WO2023085779A1 - Fc 변이체를 포함하는 이종이합체 및 이의 제조방법 - Google Patents

Fc 변이체를 포함하는 이종이합체 및 이의 제조방법 Download PDF

Info

Publication number
WO2023085779A1
WO2023085779A1 PCT/KR2022/017565 KR2022017565W WO2023085779A1 WO 2023085779 A1 WO2023085779 A1 WO 2023085779A1 KR 2022017565 W KR2022017565 W KR 2022017565W WO 2023085779 A1 WO2023085779 A1 WO 2023085779A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
domain
heterodimer
chain
expression vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2022/017565
Other languages
English (en)
French (fr)
Inventor
류성언
박정원
김명빈
박흥록
윤소라
이광현
박수봉
배동구
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genuv Inc
Industry University Cooperation Foundation IUCF HYU
Original Assignee
Genuv Inc
Industry University Cooperation Foundation IUCF HYU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genuv Inc, Industry University Cooperation Foundation IUCF HYU filed Critical Genuv Inc
Priority to KR1020247019363A priority Critical patent/KR20240116743A/ko
Publication of WO2023085779A1 publication Critical patent/WO2023085779A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification

Definitions

  • the present invention relates to a heterodimer comprising an Fc variant and a method for preparing the same, and more particularly, to a heterodimer comprising an Fc variant having excellent structural similarity to the wild-type Fc region and a high heterodimer yield, and a method for preparing the same. it's about
  • Antibody therapeutics have a mechanism of action that prevents progression of a disease by using an antibody that binds to an antigenic epitope that causes the disease.
  • Antibody therapeutics are known to have excellent therapeutic efficacy and relatively few side effects due to high binding specificity to a target antigen and stability in the human body, and a number of antibody therapeutics including Adalimumab (trade name: Humira) have achieved great success.
  • bispecific antibodies Antibodies capable of binding to two types of antigens are referred to as bispecific antibodies.
  • bispecific antibody When using a bispecific antibody, it has an additional specific antigen binding site compared to a monospecific antibody, so it can more specifically target a tissue or cell related to a disease, is free from resistance, and can increase the therapeutic effect.
  • the bispecific antibodies can be engineered to bind to target cells and immune cells simultaneously, thereby positioning the immune cells in close proximity to the target cells, thereby inducing activation of the immune cells to effectively kill the target cells.
  • a typical example of a bispecific antibody therapeutic agent is a Catumaxomab antibody capable of binding to EpCAM antigen and CD3 of T cells as a bispecific antibody described in European Patent Publication No. 1315520.
  • various bispecific antibodies such as the Ertumaxomab antibody capable of binding to the HER2/neu antigen and CD3 of T cells, are in the clinical trial stage.
  • antibodies existing in nature have a structure in which two heavy chains with the same amino acid sequence and two light chains with the same sequence are combined to bind to one antigen.
  • chemical engineering is required.
  • the zygote must be formed using biotechnology.
  • a representative technique for forming a heterodimer in the Fc region is a knob-into-hole (KiH) technique.
  • KiH knob-into-hole
  • the KiH method in the hydrophobic interaction region of the CH3 domain, amino acids with large side chains are substituted with amino acids with small side chains in one chain, and mutations in which small amino acids are substituted with large amino acids in the other chain are used.
  • T366 is substituted with large residues of Y and W, and Y407, T394, and T366 of the opposite chain are substituted with small residues such as T and A. are listed.
  • the yield of Fc heterodimer was improved to about 60%.
  • EW-RVT variants introducing charge and hydrophobic amino acid mutations in the Fc region have been proposed. Although this variant showed an effect on yield improvement compared to KiH, as a result of analyzing the tertiary structure, it was confirmed that the tertiary structures of the CH2 and CH3 domains of the Fc region were modified due to structural collisions of the mutated residues.
  • the Fc region of an antibody exhibits the property of inducing an immune response by binding to immune cells and serves to regulate the stability of the antibody in plasma by increasing the half-life of the antibody. Structural similarity is reduced, and a problem in which the function of the Fc region is deteriorated may occur. In order to prevent such a functional degradation problem of the Fc region, it is important to design a variant having excellent structural similarity to the wild-type Fc region.
  • An object of the present invention is to provide a heterodimer comprising an Fc variant having high structural similarity to a wild-type Fc region and an excellent heterodimer production yield.
  • Another object of the present invention is to provide a method for preparing the heterodimer.
  • the present invention provides a heterodimer comprising a variant of the Fc region of wild-type immunoglobulin, specifically a variant of the CH3 domain.
  • the heterodimer of the invention comprises a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain of an antibody, wherein the first CH3 domain comprises amino acid at T366 substitution, wherein the second CH3 domain comprises an amino acid substitution at one or more of T366, L368 and Y407, and any one of the first CH3 domain and the second CH3 domain further comprises an amino acid substitution at K360. and the other domain further contains an amino acid substitution at Q347.
  • the amino acid number of the CH3 domain is based on the EU numbering of KABAT literature [Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Ed., NIH Publication, 1991].
  • the domain including the amino acid substitution at K360 among the first CH3 domain and the second CH3 domain may further include an amino acid substitution at Q347.
  • the domain including the amino acid substitution at Q347 among the first CH3 domain and the second CH3 domain may further include an amino acid substitution at K360.
