (cartilage cells), myocytes (muscle cells), and adipocytes (fat cells which give rise to marrow adipose tissue).
  • the term mesenchymal stromal cell is suggested in the scientific literature to replace the term “mesenchymal stem cell”.
  • cells of the disclosure maybe mesenchymal stromal cells.
  • an “autologous cell” is a cell obtained from the same individual to whom it may be administered as a therapy (the cell is autologous to the subject).
  • Autologous cells of the disclosure include, but are not limited to, hematopoietic cells and stem cells, such as hematopoietic stem cells.
  • an allogeneic cell is a cell obtained from an individual who is not the intended recipient of the cell as a therapy (the cell is allogeneic to the subject).
  • Allogeneic cells of the disclosure maybe selected from immunologically compatible donors with respect to the subject of the methods of the disclosure.
  • Allogeneic cells of the disclosure may be modified to produce “universal” allogeneic cells, suitable for administration to any subject without unintended immunogenicity.
  • Allogeneic cells of the disclosure include, but are not limited to, hematopoietic cells and stem cells, such as hematopoietic stem cells.
  • the term “Transfect” or “transform” or “transduce” may refer to a process by which exogenous nucleic acid is transferred or introduced into a host cell.
  • a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid or progeny of the cell.
  • Cell therapy may refer to the provision or delivery of cells into a recipient for therapeutic purposes.
  • “pharmaceutically acceptable” refers to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication commensurate with a reasonable benefit/risk ratio.
  • the small molecules, polynucleotides, polypeptides, gene therapy vectors or cells of the disclosure may be administered as part of a composition together with other pharmaceutically acceptable components, including pharmaceutically acceptable carriers.
  • the term “pharmaceutically acceptable salts” refers to derivatives of the small molecules of the disclosure wherein the specified compoundis converted to an acid or base salt thereof.
  • Such pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
  • the pharmaceutically acceptable salts include the conventional non-toxic salts or the quaternary ammonium salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
  • such conventional non-toxic salts include those derived from inorganic acids such as hydrochloric, hydrobromic, sulfuric, sulfamic, phosphoric, nitric and the like; and the salts prepared from organic acids such as acetic, propionic, succinic, glycolic, stearic, lactic, malic, tartaric, citric, ascorbic, pamoic, maleic, hydroxymaleic, phenylacetic, glutamic, benzoic, salicylic, sulfanilic, 2- acetoxybenzoic, fumaric, to luensulfonic, methanesulfonic, ethanedisulfonic, oxalic, isethionic, and the like.
  • the small molecules of the disclosure may be provided as pharmaceutically acceptable salts.
  • excipients refer to pharmacologically inert ingredients that are not active in the body. See, for example, Hancock, B. C., Moss, G. P., & Goldfarb, D. J. (2020). Handbook of pharmaceutical excipients. London: Pharmaceutical Press, the entire disclosure of which is incorporated herein by reference.
  • the small molecules of the disclosure may be mixed with pharmaceutically acceptable carriers, diluents, adjuvants, excipients, or vehicles, such as preserving agents, fillers, polymers, disintegrating agents, glidants, wetting agents, emulsifying agents, suspending agents, sweetening agents, flavoring agents, perfuming agents, lubricating agents, acidifying agents, and dispensing agents, depending on the nature of the mode of administration and dosage forms.
  • Pharmaceutically acceptable carriers include water, ethanol, polyols, vegetable oils, fats, waxes polymers, including gel forming and non-gel forming polymers, and suitable mixtures thereof.
  • excipients examples include starch, pregelatinized starch, Avicel, lactose, milk sugar, sodium citrate, calcium carbonate, dicalcium phosphate, and lake blend.
  • disintegrating agents include starch, alginic acids, and certain complex silicates.
  • lubricants include magnesium stearate, sodium lauryl sulfate, talc, as well as high molecular weight polyethylene glycols.
  • the small molecules, polynucleotides, gene therapy vectors or cells of the disclosure may be provided and administered in compositions that include pharmaceutically acceptable excipients.
  • the identified consensus motifs of Table 16 comprise some variability within the identified sequence.
  • the identified consensus motifs of Table 16 may allow for one or more nucleotide substitutions within the identified consensus motifs.
  • N may allow for any nucleotide to be substituted at that position including A, G, C, T;
  • S may allow for either G or C to be substituted at that position;
  • R may allow for either A or Gto be substituted at that position;
  • W may allow for A or T to be substituted at that position.
