WO2023110044A1 - Formulations comprising a sada complex - Google Patents

Formulations comprising a sada complex Download PDF

Info

Publication number
WO2023110044A1
WO2023110044A1 PCT/DK2022/050279 DK2022050279W WO2023110044A1 WO 2023110044 A1 WO2023110044 A1 WO 2023110044A1 DK 2022050279 W DK2022050279 W DK 2022050279W WO 2023110044 A1 WO2023110044 A1 WO 2023110044A1
Authority
WO
WIPO (PCT)
Prior art keywords
composition according
seq
sada
sequence
binding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/DK2022/050279
Other languages
English (en)
French (fr)
Inventor
Torben LUND-HANSEN
Nico LIEBENBERG
Matias Munck MORTENSEN
Steen Lisby
Li PING
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Y-mAbs Therapeutics Inc
Original Assignee
Y-mAbs Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Y-mAbs Therapeutics Inc filed Critical Y-mAbs Therapeutics Inc
Priority to EP22826808.2A priority Critical patent/EP4448006A1/en
Priority to JP2024534718A priority patent/JP2024546804A/ja
Priority to CA3238361A priority patent/CA3238361A1/en
Priority to CN202280080939.6A priority patent/CN118382458A/zh
Priority to KR1020247023387A priority patent/KR20240124960A/ko
Priority to AU2022412918A priority patent/AU2022412918A1/en
Priority to US18/717,256 priority patent/US20250041410A1/en
Publication of WO2023110044A1 publication Critical patent/WO2023110044A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39591Stabilisation, fragmentation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/08Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
    • A61K47/12Carboxylic acids; Salts or anhydrides thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/20Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing sulfur, e.g. dimethyl sulfoxide [DMSO], docusate, sodium lauryl sulfate or aminosulfonic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/0474Organic compounds complexes or complex-forming compounds, i.e. wherein a radioactive metal (e.g. 111In3+) is complexed or chelated by, e.g. a N2S2, N3S, NS3, N4 chelating group
    • A61K51/0482Organic compounds complexes or complex-forming compounds, i.e. wherein a radioactive metal (e.g. 111In3+) is complexed or chelated by, e.g. a N2S2, N3S, NS3, N4 chelating group chelates from cyclic ligands, e.g. DOTA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/0495Pretargeting
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1045Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody against animal or human tumor cells or tumor cell determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1093Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody conjugates with carriers being antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/08Solutions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4746Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used p53
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3084Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated gangliosides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2123/00Preparations for testing in vivo
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/70Fusion polypeptide containing domain for protein-protein interaction
    • C07K2319/735Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)