  • a domain comprising an amino acid substitution at K360 among the first CH3 domain and the second CH3 domain, a domain comprising an amino acid substitution at K360 further comprises an amino acid substitution at Q347, and a domain comprising an amino acid substitution at Q347 is at K360. It may further include amino acid substitutions of.
  • the amino acid substitution at K360 and/or Q347 of the first CH3 domain and/or the second CH3 domain comprises a substitution with an amino acid that is positively or negatively charged at physiological pH.
  • the heterodimer of the invention comprises a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain of an antibody, wherein the first CH3 domain comprises amino acid at T366 substitution, wherein the second CH3 domain comprises an amino acid substitution at one or more of T366, L368 and Y407, and wherein the first CH3 domain and the second CH3 domain comprise an amino acid substitution at one or more of K360 and Q347, respectively.
  • the domain in which the Q347 is substituted with an amino acid having a positive charge at physiological pH may further include substitution of an amino acid with a positive charge at physiological pH at K360, and the K360 is substituted at physiological pH.
  • the other domain that is substituted with a negatively charged amino acid may further include a substitution at Q347 with an amino acid that is negatively charged at physiological pH, or
  • K360 of the other domain is substituted with an amino acid that is positively charged at physiological pH
  • the domain in which Q347 is substituted with an amino acid that is negatively charged at physiological pH further includes substitution of K360 with an amino acid that is negatively charged at physiological pH.
  • the first CH3 domain and the second CH3 domain may include the following amino acid substitutions at Q347 and K360, respectively:
  • Q347 and K360 of either of the first CH3 domain and the second CH3 domain are substituted with amino acids that are positively charged at physiological pH, and K360 and Q347 of the other domain are negatively charged at physiological pH. is substituted with an amino acid
  • the invention comprises a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain, wherein the first CH3 domain comprises amino acid substitutions at T366 and K360. wherein the second CH3 domain provides a heterodimer comprising an amino acid substitution at one or more of T366, L368 and Y407 and an amino acid substitution at Q347.
  • the invention comprises a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain, wherein the first CH3 domain comprises amino acid substitutions at T366 and Q347. wherein the second CH3 domain provides a heterodimer comprising an amino acid substitution at one or more of T366, L368 and Y407 and an amino acid substitution at K360.
  • the invention includes a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain, wherein the first CH3 domain is at T366, K360 and Q347. amino acid substitutions, and the second CH3 domain provides a heterodimer comprising amino acid substitutions at one or more of T366, L368 and Y407 and amino acid substitutions at K360 and Q347.
  • the first CH3 domain may include amino acid substitutions of T366W
  • the second CH3 domain may include amino acid substitutions of T366S, L368A, and Y407V.
  • each of the first CH3 domain and the second CH3 domain may include one or more amino acid substitutions selected from the group consisting of K360E, K360D, K360R, Q347E, Q347D, Q347R and Q347K.
  • the lysine (K) at amino acid position 360 of the other domain may not be substituted.
  • the domain including the amino acid substitution of Q347E or Q347D preferably further includes the amino acid substitution of K360E or K360D.
  • the amino acid substitution at Q347 is a positively charged amino acid. Substitution of is preferred.
  • the CH3 domain in the heterodimer, may be included in an immunoglobulin selected from the group consisting of IgG, IgM, IgA, IgD and IgE, preferably IgG, more preferably human IgG. there is.
  • the heterodimer may further include one or more binding domain proteins linked to one or more of the first and second polypeptides.
  • the connection may be a direct connection or a connection by a peptide composed of 1 to 50 amino acids.
  • the binding domain protein may be at least one selected from the group consisting of an antigen-binding region of an antibody, a receptor-derived protein, a cytokine, and a hormone.
  • the antigen binding region may be in the form of Fab, scFab, sdAb, scFv, di-scFv or (dsFv) 2 .
  • the heterodimer may be a bispecific or multispecific antibody capable of binding to two or more target proteins, or a bispecific or multispecific fusion protein.
  • one or more drugs may be conjugated to the heterodimer.
  • Another aspect of the present invention also provides a polynucleotide encoding the heterodimer.
  • the present invention also provides an expression vector comprising the polynucleotide.
  • the present invention also provides a host cell comprising the polynucleotide or an expression vector containing the polynucleotide.
  • the present invention also provides a method for preparing the heterodimer.
  • the method for preparing the heterodimer includes preparing one or more expression vectors encoding the heterodimer; and forming a heterodimer by expressing the expression vector in a host cell and obtaining a protein.
  • the expression vector may include a polynucleotide sequence encoding a first polypeptide and a polynucleotide sequence encoding a second polypeptide.
  • the expression vector may include a first expression vector comprising a polynucleotide sequence encoding a first polypeptide, and a second expression vector comprising a polynucleotide sequence encoding a second polypeptide.
  • the first expression vector and the second expression vector may be respectively expressed in a host cell to obtain two types of proteins, and a heterodimer may be formed by a mixing reaction.
  • a heterodimer can be obtained by co-expressing the first expression vector and the second expression vector in a host cell.
  • the present invention also provides a method for treating a disease, comprising administering the heterodimer or a pharmaceutical composition containing the heterodimer to a subject.