  • Table 18 below lists specific motifs that were identified that reduce the variability of the consensus motifs.
  • Table 18 lists exemplary specific motifs that exist within the identified consensus motifs of Table 16.
  • the transcription initiator and the regulators of the disclosure may comprise any one or more of the specific exemplary motifs of Table 16.
  • the term “subject” refers to any mammal, including without limitation, humans.
  • Singular or plural words also include the plural and singular number, respectively.
  • the disclosure includes polynucleotides with a single gene of interest or multiple genes of interest.
  • dilution buffer contains casein block and PBS-T (1 :1). Added 2 mg/mL CD25-Fc in Casein Block + PBS-T (1 :1) and diluted 100 mL of 100 mg/mL CD25-Fc in 5 milliliters (mL) of dilution buffer. Added 0.5 mg/mL CD25-Fc in Casein Block + PBS-T (1 :1) and then diluted 25 mL of 100 mg/mL CD25-Fc in 5 mL of dilution buffer. Mixed scIL12-anti-PDLl-scFv-STII + IL12Rb2-Fc at the specified concentration in casein block + PBS-T (1 :1). Incubated for 1 hr at room temperature.
  • IL2 formulation as at 500 mg/mL. Diluted 1 :50 in Expi293 media then 5 fold dilution series (transfered 20 mL into 80 mL Expi293). After diluting 20 mL of this to a final volume of 200 mL for the assay the concentration range is: 1000 ng/mL > 200 ng/mL > 40 ng/mL > 8 ng/mL > 1.6 ng/mL > 0.32 ng/mL > 0.06 ng/mL > 0.012 ng/mL. [216] Incubated plates with dilution series of Designed Cytokines or WT IL-2 overnight at
  • Octet setup ProA tips, Octet Buffer (HBS-EP + 0.25% BSA), use 2.6 mg/mL IL2Ra-Fc for capture; use zeba columns (0.5 mL, 7 kDa) to buffer-exchange proteinsinto HBS-EP (No BSA).
  • Octet Bindins to IL2Rb/g (beta/gamma)
  • Octet setup info ProA tips, OctetBuffer (HBS-EP + 0.25% BSA), use 12 ug/mL
  • IL2Rb/g-Fc for capture, Use zeba columns (0.5 mL, 7 kDa) to buffer-exchange proteins into HBS-EP (No BSA).
  • Designed Cytokines were engineered to not bind to CD25 (IL2Ra), but to activate IL2R through IL2Rb and common gamma chain receptors. This study demonstrates the ability of Designed Cytokines to express in transiently transfected Expi293 cells, to bind to CD25 (IL2Ra) by ELISA, and to activate HEK-Blue reporter lines that express [IL2Ra, IL2Rb, and the gamma subunit common to IL-2 and IL-15] OR [IL2Rb and the gamma subunit common to IL-2 and IL- 15].
  • Designed Cytokines were identified that 1) express in Expi293 cells, 2) activate IL2R and CD122/132 only in HEK-Blue assays even at relatively high dilutions of the transfection supernatant, and 3) no longer bind to CD25 (despite relatively good expression). These designs were marked for further development. Among these, Designed Cytokine No. 39 and Designed Cytokine No. 40 appear to be of particular interest because these were among the highest expressing proteins by anti-STII jess. Designed Cytokine No. 39 and Designed Cytokine No. 40 showed good activation in HEK-Blue assays and they did not bind to CD25. These proteins are also closely related, so the factthattheir behavior is similar confirms the structure-function relationship.
  • IL2Ra binding No detectable binding of the Designed Cytokines to IL2Ra was observed, even up to 3 uM. WT IL2, in contrast, binds to IL2Ra and has aKd of ⁇ 15 nM. This experiment therefore confirms that our WT IL2 binds to IL2Ra as expected, while the Designed Cytokines show no binding.
  • IL2Rb/g binding The Designed Cytokines bind to IL2Rb/g with nanomolar affinity, similar to WT IL2 binding. Designed Cytokine No. 169 has a Kd of ⁇ 1.6nM, while WT IL2 has a Kd of ⁇ 0.4 nM. Designed Cytokine No. 153 has a lower affinity, at 3.9 nM, which is consistent with its lower activity in functional assays.
  • the Designed Cytokines demonstrate lower intrinsic fluorescence, and therefore, greater stability upon contact with a denaturant, when compared to the intrinsic fluorescence of WT IL-12.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
PCT/US2023/060508 2022-01-11 2023-01-11 Designed cytokine compositions and methods of use Ceased WO2023137346A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020247026696A KR20240164594A (ko) 2022-01-11 2023-01-11 설계된 사이토카인 조성물 및 사용 방법
CN202380027065.2A CN119053616A (zh) 2022-01-11 2023-01-11 设计的细胞因子组合物及使用方法
IL314226A IL314226A (en) 2022-01-11 2023-01-11 Designed cytokine compositions and methods of use
EP23740805.9A EP4463469A4 (en) 2022-01-11 2023-01-11 CYTOKINE COMPOSITIONS DESIGNED AND METHODS OF USE
US18/727,646 US20250223330A1 (en) 2022-01-11 2023-01-11 Designed cytokine compositions and methods of use
MX2024008642A MX2024008642A (es) 2022-01-11 2023-01-11 Composiciones de citocinas dise?adas y metodos de uso.
AU2023208031A AU2023208031A1 (en) 2022-01-11 2023-01-11 Designed cytokine compositions and methods of use
JP2024541803A JP2025502205A (ja) 2022-01-11 2023-01-11 設計されたサイトカイン組成物および使用方法
CA3248134A CA3248134A1 (en) 2022-01-11 2023-01-11 CYTOKINE COMPOSITIONS DESIGNED AND METHODS OF USE
TW112101435A TW202434618A (zh) 2023-01-09 2023-01-12 經設計之細胞激素組合物及使用方法