Definitions

  • Formulations comprising a SADA complex
  • the present invention relates to compositions comprising a SADA complex, wherein said SADA complex remain stabilized on tetramer-form.
  • the composition is a pharmaceutical composition.
  • the invention further relates to the treatment of cancer using the composition of the invention.
  • Protein drugs are typically formulated as an aqueous formulation comprising ingredients that stabilizes the proteins in order to secure a satisfactory shelf-life.
  • SADA self-assembling and disassembling
  • SADA-complexes may be designed so that the tetrameric form has a molecular weight well above the renal clearance limit and the monomeric form has a molecular weight below the renal clearance limit, meaning that the tetrameric form will have a high plasma-half-life and the monomeric form has a low plasma half-life.
  • SADA-complexes are mainly administered in tetrameric form it provides a challenge to the formulation thereof, because the formulation should not only provide for a satisfactory stability of the protein, it should also secure that the SADA-complex remains on tetrameric form without excessive disassembly to monomers or agglomeration to multimers. Summary of the invention
  • compositions comprising SADA domains as a part of a SADA- complex permitting effective delivery of a payload to a target site of interest, while minimizing risk of off-target interactions.
  • SADA-complex in tetramer-form is highly stable in the composition/solution.
  • ensuring the stability of said compositions is a challenge. The challenge is to ensure that the composition comprises SADA-complexes predominantly in the higher-order tetramerized state, that said SADA-complexes remains on the tetramer-form and at the same time avoid multimerization, aggregation and precipitation thereof as well as product loss.
  • the SADA complex is administered on tetrameric form, because the tetrameric form having a size well above the renal clearance limit will remain in the blood circulation for a sufficient time to allow binding to the site of interest, whereas the monomeric form will be rapidly lost from the circulation because its size is below the renal clearance.
  • this provides the particular desirable properties of SADA-complexes, that when administered on tetrameric form remains sufficiently long in circulation to bind to the site of interest, and complexes that do not bind a target will gradually disintegrate into monomers that will be lost via the kidneys.
  • the present disclosure provides a composition ensuring the needed stability of the SADA-complex.
  • the invention in a first aspect relates to an aqueous composition
  • a. A SADA-complex comprising a SADA domain and at least one additional domain in an amount of 5-50 g/L
  • b. A buffer-system comprising a. A buffer-system; c. One or more stabilizing agents; and d.
  • One or more surfactants wherein the pH is in the range of 5-6, and the SADA-complex is predominantly on the tetrameric form, and the ionic strength is in the range of 5-150 mM.
  • the formulation is capable of stabilizing the SADA- complexes upon storage and further to maintain the SADA complex predominantly on tetrameric form.
  • the SADA-complex preferably comprises a SADA-domain and two binding sites, one capable of binding a tumor antigen, the other binding site capable of binding a chelator complexing a metal ion.
  • the chelator may be DOTA or a compound comprising a DOTA ring system.
  • the invention relates to the use of a composition according to the invention for treating or diagnosing cancer.
  • the invention relates to the use of a composition according to the invention in a method comprising the steps of: a. Administering a composition according to the invention to a patient in need of the treatment or diagnosing; and b. After a period administering a DOTA-compound binding a radionuclide.
  • the invention in a third aspect relates to a kit comprising the composition of the invention and preferably, instructions for use and/or DOTA binding a radionuclide.
  • the present invention relates to Self Assembly and Dis-Assembly (SADA) technology that has been described in the international patent application with publication number WO 2018204873A1, incorporated herein by reference.
  • SADA Self Assembly and Dis-Assembly
  • the technology is based on SADA- domains, small polypeptides that have the property of self assembly and disassembly depending on concentration.
  • SADA polypeptide is a polypeptide that comprises a tetramerization domain of p53, p63, p76, hnRNPC, SNAP-23, Stefin B, KCNQ4, CBFA2T1 and any other examples of such polypeptides provided in said international patent application, without limitation.
  • a SADA-complex is intended to mean a polypeptide comprising a SADA domain and at least one additional domain.
  • SADA-complexes will self-assemble and form multimers, in particular tetramers, at high concentration and disassemble into monomers at low concentration. This has the consequence that a SADA-complex on tetrameric form will, when administered to a patient, be diluted in plasma and gradually disassemble into monomers. If a SADA complex is designed so the multimeric form has a size above the renal clearance limit and the monomer has a size below the renal clearance limit, the multimer will have a long plasma half life whereas the monomer has a low plasma half life.
  • SADA-complexes comprising a binding site, binding to a tissue antigen, SADA-complex will rapidly bind to the antigen target and be localized at the target tissue, whereas unbound SADA complex will rapidly disassemble and be cleared from the plasma by renal clearance.
  • the invention concerns an aqueous composition
  • a. A SADA-complex comprising a SADA domain and at least one additional domain, in an amount of 5-50 g/L; b. A buffer-system; c. One or more stabilizing agents; and d. One or more surfactants; wherein the pH is in the range of 5-6, and the ionic strength is in the range of 5-150 mM.
  • the SADA complex is predominantly of multimeric/tetrameric form.
  • the formulation of the invention has the advantage of ensuring the stability of the composition.
  • the inventors have realized that the formulation of the invention secures a high stability of the SADA complexes and is capable of maintaining the SADA-complexes in tetrameric form upon storage and further protect the protein against protein degradation.
  • the compositions of the invention provide a solution of tetrameric SADA-complexes that remain on tetrameric form and reduces protein degradation after and during storage.
  • the formulations of the invention provide SADA-molecules with a desirable high shelf- life.
  • the invention concerns the composition of the invention, wherein the ionic strength is in the range of 5-150 mM, 10-135 mM, 20-120 mM or 25-100 mM.
  • the invention concerns the composition of the invention, comprising a SADA-complex in an amount selected among 5-50 g/L, 6.25-45 g/L, 7.5-40 g/L, 9.75-35 g/L, 10-20 g/L, and preferably 10-15 g/L.
  • the SADA-complex comprises two binding sites and a SADA domain, wherein the first binding site is capable of binding to a target antigen and the second binding site is capable of binding to a payload, such as a cytotoxic agent, a radionuclide or a compound capable of binding a payload.
  • a payload such as a cytotoxic agent, a radionuclide or a compound capable of binding a payload.
  • the first and/or second binding site is or comprises an antibody component, such as an antigen binding fragment of an antibody, a scFv or a nanobody.