  • the Fc variants of the present invention bonding is hardly formed between chains having the same sequence and bonding strength between chains having different sequences is improved, so that the production yield of heterodimers can be remarkably improved.
  • the Fc variant of the present invention can minimize structural modification due to mutation, it has excellent structural similarity with the wild-type Fc region. Therefore, by using the heterodimer formation technology of the present invention, various types of antibodies maintaining the function of the Fc region can be produced in high yield.
  • 1 is a heterodimer according to one embodiment of the present invention, which schematically shows the structure of a heterodimer in which an Fc region is linked to an antigen-binding region.
  • FIGS. 2a and 2b respectively show amino acid sequences of a first Fc chain (a) and a second Fc chain (b) of a heterodimer according to an embodiment of the present invention.
  • 3a and 3b respectively show structural models of a hydrophobic interaction site (a) and a charge pair interaction site (b) between Fc chains in a heterodimer according to an embodiment of the present invention.
  • Figure 4 shows the structure of an Fc heterodimer according to an embodiment of the present invention, an Fc heterodimer of the prior art, and a wild-type Fc region.
  • 5a and 5b show structural comparison between heterodimer and wild-type according to an embodiment of the present invention (a) and structure comparison between heterodimer and wild-type in the prior art, targeting only the B-chain region in the structure of FIG. 4 ( b) is shown.
  • FIG. 6 shows SDS-PAGE results of a heterodimer according to an embodiment of the present invention and a prior art heterodimer.
  • FIG. 7 schematically shows the structure of a heterodimer according to an embodiment of the present invention and a prior art heterodimer.
  • Figure 8 shows a protein form that can occur when preparing an asymmetric heterodimeric form in which an antigen-binding region is linked to one chain of the Fc region according to an embodiment of the present invention.
  • SEC 9 is a size exclusion chromatography (SEC)-HPLC graph analysis profile of a recombinant protein expressed and purified from an expression vector into which a CH3 variant according to an embodiment of the present invention or a CH3 variant of the prior art was introduced.
  • SEC size exclusion chromatography
  • FIG. 10 is a graph showing the production ratios of homodimers, heterodimers, and monomers obtained from the SEC-HPLC graph analysis profile of FIG. 9 .
  • 11a, 11b and 11c show wild-type IgG1 homodimer (WT Fc) (a) and two heterodimers (WRE (b) and WRREE (c), respectively) according to an embodiment of the present invention, respectively, and FcRn It is a graph in which affinity analysis was performed through steady-state RU based on sensorgrams obtained through association and dissociation analysis.
  • 12a, 12b, and 12c show the results of differential scanning heat capacity analysis of a wild-type IgG1 homodimer (WT Fc) (a) and two heterodimers (WRE (b) and WRREE (c), respectively) according to an embodiment of the present invention, respectively. It is a profile.
  • the present invention relates to a heterodimer comprising a variant of the Fc region of a wild type antibody, specifically a variant of the CH3 domain.
  • heterodimer refers to a dimer formed by two different monomers.
  • heterodimer refers to an Fc heterodimer or CH3 heterodimer, which is a protein complex in which the Fc region or CH3 domain of an antibody is formed of two chains having different amino acid sequences and coupled to each other, as well as an antibody comprising the same. It is meant to cover all forms of fusion proteins, bispecific antibodies and multispecific antibodies in which other polypeptides and/or proteins are linked to part or all of the heterodimer, and antibody-drug conjugates in which a drug is conjugated thereto. interpreted
  • each chain of the Fc region can be divided into a first Fc chain and a second Fc chain.
  • the heterodimer of the present invention can be divided into a first polypeptide comprising a first CH3 domain and a second polypeptide comprising a second CH3 domain.
  • the first Fc chain (or first polypeptide) and the second Fc chain (or second polypeptide) may form a tertiary structure, which may be a covalent bond such as a disulfide bond, a hydrogen bond, an ionic bond, or a van der Waals bond. They can interact with each other by non-covalent interactions such as bonding and hydrophobic interactions.
  • the term "antibody” includes an immunoglobulin (Ig) molecule immunologically reactive with a specific antigen, and includes both polyclonal antibodies and monoclonal antibodies.
  • the term also applies to genetic engineering such as non-human mammalian antibodies (eg murine antibodies), chimeric antibodies, humanized antibodies, human antibodies and heterologous antibodies (eg bispecific antibodies). forms produced by The immunoglobulin may be IgG such as IgG1, IgG2, IgG3, or IgG4, IgA, IgE, IgD, or IgM.
  • the term "Fc region” refers to the C-terminal region including the CH2 and CH3 domains (or CH2, CH3 and CH4 domains) of the heavy chain constant region of an antibody, wild-type (wild-type, WT) Fc It is used in the sense of encompassing the region and its variants.
  • the Fc region may refer to a region extending from residue 221 of a human IgG1 heavy chain to the C-terminus, or a region further including a hinge in the region.
  • the numbering of amino acid residues in the Fc region is according to the EU numbering that defines the numbering of residues in human immunoglobulin heavy chains in the Kabat literature.
  • wild-type Fc region includes an amino acid sequence identical to the amino acid sequence of an Fc region of an immunoglobulin found in nature.
  • the term “variant of Fc region” includes one or more amino acid residues different from the wild-type Fc region, and may be abbreviated as “Fc variant”.