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US202263298623P 2022-01-11 2022-01-11
US63/298,623 2022-01-11
US202363479178P 2023-01-09 2023-01-09
US202363479177P 2023-01-09 2023-01-09
US202363479176P 2023-01-09 2023-01-09
US63/479,177 2023-01-09
US63/479,176 2023-01-09
US63/479,178 2023-01-09

Publications (2)

Publication Number Publication Date
WO2023137346A2 true WO2023137346A2 (en) 2023-07-20
WO2023137346A3 WO2023137346A3 (en) 2023-11-16

Family

ID=87279672

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2023/060508 Ceased WO2023137346A2 (en) 2022-01-11 2023-01-11 Designed cytokine compositions and methods of use

Country Status (10)

Country Link
US (1) US20250223330A1 (https=)
EP (1) EP4463469A4 (https=)
JP (1) JP2025502205A (https=)
KR (1) KR20240164594A (https=)
CN (1) CN119053616A (https=)
AU (1) AU2023208031A1 (https=)
CA (1) CA3248134A1 (https=)
IL (1) IL314226A (https=)
MX (1) MX2024008642A (https=)
WO (1) WO2023137346A2 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025015322A1 (en) * 2023-07-13 2025-01-16 Outpace Bio, Inc. Designed interleukin-2 cytokine compositions and methods for use
WO2025212606A1 (en) * 2024-04-01 2025-10-09 Bio-Techne Corporation Synthetic il-2 polypeptides and conjugates, compositions, and uses thereof