  • the first and/or second binding sites is (are) a scFv.
  • the first binding site is specific for a cell surface target, such as a tumor antigen.
  • the binding site specific for a tumor antigen is anti-GD2, anti- CD20, anti-CD38, anti-Globo H, anti-GPA33, anti-PSMA, anti-polysialic acid, anti-Lewy, anti- LiCAM, anti-HER2, anti-B7H3, anti-CD33, anti-peptide/MHC, anti-glypican3, or anti GD3 binding domain.
  • the invention concerns the composition of the invention, wherein the first binding site is capable of binding to a tumor antigen.
  • the invention concerns the composition according to the invention, wherein the first binding site is capable of binding to GD2, B7-H3, CD20, GPA33 or CD38.
  • GD2 is a disialoganglioside, which can be considered a tumor-associated antigen.
  • B7-H3 also known as CD276 is an immune checkpoint molecule and a costimulatory/coinhibitory immunoregulatory protein, which can be considered a tumor- associated antigen.
  • CD20 is a membrane-embedded surface molecule, which can be considered a tumor- associated antigen.
  • GPA33 is a glycoprotein and a cell surface antigen, which can be considered a tumor- associated antigen.
  • CD38 also known as cyclic ADP ribose hydrolase, is a glycoprotein, which can be considered a tumor-associated antigen.
  • the invention concerns the composition according to the invention, wherein the first binding site comprises a sequence a. Comprising the CDR sequences of SEQ ID NO: 1-6 and b. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 7.
  • the first binding site is capable of binding GD2 and comprises the sequence of SEQ ID NO: 7.
  • the invention concerns the composition according to the invention, wherein the first binding site comprises a sequence a. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 8; and a sequence b. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 9.
  • CD38 also known as cyclic ADP ribose hydrolase, is a glycoprotein, which can be considered a tumor-associated antigen.
  • the invention concerns the composition according to the invention, wherein the first binding site comprises a sequence a. Comprising the CDR sequences of SEQ ID NO: 29-34 and b. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 35.
  • the first binding site of this embodiment is capable of binding CD38.
  • the first binding site is capable of binding CD38 and comprises the sequence of SEQ ID NO: 35.
  • the invention concerns the composition according to the invention, wherein the first binding site comprises a sequence a. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 36 and a sequence b. Having at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 37.
  • the invention concerns the composition according to the invention, wherein the second binding site is capable of binding to a chelator.
  • any chelator may be used according to the invention, provided that the second binding site is capable of binding said chelator.
  • the invention concerns the composition according to the invention, wherein the second binding site is capable of binding to DOTA, or a compound comprising a DOTA ring system, or capable of binding DOTA or a compound comprising a DOTA ring system when DOTA is chelated to a metal ion, e.g. lutetium such as 175 Lu 3+ or 177 Lu 3+ .
  • a metal ion e.g. lutetium such as 175 Lu 3+ or 177 Lu 3+ .
  • DOTA Dodecane Tetraacetic Acid
  • 1,4,7,10-tetraazacyclododecane- 1,4,7 10-tetraacetic acid and has the formula (CHzCHzNCHzCOzH ⁇ also known as C16H28N4O8 • xHzO.
  • a compound comprising a DOTA ring system is in this specification intended to mean a compound comprising DOTA whereto additional groups or moieties are attached.
  • examples of such compounds include Benzyl-DOTA and the bispecific chelators disclosed in W02019010299A, incorporated by reference.
  • the invention concerns the composition according to the invention, wherein the second binding site: a. Comprises the CDR sequences of SEQ ID NO: 23-28, and b. Comprising a polypeptide with at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 35.
  • the second binding site of this embodiment is capable of binding DOTA-metal, i.e. DOTA chelating a metal ion such as lutetium, preferably Lu 3+ .
  • the invention concerns the composition according to the invention, wherein the second binding site is capable of binding DOTA-metal and comprises a sequence a. with at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 10 and a sequence b. with at least 90 %, 95%, 96%, 97% 98% or preferably at least 95% sequence identity, to SEQ ID NO: 11.
  • the invention concerns the composition according to the invention, wherein the SADA-domain comprises a sequence disclosed in SEQ ID No. 12 - 19 or a sequence that differs from one of the sequences SEQ ID NO: 12-19 by 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 substitutions.
  • the p53 tetramerization domain comprising the sequence of SEQ ID NO: 12, more preferred amino acids 6-36 of SEQ ID NO: 12, is a preferred SADA domain.
  • the SADA-complexes may according to the invention comprise additional elements, including but not limited to linkers separating different parts of the complex, antibody fragments apart from binding sites, such as constant regions and antigen fragments binding to and capable of eliciting effector or immune reactions.
  • the SADA complex comprises linkers.
  • Linkers also sometimes known as spacers are short amino acid sequences created to separate two domains in a single polypeptide, allowing the two domains to fold and operate without steric hindrance from an adjacent domain. Linkers are known in the art and the present invention is not limited to any particular sequence of the linkers. In general, the purpose of linkers is to connect and/or separate different elements of the complex and are typically mainly composed of small hydrophilic amino acids such as glycine, serin and threonine.
  • the invention concerns the composition according to the invention, wherein the SADA complex comprises linkers with a sequence selected among SEQ ID NO: 20 multiplied by an integer between 1-6.
  • Another suitable linker that may be used according to the invention is an lgG3 spacer domain, such as the lgG3 spacer domain is disclosed in SEQ ID NO: 21.
  • the SADA-complex consists of a SADA domain and 2 binding sites such as scFv's.
  • the SADA-complex comprises anti-GD2 scFv -anti-DOTA scFv - p53 tetramerization domain connected by linkers and/or spacers.
  • the SADA-complex has the following structure: anti-GD2 light chain Fv - anti-GD2 heavy chain Fv - anti-DOTA heavy chain Fv -anti-DOTA light chain Fv - p53 tetramerization domain connected by linkers and/or spacers.
  • SADA complexes includes the GD2-SADA conjugate comprising the amino acid sequence of SEQ ID NO: 22, the CD38-SADA conjugate comprising the amino acid sequence of SEQ ID NO: 38, the B7-H3-SADA conjugate comprising the amino acid sequence of SEQ ID NO: 39, the CD20-SADA conjugate comprising the amino acid sequence of SEQ ID NO: 40 and the GPA33-SADA conjugate comprising the amino acid sequence of SEQ ID NO: 41.
  • the composition according to the invention comprises a buffer system such as an organic acid or an alkali metal salt thereof.
  • the buffer is selected among acetate, citrate, histidine, citrate-histidine, acetate- histidine and succinate.
  • Preferred examples include acetate buffer, comprising acetic acid and sodium acetate.
  • Sodium acetate is also known as Acetic acid sodium salt and has the Formula CHsCOONa.