  • the Fc variant may have about 80% or more, preferably about 90% or more, homology to the parent wild-type Fc region sequence.
  • Fc variants are formed by introducing different variants into the CH3 domain of each chain.
  • the "Fc variant” may further include amino acid mutations in the CH2 domain, if necessary.
  • CH3 domain variant includes one or more amino acid residues different from the wild-type CH3 domain of an antibody heavy chain, and may be abbreviated as "CH3 variant".
  • the CH3 variant may have about 95% or more, preferably 96% or more, more preferably 97% or more homology to the sequence of the wild-type CH3 domain.
  • the term "mutation" is meant to include substitution, insertion and/or deletion of amino acid residues, and preferably, the variants of the present invention include substitution of amino acid residues. Substitution of amino acid residues is indicated in the order of the amino acid residue present in the Fc region of the parent wild-type antibody, the number of the amino acid residue, and the amino acid residue substituted.
  • each chain constituting the Fc region can be divided into a first Fc chain and a second Fc chain, and each chain contains one or more mutations using wild-type Fc as a parent.
  • a heterodimer is formed by introducing mutations complementary to each other at the interaction site of the two chains so that bonds are not formed between the same chains.
  • the residues of the wild-type Fc dimer interaction site are mutated into various sets through protein tertiary structure modeling, and for each mutation set Mutations were designed in such a way that a set optimized for structural transformation and interaction energy was searched for through energy minimization and structural transformation analysis of the tertiary structure.
  • the heterodimer of the invention comprises a first polypeptide comprising a first CH3 domain of an antibody and a second polypeptide comprising a second CH3 domain, wherein the first CH3 domain is at T366 wherein the second CH3 domain comprises an amino acid substitution at one or more of T366, L368 and Y407, wherein the first CH3 domain and the second CH3 domain comprise an amino acid substitution at one or more of K360 and Q347, respectively more includes
  • the amino acid substitution at T366 of the first polypeptide may be a substitution with tryptophan (W), tyrosine (Y), arginine (R) or phenylalanine (F).
  • the amino acid substitution at T366 may be T366W.
  • the second polypeptide comprises an amino acid substitution at one or more of T366, L368 and Y407 to interact with residue at amino acid position 366 of the first polypeptide.
  • the amino acid substitution at T366, L368 or Y407 may be a substitution with serine (S), alanine (A) or valine (V), respectively.
  • the amino acid substitution at T366 of the second polypeptide may be T366S
  • the amino acid substitution at L368 may be L368A
  • the amino acid substitution at Y407 may be Y407V.
  • the amino acid substitution at K360 or Q347 comprises a substitution with an amino acid that is positively or negatively charged at physiological pH (approximately pH 7.4).
  • amino acids that are positively charged at physiological pH include arginine (R), lysine (K) or histidine (H).
  • Amino acids that are negatively charged at physiological pH include glutamic acid (E) or aspartic acid (D).
  • the amino acid substitution at K360 or Q347 is substituted with amino acids having opposite charges between the first CH3 domain and the second CH3 domain, so that an electrostatic attraction is formed between the two domains. can interact.
  • the lysine (K) at amino acid position 360 is itself positively charged at physiological pH, it may not be substituted if the amino acid substitution at position Q347 in the opposite domain is a change to a negatively charged amino acid.
  • the amino acid substitution at K360 may be substitution with glutamic acid (E), aspartic acid (D), histidine (H) or arginine (R), preferably K360E or K360R. there is.
  • the other polypeptide chain in order to interact with the residue at amino acid position 360 of the polypeptide chain comprising the amino acid substitution at K360, the other polypeptide chain comprises the amino acid substitution at Q347.
  • the amino acid substitution in Q347 may be substitution with arginine (R), lysine (K), histidine (H), glutamic acid (E) or aspartic acid (D), preferably Q347R or Q347E.
  • the heterodimer of the present invention is such that when either one of the first CH3 domain and the second CH3 domain does not include an amino acid substitution at Q347, the other domain has an amino acid substitution at K360. It is preferable not to include
  • the heterodimer of the present invention may not include an amino acid substitution at one or more of Y349, D356, F405 and K409 in the first CH3 domain and/or the second CH3 domain.
  • a variant capable of increasing the yield of Fc dimer formation while preventing structural deformation due to the optimized hydrophobic interface was designed by adjusting hydrophobic residues and introducing electric charges so that the hydrophobic interface does not collide in the Fc region.
  • heterodimers can be obtained in higher yields than conventional Fc heterodimer formation techniques.
  • the CH2 domain of the Fc region is a place where Fc receptors, etc. bind to cause an effector function of immune activation. If the structure of the CH2 domain is changed, the immune effector function may be reduced.
  • the CH2 and CH3 domains of the variant according to the present invention It has very good structural similarity to wild-type Fc, and thus the immune effector function of the Fc region can be maintained.
  • the FcRn nonatal Fc receptor
  • the amino acid substitution at K360 may be made in the first Fc chain and the amino acid substitution at Q347 may be made in the second Fc chain.
  • the first Fc chain may include amino acid substitutions at T366 and K360
  • the second Fc chain may include amino acid substitutions at one or more of T366, L368 and Y407 and amino acid substitution at Q347.