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20210025522A (ko) * 2018-06-25 2021-03-09 유니버시티 오브 워싱톤 강력하고 선택적인 인터루킨 모방체의 드 노보 디자인
MX2021000801A (es) * 2018-07-24 2021-04-12 BioNTech SE Agonistas de il2.
CN118510795A (zh) * 2022-01-07 2024-08-16 苏州克睿基因生物科技有限公司 新型白介素-2多肽

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025015322A1 (en) * 2023-07-13 2025-01-16 Outpace Bio, Inc. Designed interleukin-2 cytokine compositions and methods for use
WO2025212606A1 (en) * 2024-04-01 2025-10-09 Bio-Techne Corporation Synthetic il-2 polypeptides and conjugates, compositions, and uses thereof

Also Published As

Publication number Publication date
US20250223330A1 (en) 2025-07-10
KR20240164594A (ko) 2024-11-19
IL314226A (en) 2024-09-01
CA3248134A1 (en) 2023-07-20
MX2024008642A (es) 2024-09-23
EP4463469A2 (en) 2024-11-20
AU2023208031A1 (en) 2024-08-29
EP4463469A4 (en) 2026-01-14
JP2025502205A (ja) 2025-01-24
CN119053616A (zh) 2024-11-29
WO2023137346A3 (en) 2023-11-16

Similar Documents

Publication Publication Date Title
US11400133B2 (en) Receptor-based antagonists of the programmed cell death 1 (PD-1) pathway
JP6783797B2 (ja) 抗がん融合ポリペプチド
KR102653906B1 (ko) 편향된 il2 뮤테인 방법 및 조성물
KR20220016945A (ko) 다중특이적 단백질
CN111511911A (zh) 表达特异性地识别人间皮素的细胞表面分子、il-7和ccl19的免疫活性细胞
CA3150226A1 (en) Chimeric orthogonal receptor proteins and methods of use
WO2022169913A2 (en) Synthetic degrader system for targeted protein degradation
WO2023137346A2 (en) Designed cytokine compositions and methods of use
US20230027899A1 (en) Cd122 with altered icd stat signaling
US20230374454A1 (en) Human immune cells genomically modified to express orthogonal receptors
WO2023081718A1 (en) Multimeric t-cell modulatory polypeptides and methods of use thereof
JP2026041861A (ja) Il2オルソログおよび使用法
KR20250024838A (ko) Kras g12v 돌연변이 폴리펩티드를 표적화하는 t 세포 수용체 및 이의 용도
KR20220143939A (ko) G12v 돌연변이를 갖는 ras에 대한 hla 클래스 ii-제한된 t 세포 수용체
AU2024288570A1 (en) Designed interleukin-2 cytokine compositions and methods for use
WO2025059385A2 (en) Anti-mesothelin chimeric antigen receptors and methods of use
KR20240004453A (ko) 변형된 과립구 집락-자극 인자(g-csf) 및 이에 결합하는 키메라 사이토카인 수용체
EP3749349A1 (en) Mutant idh1 specific t cell receptor
TW202434618A (zh) 經設計之細胞激素組合物及使用方法
WO2025207624A1 (en) Compositions and methods useful in the treatment of autoimmune disease
WO2023150649A2 (en) Synthetic degrader system for targeted protein degradation
JP2024529340A (ja) 新生物疾患の細胞療法に使用するための方法および組成物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23740805

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: MX/A/2024/008642

Country of ref document: MX

Ref document number: 314226

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2024541803

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: AU23208031

Country of ref document: AU

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2023208031

Country of ref document: AU

Date of ref document: 20230111

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2023740805

Country of ref document: EP

Effective date: 20240812

WWE Wipo information: entry into national phase

Ref document number: 202380027065.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 23740805

Country of ref document: EP

Kind code of ref document: A2

WWP Wipo information: published in national office

Ref document number: 18727646

Country of ref document: US