  • the invention concerns the composition according to the invention, comprising a buffer in an amount selected among 5-30 mM, 10-25 mM and preferably 20 mM.
  • the stabilizing agent is selected among polyols, in particular sugar alcohols and non-reducing sugars.
  • Preferred examples include sucrose, trehalose, sorbitol, glycerol and inositol.
  • the stabilizer maintains or extends the time, wherein the active pharmaceutical ingredient maintains the desirable properties during storage.
  • the invention concerns the composition according to the invention comprising a stabilizing agent, preferably sucrose, in an amount selected among, 200-600 mM, 225-500 mM, 250-300 mM, and preferably 275 mM.
  • a stabilizing agent preferably sucrose
  • the invention also concerns a composition, wherein the surfactant is a nonionic surfactant.
  • Nonionic surfactants may comprise/consist of long chain polymers which do not dissociate, consisting of a hydrophilic head group and a hydrophobic tail.
  • the invention concerns a composition wherein the surfactant is Polyethylene glycol sorbitan monolaurate, poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) or Polyethylene glycol sorbitan monooleate, Polyoxyethylenesorbitan monooleate.
  • the surfactant is Polyethylene glycol sorbitan monolaurate, poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) or Polyethylene glycol sorbitan monooleate, Polyoxyethylenesorbitan monooleate.
  • Polyethylene glycol sorbitan monolaurate also known as polyoxyethylenesorbitan monolaurate, is known in the art.
  • a preferred Polyethylene glycol sorbitan monolaurate is commercially available as Polysorbate® 20 or TWEEN® 20.
  • Polyethylene glycol sorbitan monooleate also known as polyoxyethylenesorbitan monooleate, is also known in the art.
  • a preferred Polyethylene glycol sorbitan monooleate is commercially available as Polysorbate® 80 or TWEEN® 80.
  • Poly( ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) is also known in the art.
  • a preferred poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) is commercially available as Kolliphor® P188 or Poloxamer® 188.
  • Polyethylene glycol sorbitan monolaurate is a preferred surfactant for use according to the invention.
  • the invention concerns compositions, comprising a surfactant in an amount selected among 0.1-0.3 g/L, 0.15-0.25 g/l, 0.16-0.24 g/L, 0.17-0.23 g/L, 0.18- 0.22 g/L, 0.19-0.21 g/L and preferably 0.20 g/L.
  • compositions of the invention may have a pH selected among 5-6, 5.1-5.9, 5.2-5.8, 5.3- 5.7, 5.4-5.6 and preferably 5.5.
  • compositions according to the invention may further comprise an antioxidant.
  • An antioxidant can be added to a composition to protect the contents from damage caused by oxidative stress. This can be advantageous for proteins comprising amino acids susceptible to oxidation particularly for proteins comprising amino acids susceptible of oxidation which amino acids are exposed on the surface of the proteins.
  • Example of amino acids susceptible to oxidation includes residues such as methionine and (free) cysteine.
  • a preferred antioxidant for use according to the invention is Methionine.
  • the invention concerns compositions, comprising an antioxidant, such as methionine, in an amount selected among, 5-15 mM, 6-14 mM, 7-13 mM, 8-12 mM, 9-11 mM and preferably 10 mM.
  • the invention further concerns a composition according to the invention, that does not comprise salt, or only comprise salt in a low concentration e.g. below 50 mM.
  • salts in general destabilizes SADA complexes, and it is therefore preferred to limit the amounts of salts such as NaCI, KCI, or similar salts; in the composition.
  • a preferred composition according to the invention comprises a. SADA-complex in an amount of 15 g/L b. Sodium acetate in an amount of 20 mM c. Sucrose in an amount of 275 mM d. Polysorbate 20 in an amount of 0.2 g/L wherein the pH is 5,5 and the SADA complex is predominantly on tetrameric form.
  • the composition further comprises 10 mM methionine.
  • the term predominantly on tetramer-form is in the present specification and claims intended to mean that the majority of the SADA-complexes are on tetramer-form, e.g., at least 50% w/w; at least 60% w/w; at least 70% w/w; at least 80% w/w; at least 90% w/w; or at least 95% w/w.
  • the composition according to the invention is a pharmaceutical composition.
  • the SADA-complexes of the invention may be prepared using methods known in the art.
  • a nucleic acid encoding the desired amino acid sequence of the complex is provided.
  • a construct comprising the nucleic acid sequence provided with the necessary regulatory elements to direct expression in a selected host organism, such as promoter, signal sequence ribosome recognition sites Kozak sequence, enhancers, terminator, poly adenylation sites etc. is prepared and inserted into the selected host organism that is grown under conditions leading the expression of the SADA-complex. Finally, the SADA- complex is recovered from the growth broth using well known separation and recovery techniques.
  • the formulation of the invention may be prepared by dissolving the SADA-complex and other ingredients in sterile water using method known in the art.
  • the invention further concerns use of a composition according to the invention for treating or diagnosing cancer.
  • the composition according to the invention may be used for treating or diagnosing cancer expressing the tumor antigen recognized by the SADA conjugate, such as GD2, CD38, B7-H3, CD20 or GPA33.
  • SADA conjugate such as GD2, CD38, B7-H3, CD20 or GPA33.
  • the cancer may be selected among neuroblastoma, melanoma, sarcoma, brain tumor or carcinoma.
  • the invention concerns use of a composition according to the invention, wherein said cancer is selected among osteosarcoma, liposarcoma, fibrosarcoma, malignant fibrous histiocytoma, leiomyosarcoma, spindle cell sarcoma, brain tumor, small cell lung cancer, retinoblastoma, HTLV-1 infected T cell leukemia and other tumors that are positive for GD2, CD38, B7-H3, CD20 or GPA33.
  • said cancer is selected among osteosarcoma, liposarcoma, fibrosarcoma, malignant fibrous histiocytoma, leiomyosarcoma, spindle cell sarcoma, brain tumor, small cell lung cancer, retinoblastoma, HTLV-1 infected T cell leukemia and other tumors that are positive for GD2, CD38, B7-H3, CD20 or GPA33.
  • the invention concerns use of a composition according to any of the preceding claims, in a method comprising the steps: a. Administering a composition according to the invention to a patient in need of the treatment or diagnosing; and b. After a period administering a DOTA-compound comprising a radionuclide.
  • the period in step b. is typically selected between 48 hours to 72 hours, such as 50 hours to 65 hours, or 55 hours to 60 hours. Preferably, the period is selected to allow the majority of unbound SADA-complex to disassemble and be cleared from the blood stream.
  • the method of the invention may further comprise administering a clearing agent after step a. and before step b.
  • the invention concerns use of a composition according to the invention, wherein the radionuclide is selected among an alpha, beta and positron emitting radionuclide.
  • the invention concerns use according to the invention, wherein the radionuclide is selected from the group consisting of 211 At, 51 Cr, 57 Co, 58 Co, 67 Cu, 152 Eu, 67 Ga, 111 ln, 59 Fe, 212 Pb, 177 Lu, 223 Ra, 224 Ra, 186 Re, 188 Re, 75 Se, 99m Tc, 227 Th, 89 Zr, 90 Y, 94m Tc, 64 Cu, 68 Ga, 66 Ga, 86 Y, 82 Rb, 110m ln, 209 Bi, 211 Bi, 212 Bi, 213 Bi, 210 Po, 211 Po, 212 Po, 214 Po, 215 Po, 216 Po, 218 Po, 211 At, 215 At, 217 At, 218 At, 221 Fr, 223 Ra, 224 Ra, 226 Ra, 225 Ac, 227 Ac, 227 Th, 228 Th, 229 Th, 230 Th, 232 Th, 231 Pa,