  • the first Fc chain comprises amino acid substitutions at T366 and K360
  • the second Fc chain may comprise amino acid substitutions at T366, L368, Y407 and Q347.
  • the first Fc chain may include substitutions of T366W and K360E
  • the second Fc chain may include substitutions of T366S, L368A, Y407V and Q347R.
  • these variants are named "WER variants”.
  • the WER variant may be formed using the following amino acid sequence of human IgG1 (according to EU numbering in Kabat literature) from 221 to 447 as a parent.
  • the amino acid sequence of the WER variant chain can be represented by SEQ ID Nos: 1 and 2 below.
  • the amino acid substitution at Q347 may be made in the first Fc chain and the amino acid substitution at K360 may be made in the second Fc chain.
  • the first Fc chain may include amino acid substitutions at T366 and Q347 and the second Fc chain may include amino acid substitutions at one or more of T366, L368 and Y407 and amino acid substitutions at K360. More preferably, the first Fc chain comprises amino acid substitutions at T366 and Q347, and the second Fc chain may comprise amino acid substitutions at T366, L368, Y407 and K360.
  • the first Fc chain may include substitutions of T366W and Q347R
  • the second Fc chain may include substitutions of T366S, L368A, Y407V, and K360E.
  • these variants are named "WRE variants" (see SEQ ID NOs: 6 and 7).
  • the first Fc chain and the second Fc chain may have both amino acid substitutions at K360 and Q347.
  • a first Fc chain may comprise amino acid substitutions at T366, K360 and Q347
  • a second Fc chain may comprise amino acid substitutions at one or more of T366, L368 and Y407 and amino acid substitutions at K360 and Q347.
  • the first Fc chain comprises amino acid substitutions at T366, K360 and Q347
  • the second Fc chain may comprise amino acid substitutions at T366, L368, Y407, K360 and Q347.
  • the first Fc chain may include substitutions of T366W, K360R, and Q347R
  • the second Fc chain may include substitutions of T366S, L368A, Y407V, K360E, and Q347E.
  • these variants are named "WRREE variants" (see SEQ ID NOs: 8 and 9).
  • the first Fc chain may include substitutions of T366W, K360E, and Q347E
  • the second Fc chain may include substitutions of T366S, L368A, Y407V, K360R, and Q347R.
  • these variants are referred to as "WEERR variants”.
  • hydrophobic residues are adjusted and charges are introduced so that the hydrophobic interface does not collide in the Fc region, thereby minimizing structural deformation due to the optimized hydrophobic interface and increasing the yield of Fc dimer formation. can be significantly improved.
  • the variant of the present invention has a very good structural similarity to wild-type Fc, and thus has the advantage of maintaining the immune effector function of the Fc region and preserving the stability effect in plasma.
  • the heterodimer according to one embodiment of the present invention may include an Fc region including the CH3 mutation and one or more binding domain proteins linked thereto.
  • the binding domain protein may be linked to one or more polypeptides of a first polypeptide comprising a first CH3 domain and a second polypeptide comprising a second CH3 domain.
  • the heterodimer formation technology of the present invention can be applied to various types of heterodimer proteins and antibodies, such as fusion proteins, bispecific antibodies, and multispecific antibodies.
  • the connection may be a direct connection or a connection by a peptide composed of 1 to 50 amino acids.
  • the binding domain protein may be linked to the N-terminus and/or C-terminus of the first and/or second polypeptide.
  • the binding domain protein may include at least one selected from the group consisting of antigen-binding regions of antibodies, cytokines, growth factors, hormones, and receptor-derived proteins.
  • the antigen-binding region may refer to a part of an antibody that specifically binds to part or all of an antigen and includes a region complementary to part or all of the antigen.
  • the form of the antigen-binding region linked to the Fc region is not particularly limited, and may be in the form of a recombinant domain such as scFab, sdAb, scFv, di-scFv, dsFv, (dsFv) 2 as well as Fab form.
  • the Fab type includes a heavy chain variable region (VH) domain and a CH1 domain among constant regions, and a light chain variable region (VL) domain and a constant region CL domain, and a disulfide bond is formed between the CH1 domain and the CL domain.
  • VH heavy chain variable region
  • VL light chain variable region
  • CL domain constant region
  • a disulfide bond is formed between the CH1 domain and the CL domain.
  • the scFab form refers to a single-chain antibody fragment in which a VH-CH1 heavy chain fragment and a VL-CL light chain are connected by a peptide linker.
  • the sdAb form means a single-domain variable fragment, and means one variable region domain.
  • the scFv form means a single-chain variable fragment in the form of a continuous variable region, and means a recombinant domain in which VH and VL regions are connected by a peptide linker.
  • the di-scFv form means a recombination domain in which two scFvs are linked by a linker.
  • the linker may suitably use a linker known in the art, and may be a peptide composed of 5 to 20 amino acids.
  • the linker may be composed of one or more amino acids selected from the group consisting of G, A, S, P, E, T, D and K.
  • the linker may be (GGGGX) n , X is preferably A or S, and n is preferably a natural number from 1 to 4.
  • dsFv form is a disulfide-linked variable fragment, similar to scFv in that the variable region is connected, but refers to a recombinant domain in which the VH and VL regions are connected by a disulfide bond rather than a linker.
  • (dsFv) 2 form means a recombination domain in which two dsFvs are connected by a linker.