  • radionuclides for use according to the invention includes 177 Lu, "mTc, 64 Cu, 90 Y and 89 Zr.
  • the invention concerns kit comprising the composition of the invention, and a DOTA compound.
  • the kit further comprises instructions to use, or at least information to the user regarding where to find such information.
  • the invention concerns kit according to the invention, further comprising a radionuclide.
  • Antibody fragment is a portion of an antibody such as F(ab')2, F(ab)2, Fab', Fab, Fv, sFv and the like. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the intact antibody. For example, an 3F8 monoclonal antibody fragment binds with an epitope recognized by 3F8.
  • antibody fragment also includes any synthetic or genetically engineered protein that acts like an antibody by binding to a specific antigen to form a complex.
  • antibody fragments include isolated fragments consisting of the variable regions, such as the "Fv” fragments consisting of the variable regions of the heavy and light chains, recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker ("scFv proteins"), and minimal recognition units consisting of the amino acid residues that mimic the hypervariable region.
  • DOTA Dodecane Tetraacetic Acid
  • scFv proteins peptide linker
  • minimal recognition units consisting of the amino acid residues that mimic the hypervariable region.
  • DOTA DOTA (Dodecane Tetraacetic Acid) is also referred to as 1,4,7,10-tetraazacyclododecane- 1,4,7 10-tetraacetic acid, and has the formula (CH 2 CH 2 NCH 2 CO 2 H)4 also known as C16H28N4O8 • xH 2 O.
  • DOTA metal chelate means DOTA with a complex bound metal ion.
  • Derivative of DOTA is intended to mean a compound comprising the DOTA ring system and is capable of chelating metal ions. Examples of such compounds include Benzyl-DOTA and the bispecific chelators disclosed in W02019010299A. Additional DOTA derivatives are disclosed in W02010099536 Al.
  • Radioactive isotope examples include, but are not limited to, 211 At, 14 C, 51 Cr, 57 Co, 58 Co, 67 Cu, 152 Eu, 67 Ga, 3 H, 111 ln, 59 Fe, 177 Lu, 32 P, 223 Ra, 224 Ra, 186 Re, 188 Re, 75 Se, 35 S, 99m Tc, 227 Th, 89 Zr, 90 Y, 123 l, 124 l, 125 l, 131 l, 94m Tc, 64 Cu, 68 Ga, 66 Ga, 76 Br, 86 Y, 82 Rb, 110m ln, 13 N, 11 C, 18 F and alpha- emitting particles.
  • Non-limiting examples of alpha-emitting particles include 209 Bi, 211 Bi, 212 Bi, 213 Bi, 212 Pb, 210 Po, 211 Po, 212 Po, 214 Po, 215 Po, 216 Po, 218 Po, 211 At, 215 At, 217 At, 218 At, 218 Rn, 219 Rn, 220 Rn, 222 Rn, 226 Rn, 221 Fr, 223 Ra, 224 Ra, 226 Ra, 225 Ac, 227 Ac, 227 Th, 228 Th, 229 Th, 230 Th, 232 Th, 231 Pa, 233 U, 234 U, 235 U, 236 U, 238 U, 237 Np, 238 Pu, 239 Pu, 240 Pu, 244 Pu, 241 Am, 244 Cm, 245 Cm, 248 Cm, 249 Cf, and 252 Cf.
  • treatment refers to prophylaxis and/or therapy, particularly wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of multiple sclerosis.
  • beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
  • Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
  • Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
  • composition is intended to mean a composition for administration as a drug or medicine to a patient in need thereof.
  • Pharmaceutical compositions are prepared from pharmaceutical grade ingredients e.g., as described in European Pharmacopoeia 10 th Edition, using methods and technologies known in the pharmaceutical or apothecary area.
  • Sequence identity is intended to mean a measurement of the relatedness of two nucleic or amino acid sequences. Sequence identity is determined by aligning the two sequences and finding the longest overlap, counting the number of matches in the overlap and calculating the sequence identity by dividing the number of matches by the number of, nucleotide or amino acid, residues in the overlap. Sequence identity is typically expressed in percent (%).
  • Sequence alignment refers to Pairwise alignments. Several algorithms perform this including the sequence alignment program Clustal Omega[doi:10.1038/msb.2011.75],
  • sequence alignment are performed using the algorithm: Algorithm: Clustal Omega (1.2.4),
  • Fig. 1 shows the results of two mass photometry measurements of GD2-SADA construct at a concentration of 100 nM and 5 nM. For further details see example 1.
  • Fig. 2 shows the distribution of monomer, dimer and tetramer of a GD2-SADA construct dependent of the concentration. For further details see example 1.
  • Fig. 3 shows the design of part A, phase I trial for GD2-SADA. For further details see example 10.
  • Fig. 4 shows the effect of tetramerization on the tumor killing effect for a GD2-SADA conjugate. For further details see example 9.
  • Fig.5 shows SPECT images of tumor implanted IMR-32 athymic nude mice that had been given GD2-SADA (>90% tetramer, 10 mg/kg, IV) (top panel), GD2-monomer (2.4 mg/kg, IV) (middle panel) and a GD2-monomer (9.6 mg/kg)(lower panel); followed by administration of 177 Lu-DOTA.
  • the first mouse was scanned 2 hours after administration of 177 Lu- DOTA, the following mice were scanned 24, 48 and 120 hours after administration of 177 Lu- DOTA, respectively.
  • GD2-SADA >90% tetramer, 10 mg/kg, IV
  • GD2-monomer 2.4 mg/kg, IV
  • a GD2-monomer 9.6 mg/kg
  • SEQ ID NO: 1-6 CDR sequences of the GD2 binding antibody 3F8 equal to the CDR sequences of the GD2-scFv;
  • SEQ ID NO: 7 anti-GD2 scFv
  • SEQ ID NO: 10 huC825 VL
  • SEQ ID NO: 12-19 SADA domains disclosed in WO 2018204873A1;
  • SEQ ID NO: 20 Linker sequence
  • SEQ ID NO: 21 lgG3 spacer sequence
  • SEQ ID NO: 22 GD2-SADA complex.
  • SEQ ID NO: 29-34 CDR sequences of a CD38 binding antibody
  • SEQ ID NO: 35 anti-CD38 scFV
  • SEQ ID NO: 36 anti-CD38 VL
  • SEQ ID NO: 37 anti-CD38 VH
  • SEQ ID NO: 40 CD20-SADA complex
  • SEQ ID NO: 41 GPA33-SADA complex. All cited references are incorporated by reference.
  • GD2-SADA complex the complex comprises an anti-GD2 scFv domain, a humanized C825 domain and a P53 SADA domain.
  • the complex is disclosed in WO 2018/204873A1 as SEQ ID NO:31, and as SEQ ID NO: 22 in the present patent application.
  • CD38-SADA complex the complex comprises an anti-CD38 scFv domain, a humanized C825 domain and a P53 SADA domain.
  • the complex is disclosed in (unpublished Danish Patent application) DK PA 2021 70621 as SEQ ID NO:41, and as SEQ ID NO: 38 in the present patent application.
  • B7-H3-SADA complex the complex comprises an anti-B7-H3 scFv domain, a humanized C825 domain and a P53 SADA domain.
  • the complex has the amino acid sequence shown in SEQ ID NO: 39.
  • CD20-SADA complex the complex comprises an anti-CD20 scFv domain, a humanized C825 domain and a P53 SADA domain.
  • the complex is disclosed in (unpublished Danish Patent application) DK PA 2021 70621 as SEQ ID NO:42, and as SEQ ID NO: 40 in the present patent application.
  • GPA33-SADA complex the complex comprises an anti-GPA33 scFv domain, a humanized C825 domain and a P53 SADA domain.
  • the complex is disclosed in (unpublished Danish Patent application) DK PA 2021 70621 as SEQ ID NO:61, and as SEQ ID NO: 41 in the present patent application.
  • Polysorbate 20 TWEEN 20®, Polyethylene glycol sorbitan monolaurate, Polyoxyethylenesorbitan monolaurate.
  • Polysorbate 80 TWEEN 80®, Polyethylene glycol sorbitan monooleate, Polyoxyethylenesorbitan monooleate.
  • Poloxamer 188 poly(ethylene glycol)-block- poly(propylene glycol)-block-poly(ethylene glycol)
  • Example 1 Impact of SADA concentration on relative numbers of oligomeric forms measured for GD2-SADA.
  • the GD2-SADA construct was diluted in PBS, and incubated for 60 minutes at 37°C before measuring the size distribution. Following dilutions were made: 150 nM, 100 nM, 50 nM, 10 nM, 5 nM, 1 nM and 100 pM and subjected to Mass photometry using the Refeyn Mass photometer. Exemplary spectrograms are shown in Figure 1, on top for 100 nM and below for 5 nM. In the spectrograms three peaks representing monomer, dimer and tetramer GD2-SADA can be seen and for the 100 nM concentration further a broad peak at around 500 kDa can be seen representing higher multimers of GD2-SADA. It can further be seen that at high concentration (100 nM) a high proportion of the GD2-SADA constructs are present at tetrameric form, whereas at low concentration the majority is present a monomeric form.
  • Figure 2 shows the distribution of GD2-SADA construct dependent on concentration.
  • Example 2 Effect of Buffers and pH GD2-SADA was prepared in 20 mM buffers at the pH indicated in the table below. The stability of the construct was determined by nanoDSF, where the Tm indicated the temperature where 50% of the protein is unfolding, meaning that a higher temperature is indicative for a higher stability. The measurements were made in quadruples. Following result were obtained: Table 1. GD2-SADA; Effect of buffer and pH The results showed that acetate and histidine provided a higher stability than citrate and succinate buffers. A pH value >5.5 was found to provide best stability.
  • Example 3 Effect of salt and sucrose GD2-SADA was prepared in 20 mM buffers at pH 5.5 and salt (sodium chloride) or sucrose added as indicated.
  • the stability of the construct was determined by nanoDSF, where the Tm indicated the temperature where 50% of the protein is unfolding, meaning that a higher temperature is indicative for a higher stability. The measurements were made in quadruples. Following result were obtained:
  • sucrose is stabilizing the construct whereas salt (sodium chloride) is destabilizing.
  • salt sodium chloride
  • Exemplary formulations were prepared, each comprising 20 mM acetate buffer and 275 mM sucrose and further comprising:
  • Protein recovery was 99 and 106 % for the tested concentrations. The recovery was calculated as the percentage difference between the observed concentrations and expected theoretical concentration.
  • the formulation used was evaluated to be stable within the tested concentration range of 0.05 mg/mL to 10 mg/mL, as well as during storage and handling of the GD2-SADA for up to 4 hours at room temperature.
  • the long-term stability study shows that GD2-SADA is stable in tetramer form (>94%) at 2- 8°C for at least 9 months in formulations containing 20 mM sodium acetate buffer, 275 mM sucrose and 0.2 g/L polysorbate 20 at pH of 5.5.
  • the accelerated stability data shows that GD2-SADA is stable in tetramer form (>94%) at 25 °C for at least 3 months.
  • the stability data shows that GD2-SADA is stable in current formulation regarding potency, purity and impurity.
  • Sample solution were centrifuged for 1 h at 20,000 X g, 4°C in a tabletop centrifuge. The supernatant was buffer exchanged into stock buffer (Histidine and Acetate with and without 150 mM NaCI) and samples were further diluted to 10 pM. Sucrose was spiked in for all conditions with target sucrose concentration. Each sample was measured as duplicates by nanoDSF (Ratio 350/330 nm for protein unfolding T m ). There are five molecules included in this study. These molecules have the same DOTA binding and P53 sequence, but with different antigen binding sites, such as GD2, CD38, B7H3, CD20 and GPA33.
  • Example 9 GD2-SADA tetramer has better PK profile and thus better tumor update as well as the tumor killing effect.
  • GD2-SADA and (P53-/-)GD2-SADA were compared regarding plasma pharmacokinetics and anti-tumor efficacy.
  • the result demonstrates GD2-SADA tetramer, altering the plasma exposure profile (Table 12), and improving the therapeutic efficacy of GD2-SADA (Fig.4), compared to GD2-SADA, (P53-/-)GD2-SADA in monomer form.
  • Example 10 Phase I trial of GD2-SADA: 177 Lu-DOTA Drug Complex in Patients with recurrent or refractory metastatic solid tumors known to express GD2, including Small Cell Lung Cancer, Sarcoma and Malignant Melanoma.
  • GD2-SADA dose escalation to optimize the safe tumor-targeting protein component (GD2-SADA) dose and dosing interval between GD2-SADA and 177 Lu-DOTA administrations.
  • the aim of the trial is to establish a safe dosing schedule.
  • Part A treatment schedule The trial design of part A can be seen in Fig. 3 and table 13 below. Table 13. Part A treatment schedule:
  • Cohort 1 Patients will be administered an intravenous infusion of GD2-SADA on Day 1 followed by an intravenous infusion of 177 Lu-DOTA imaging dose on Day 6. On Day 15 a repeated dose of GD2-SADA will be administered followed by a therapy dose of 177 Lu-DOTA on day 20.
  • Cohort 2 Patients will be administered an intravenous infusion of GD2-SADA on Day 1 followed by an intravenous infusion of 177 Lu-DOTA imaging dose on Day 3. On Day 15 a repeated dose of GD2-SADA will be administered followed by a therapy dose of 177 Lu-DOTA on day 17.
  • Cohort 3-5 Patients will be dosed on the same days as either Cohort 1 or Cohort 2, depending on the dosing interval between GD2-SADA and 177 Lu-DOTA selected after analysis of data from the first two cohorts.
  • Part A will consist of a 6-week DLT observation period and a follow-up period lasting up to 24 weeks after first treatment.
  • GD2-SADA Assuming a 48-hour interval between GD2-SADA and 177 Lu-DOTA is selected in Part A, patients will be administered an intravenous infusion of GD2-SADA on Day 1 followed by an intravenous infusion of 177 Lu-DOTA on day 3. On day 15, a repeated dose of GD2-SADA will be administered followed by a therapy dose of 177 Lu-DOTA on day 17.
  • Part B will consist of a 6-week DLT observation period and a follow-up period lasting up to 24 weeks after first treatment.
  • the treatment scheduled in Part C assumes a 48-hour interval between GD2-SADA and 177 Lu- DOTA has been selected in Part A.
  • Patients will be administered an intravenous infusion of GD2-SADA on Day 1 followed by an intravenous infusion of 177 Lu-DOTA imaging dose on Day 3.
  • First treatment cycle (Imaging Part followed by Therapy Part) is planned to have a duration of 6 weeks, and subsequent cycles (cycle 2-5) are planned to be 4 weeks (or when recovery from radiation toxicities incurred - a maximum delay of 8 weeks was permitted within this protocol) with GD2-SADA dosing on Day 1 and 177 Lu-DOTA dosing on Day 3 of each cycle. See Table 15 for Treatment schedule.
  • Part C will consist of a 6-week treatment cycle (Cycle 1) followed by up to 4 treatment cycles (Cycles 2-5) with a duration of 4 weeks each and a follow-up period lasting up to 52 weeks after first treatment.
  • Pre-medication including analgesic is mandatory and introduced based on experience from anti-GD2 IgG-based monoclonal antibodies. Administration scheme can be seen below in Table 16.
  • SEQ ID NO. 1 KASQSVSNDVT
  • SEQ ID NO. 2 SASNRYS
  • SEQ ID NO. 6 RGGHYGYALDY SEQ ID NO. 7:
  • SEQ ID NO. 14 RHGDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQLLQRP
  • SEQ ID NO. 16 STRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTEL
  • SEQ ID NO. 18 DEISMMGRVVKVEKQVQSIEHKLDLLLGFY
  • SEQ ID NO. 28 ARRGSYPYNYFDA
  • SEQ ID NO. 32 GFSLTSYG