  • the antigen binding region may be linked to one or more of the C-terminus and the N-terminus of each chain of the Fc region, and preferably may be linked to one or more of the N-terminus of each chain.
  • Each connection may be formed by a hinge or linker.
  • the binding domain protein may include a receptor-derived protein.
  • the receptor is a polypeptide capable of binding to one or more ligands, and is interpreted as meaning including various cell surface receptors, cytokine receptors, immune cell receptors, and the like, and may be, for example, a soluble T cell receptor.
  • the receptor-derived protein may refer to all, part, or variants of the receptor protein, and may preferably include a receptor protein derived from an extracellular domain (ectodomain).
  • the binding domain protein is not limited to the above examples, and a protein capable of binding to a target molecule may be selected and used according to the purpose.
  • heterodimer of the present invention can be used as a bispecific or multispecific antibody capable of binding to two or more target proteins.
  • the bispecific antibody is obtained by linking an antigen-binding domain that binds to a target antigen to one chain of the Fc region and a domain that binds to an immune cell-activating receptor to the other chain.
  • a bispecific antibody can induce apoptosis of a target antigen by antibody dependent cellular cytotoxicity (ADCC) by simultaneously binding to a target antigen and an immune cell-activated receptor.
  • ADCC antibody dependent cellular cytotoxicity
  • the bispecific antibody of the present invention may be IL-1 alpha, IL-1 beta, IL-1R, IL-4, IL-5, IL-6R, IL-9, IL-12, IL-13, IL-18, IL-18R, IL-25, TARC, MDC, MEF, TGF- ⁇ , LHR agonist, TWEAK, CL25, SPRR2a, SPRR2b, ADAM8, PED2, TNF alpha, TGF beta, VEGF, MIF, ICAM-1 , PGE4, PEG2, RANK ligand, Te38, BAFF, CTLA-4, GP130, HER1, HER2, HER3, HER4, VEGF-A, PDGF, VEGF-A, VEGF-C, VEGF-D, DR5, MET, EGFR, MAPG, CSPGs, CTLA-4, IGF1, IGF2, Erb2B, MAG, RGM A, NogoA, NgR, OMGp, PDL-I, N
  • one or more drugs may be conjugated to the heterodimer to form an antibody-drug conjugate (ADC).
  • ADC antibody-drug conjugate
  • the drug may be linked to the C-terminus and/or N-terminus of each chain, as well as to one or more residues of amino acids within the chain.
  • the drug may be conjugated using an appropriate linker.
  • drug compounds, growth inhibitors, toxins, radioactive isotopes, miRNA, siRNA, shRNA, and the like known in the art may be used.
  • drug efficacy can be improved by directing the drug to the target antigen.
  • a drug when a drug is attached to an antibody that binds to a specific receptor, the drug can be induced to be delivered into tissues using transcytosis of the antibody through the receptor.
  • the antibody when a protein derived from the antigen-binding region of an antibody for transferrin receptor is linked to the Fc region of the antibody and a therapeutic protein or drug is additionally conjugated, the antibody can pass through the blood-brain barrier through transcytosis. Through this, it is possible to improve the delivery efficiency of therapeutic proteins or drugs that are difficult to pass through the blood-brain barrier.
  • the heterodimer of the present invention can be prepared by expressing an expression vector containing a polynucleotide sequence encoding the amino acid sequence in a host cell.
  • the method for producing the heterodimer includes preparing one or more expression vectors encoding the heterodimer; and obtaining a protein by expressing the expression vector in a host cell.
  • polynucleotide is interpreted as meaning including polymers of deoxyribonucleotides or ribonucleotides in single-stranded or double-stranded form.
  • the polynucleotide may be generated by changing the polynucleotide sequence encoding the wild-type Fc chain according to the Fc variant sequence of the present invention, and the polynucleotide encoding the signal peptide, hinge, linker, histidine tag, etc. of each chain It may further contain nucleotides.
  • heterodimer when the heterodimer includes other proteins linked to the Fc chain (e.g., antigen binding region, binding domain protein such as a therapeutic protein), it is prepared using a polynucleotide sequence encoding the entire amino acid sequence including the heterodimer. can do.
  • proteins linked to the Fc chain e.g., antigen binding region, binding domain protein such as a therapeutic protein
  • An expression vector is for expressing a gene of interest in a host cell, and may contain various components depending on its role and host cell.
  • a vector includes a signal sequence recognized and processed by a host cell, an origin of replication, a marker gene, a promoter to which transcriptional regulators bind, an enhancer to increase DNA transcription, a ribosome binding site, a transcription termination sequence, and the like. It can, but is not limited thereto.
  • a nucleic acid encoding each chain of the heterodimer that is, a polynucleotide
  • an expression vector can be constructed using the obtained nucleic acid.
  • the expression vector may include a polynucleotide sequence encoding the amino acid sequence of the first Fc chain and a polynucleotide sequence encoding the amino acid sequence of the second Fc chain.
  • each polynucleotide sequence may be included in the same vector or separate vectors.
  • the expression vector may further include, in addition to the polynucleotide sequence encoding each Fc chain, a polynucleotide sequence encoding another polypeptide and/or protein that can be linked to the Fc heterodimer.
  • a polynucleotide sequence encoding another polypeptide and/or protein that can be linked to the Fc heterodimer may be used.