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Optics & Photonics (AREA)
  • Physics & Mathematics (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Dermatology (AREA)
  • Biomedical Technology (AREA)
  • Endocrinology (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/DK2022/050279 2021-12-15 2022-12-14 Formulations comprising a sada complex Ceased WO2023110044A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP22826808.2A EP4448006A1 (en) 2021-12-15 2022-12-14 Formulations comprising a sada complex
JP2024534718A JP2024546804A (ja) 2021-12-15 2022-12-14 Sada複合体を含む製剤
CA3238361A CA3238361A1 (en) 2021-12-15 2022-12-14 Formulations comprising a sada complex
CN202280080939.6A CN118382458A (zh) 2021-12-15 2022-12-14 包含sada复合物的制剂
KR1020247023387A KR20240124960A (ko) 2021-12-15 2022-12-14 Sada 복합체를 포함하는 제제
AU2022412918A AU2022412918A1 (en) 2021-12-15 2022-12-14 Formulations comprising a sada complex
US18/717,256 US20250041410A1 (en) 2021-12-15 2022-12-14 Formulations Comprising a SADA Complex

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DKPA202170621 2021-12-15
DKPA202170621 2021-12-15

Publications (1)

Publication Number Publication Date
WO2023110044A1 true WO2023110044A1 (en) 2023-06-22

Family

ID=84547279

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK2022/050279 Ceased WO2023110044A1 (en) 2021-12-15 2022-12-14 Formulations comprising a sada complex

Country Status (9)

Country Link
US (1) US20250041410A1 (https=)
EP (1) EP4448006A1 (https=)
JP (1) JP2024546804A (https=)
KR (1) KR20240124960A (https=)
CN (1) CN118382458A (https=)
AU (1) AU2022412918A1 (https=)
CA (1) CA3238361A1 (https=)
TW (1) TW202333794A (https=)
WO (1) WO2023110044A1 (https=)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3178510A1 (en) * 2020-06-04 2021-12-09 Ahmed Mahiuddin Anti-b7h3 antibodies for the treatment of cancer