  • the expression vector comprises a first expression vector comprising a polynucleotide sequence encoding an amino acid sequence of a first Fc chain, and a polynucleotide sequence encoding an amino acid sequence of a second Fc chain.
  • a second expression vector may be included.
  • a desired protein can be obtained by expressing it in a host cell.
  • the host cell may be transfected with an expression vector (transfection, transfection) and then cultured to express the protein.
  • the host cell may be selected by empirically determining which is suitable for use in the present invention, using commercial techniques known in the art. For example, Chinese hamster ovary (CHO) cells, baby hamster kidney cells (BHK), monkey kidney cells (COS), E. coli cells, and the like can be used as the host cells.
  • CHO Chinese hamster ovary
  • BHK baby hamster kidney cells
  • COS monkey kidney cells
  • E. coli cells and the like can be used as the host cells.
  • each expression vector when the expression vector includes a first expression vector and a second expression vector, each expression vector may be injected into individual host cells to be expressed. Alternatively, it is also possible to co-express by injecting each expression vector into the same host cell.
  • proteins can be isolated from the cells. Specifically, by centrifuging the cultured cells, a cell culture medium containing the protein of interest can be obtained. Thereafter, a process of separating and purifying proteins from the culture medium may be performed. Affinity chromatography, gel electrophoresis, etc. can be used for the separation, and additional chromatography, SDS-PAGE, etc. can be used for purification.
  • a heterodimer when the first expression vector and the second expression vector are respectively expressed, a heterodimer may be formed by mixing the isolated proteins.
  • the heterodimer of the present invention ie, the Fc heterodimer of the present invention and fusion proteins using the same, bispecific antibodies, multispecific antibodies, and antibody-drug conjugates
  • the present invention may provide a pharmaceutical composition for preventing or treating a disease including the heterodimer.
  • the disease to be prevented or treated by the pharmaceutical composition of the present invention may be determined according to the type of binding domain protein and/or drug linked to the Fc region in the heterodimer.
  • the pharmaceutical composition of the present invention may include a pharmaceutically acceptable carrier other than the heterodimer.
  • the pharmaceutically acceptable carrier is one commonly used in formulation, and includes lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like.
  • the pharmaceutical composition of the present invention may further include lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, and the like, in addition to the above components.
  • composition of the present invention can be administered orally or parenterally, and in the case of parenteral administration, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, etc. can be administered with
  • the pharmaceutical composition of the present invention is prepared in unit dosage form by formulating it using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by those skilled in the art, or It can be prepared by incorporating into a dose container.
  • the pharmaceutical composition may be formulated in the form of a sterile injection solution, a lyophilized formulation, a pre-filled syringe solution, an oral formulation, an external preparation, or a suppository according to conventional methods.
  • the oral composition may be formulated to coat the active agent or to protect it from degradation in the stomach.
  • the pharmaceutical composition of the present invention may further include at least one other therapeutic or diagnostic agent.
  • interferons for example, anti-S protein monoclonal antibodies, anti-S protein polyclonal antibodies, nucleoside analogs, DNA polymerase inhibitors, siRNA preparations, or therapeutic vaccines may be further included together with the heterodimer. .
  • a suitable dosage may be prescribed in various ways depending on factors such as formulation method, administration method, patient's age, weight, sex, medical condition, food, administration time, administration route, excretion rate and reaction sensitivity.
  • the daily dosage of the pharmaceutical composition of the present invention may be 0.001 to 100 mg/kg.
  • the present invention also relates to the treatment of diseases, including the step of administering the heterodimer of the present invention (ie, the Fc heterodimer of the present invention and fusion proteins using the same, bispecific antibodies, multispecific antibodies and antibody-drug conjugates). Preventive or therapeutic methods may be provided.
  • the heterodimer of the present invention ie, the Fc heterodimer of the present invention and fusion proteins using the same, bispecific antibodies, multispecific antibodies and antibody-drug conjugates.
  • Preventive or therapeutic methods may be provided.
  • the disease to be prevented or treated is cancer such as breast cancer, colorectal cancer, lung cancer, renal cell carcinoma, glioma, or ovarian cancer; allergic or inflammatory diseases; It may be an autoimmune disease or the like, but is not limited thereto.
  • the type of disease to be prevented or treated may vary depending on the binding domain protein and/or drug linked to the Fc region. For example, a dual binding domain protein binding to HER2 is linked to the Fc region of the heterodimer of the present invention Using specific or multispecific antibodies can be used for the treatment of breast cancer, colorectal cancer, lung cancer, renal cell carcinoma, glioma, or ovarian cancer.
  • the heterodimer or pharmaceutical composition of the present invention may be administered to a subject in need thereof, that is, a subject having a corresponding disease or at risk of developing the disease.
  • the subject may be an animal, typically a mammal, for example a human.
  • Coot a structural modeling program, was used for mutation of residues, and after energy minimization of the structure of the entire Fc dimer including the mutated residues using the same program, collisions of hydrophobic residues and degree of domain positional modification Back structural deformation was analyzed.
  • An expression vector was constructed based on pcDNA 3.1 / Myc His-A (Invitrogen) to have a polyhistidine tag at the C-terminus of the protein.