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010099536A2 (en) 2009-02-27 2010-09-02 Massachusetts Institute Of Technology Engineered proteins with high affinity for dota chelates
WO2018204873A1 (en) 2017-05-05 2018-11-08 Memorial Sloan Kettering Cancer Center Modular self assembly disassembly (sada) technologies
WO2019010299A1 (en) 2017-07-06 2019-01-10 Memorial Sloan Kettering Cancer Center DOTA-HAPTENE COMPOSITIONS FOR RADIOIMMUNOTHERAPY PRECIBLED BY A BISPECIFIC ANTIGEN ANTI-DOTA / ANTI-TUMOR ANTIBODY
WO2020210232A1 (en) * 2019-04-08 2020-10-15 Memorial Sloan Kettering Cancer Center Cd19 antibodies and methods of using the same
CA3180445A1 (en) * 2020-05-27 2021-12-02 Brian H. SANTICH Anti-gd2 sada conjugates and uses thereof
WO2022167052A1 (en) * 2021-02-08 2022-08-11 Y-Mabs Therapeutics, Inc. Use of ascorbic acid as stabilizing agent for anti b7-h3 antibodies

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010099536A2 (en) 2009-02-27 2010-09-02 Massachusetts Institute Of Technology Engineered proteins with high affinity for dota chelates
WO2018204873A1 (en) 2017-05-05 2018-11-08 Memorial Sloan Kettering Cancer Center Modular self assembly disassembly (sada) technologies
WO2019010299A1 (en) 2017-07-06 2019-01-10 Memorial Sloan Kettering Cancer Center DOTA-HAPTENE COMPOSITIONS FOR RADIOIMMUNOTHERAPY PRECIBLED BY A BISPECIFIC ANTIGEN ANTI-DOTA / ANTI-TUMOR ANTIBODY
WO2020210232A1 (en) * 2019-04-08 2020-10-15 Memorial Sloan Kettering Cancer Center Cd19 antibodies and methods of using the same
CA3180445A1 (en) * 2020-05-27 2021-12-02 Brian H. SANTICH Anti-gd2 sada conjugates and uses thereof
WO2022167052A1 (en) * 2021-02-08 2022-08-11 Y-Mabs Therapeutics, Inc. Use of ascorbic acid as stabilizing agent for anti b7-h3 antibodies

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
"European Pharmacopoeia"
J KANG ET AL: "Rapid Formulation Development for Monoclonal Antibodies - BioProcess InternationalBioProcess International", 12 April 2016 (2016-04-12), XP055349129, Retrieved from the Internet <URL:http://www.bioprocessintl.com/manufacturing/formulation/rapid-formulation-development-for-monoclonal-antibodies/> [retrieved on 20170223] *
NEAL WHITAKER ET AL, JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 106, no. 11, 1 November 2017 (2017-11-01), US, pages 3230 - 3241, XP055449627, ISSN: 0022-3549, DOI: 10.1016/j.xphs.2017.06.017 *
UCHIYAMA SUSUMU ED - SHUGAR DAVID ET AL: "Liquid formulation for antibody drugs", BIOCHIMICA ET BIOPHYSICA ACTA (BBA) - PROTEINS & PROTEOMICS, ELSEVIER, NETHERLANDS, vol. 1844, no. 11, 13 August 2014 (2014-08-13), pages 2041 - 2052, XP029050319, ISSN: 1570-9639, DOI: 10.1016/J.BBAPAP.2014.07.016 *
VIOLA MARGARIDA ET AL: "Subcutaneous delivery of monoclonal antibodies: How do we get there?", JOURNAL OF CONTROLLED RELEASE, ELSEVIER, AMSTERDAM, NL, vol. 286, 2 August 2018 (2018-08-02), pages 301 - 314, XP085478006, ISSN: 0168-3659, DOI: 10.1016/J.JCONREL.2018.08.001 *

Also Published As

Publication number Publication date
CN118382458A (zh) 2024-07-23
KR20240124960A (ko) 2024-08-19
TW202333794A (zh) 2023-09-01
AU2022412918A1 (en) 2024-06-06
EP4448006A1 (en) 2024-10-23
JP2024546804A (ja) 2024-12-26
CA3238361A1 (en) 2023-06-22
US20250041410A1 (en) 2025-02-06

Similar Documents

Publication Publication Date Title
US12109277B2 (en) Methods and kits for preparing radionuclide complexes
JP2017019855A (ja) 医薬製剤
TW202313127A (zh) 治療前列腺癌之組合物及方法
JP7447300B2 (ja) 放射性金属と複合するDZ-1-Lys-DOTAコンジュゲート及び使用
US20250295821A1 (en) Targeted radiopharmaceutical for tumor and its use in the imaging-guided combination therapy of targeted radiotherapy and immunotherapy
US20250041410A1 (en) Formulations Comprising a SADA Complex
AU2019314355A1 (en) Pharmaceutical formulations of masked antibodies
JP2021531330A (ja) 組合せ療法を使用してがんを治療する方法
CA3203175A1 (en) Peptide receptor radionuclide therapy
US20250152760A1 (en) Radioactive complex of anti-vegf antibody, and radiopharmaceutical
EP4317188A1 (en) Radioactive complex of anti-egfr antibody, and radiopharmaceutical
EP4327831A1 (en) Radioactive complex of anti-cd20 antibody, and radiopharmaceutical
US20240207461A1 (en) Radioactive antitumor agent
KR20190039695A (ko) 완충제를 포함하는 조성물
CN117377690A (zh) 抗egfr抗体的放射性复合物和放射性药物
TW202508639A (zh) 包含使用活性碳材料之純化步驟的抗體-藥物結合物之製造方法
CN121866076A (zh) 新型治疗靶标
WO2025202114A1 (fr) Complexe peptidique radiosensibilisant
CN117769440A (zh) 抗cd20抗体的放射性复合物和放射性药物

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22826808

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3238361

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2022412918

Country of ref document: AU

Ref document number: AU2022412918

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2022412918

Country of ref document: AU

Date of ref document: 20221214

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202280080939.6

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 2024534718

Country of ref document: JP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024011519

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202447052058

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20247023387

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022826808

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022826808

Country of ref document: EP

Effective date: 20240715

ENP Entry into the national phase

Ref document number: 112024011519

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240607