  • a polynucleotide encoding the amino acid sequence of the variant is designed, amplified by PCR technique, and then digested with restriction enzymes and ligases. cloned. Through this, an expression vector expressing an Fc region protein including a signal peptide of a human immunoglobulin G1 (IgG1) heavy chain was constructed.
  • IgG1 human immunoglobulin G1
  • the first Fc chain (Fc chain 1) expression vector was constructed by changing the nucleotide sequence to induce the T366W / K360E mutation
  • the second Fc chain (Fc chain 2) expression vector was T366S / L368A / Y407V / Q347R mutation It was prepared by introducing a nucleotide sequence that causes.
  • the amino acid sequence encoded by each expression vector is shown in FIG. 2 .
  • 2A and 2B show the amino acid sequence (a) (SEQ ID NO: 4) encoded by the chain 1 expression vector and the amino acid sequence (b) (SEQ ID NO: 5) encoded by the chain 2 expression vector, respectively. Regions corresponding to IgG1 221-447 are underlined, and mutated residues are marked with asterisks. Other signal peptides, restriction enzyme recognition sites and histidine tag regions are not indicated.
  • ExpiCHOTM cells were transfected with the expression vector of Preparation Example 1 to transiently express each protein.
  • the transfection was carried out under conditions of an initial cell density of 6 x 10 6 cells/mL and an expression vector concentration of 0.8 ⁇ gDNA/mL.
  • ExpiCHOTM Expression Medium OptiPROTM SFM, and ExpiFectamineTM transfection kit (Gibco) were used. It was used according to the manufacturer's instructions.
  • transfected cells After culturing the transfected cells in a carbon dioxide incubator for 8 days, they were separated into cell culture medium and cells containing each protein by centrifugation.
  • affinity chromatography was performed using a Ni-NTA (Qiagen) column.
  • the culture medium obtained through centrifugation was filtered through 0.45 ⁇ m filter paper and introduced. After the reaction with the culture medium, the column was washed sequentially with a buffer solution containing 50 mM Tris-HCl pH 7.5 and 500 mM NaCl and a buffer solution containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl and 30 mM imidazole.
  • proteins bound to the column were eluted using a buffer solution containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl, and 500 mM imidazole. After elution, the composition of the buffer containing the protein was changed to phosphate buffered saline (PBS) using a HitrapTM Desalting (GE healthcare) column.
  • PBS phosphate buffered saline
  • refinement result item result reflector 14318 (1166) number of atoms excluding hydrogen protein 6642 non-protein 348 R-work (%) 22.6 R-free (%) 25.5 RMS Length ( ⁇ ) 0.006 angle (°) 1.14 Ramachandran Plot (Ramachandran plot) Favored (%) 95.1 Allowed (%) 4.9 Outliers (%) 0
  • FIGS. 3a and 3b structural models of the interchain hydrophobic interaction site (a) and the charge pair interaction site (b) are shown in FIGS. 3a and 3b, respectively.
  • the Fc variant according to one embodiment of the present invention was compared with the wild-type IgG1 Fc region (WT Fc) and the Fc heterodimers of the prior art, EW-RVT Fc and KiH Fc, through experimental examples.
  • the EW-RVT Fc is a heterodimer in which K409W/K360E mutations are formed in one chain of WT Fc and F405T/D399V/Q347R mutations are formed in the other chain.
  • the KiH Fc is a heterodimer in which the T366W mutation is formed in one chain of the WT Fc and the T366S/L368A/Y407V mutation is formed in the other chain.
  • FIG. 4 The structure of the Fc region composed of WER heterodimer (WER Fc), the wild-type Fc region (WT Fc), and the Fc region of EW-RVT heterodimer (EW-RVT Fc) is shown in FIG. 4 .
  • the structure indicated in magenta is WER Fc
  • the structure indicated in green is WT Fc
  • the structure indicated in cyan is EW-RVT Fc.
  • each Fc structure was overlapped using an A-chain (corresponding to the second Fc chain), and the degree of twisting of the structure of the B-chain (corresponding to the first Fc chain) was compared.
  • the WER Fc of the present invention does not change much, and it can be confirmed that it is structurally very similar to the Fc region of WT. Accordingly, it was found that the amino acid mutation of the present invention hardly causes structural modification of the Fc region.
  • FIGS. 5a and 5b A structural comparison (a) of WER Fc and WT Fc and a structural comparison (b) of EW-RVT Fc and WT Fc are shown in FIGS. 5a and 5b, respectively, targeting only the B-chain region among the structures of FIG.
  • WER has little difference in structure between WT and CH2 domains
  • EW-RVT has a significantly lower structural similarity with WT due to structural displacement.
  • the RMS deviation of chain B was calculated to compare the twisting of the structure of the other chain (chain B, corresponding to the first Fc chain) that was not used for tertiary structure overlap.
  • the WER Fc of the present invention has a very high structural similarity with the WT Fc compared to the EW-RVT Fc.
  • a fusion protein containing the Fc heterodimer was prepared, and the yield was measured by performing SDS-PAGE analysis.
  • an expression vector encoding a protein having a rabbit antibody variable region in the heavy (HC) and light (LC) chains of a human antibody was designed, and co-expression (co-expression) with a vector encoding a human antibody Fc (hFc) was performed. expression) to prepare a fusion protein.
  • Human antibody kappa light chain and heavy chain IgG1 genes were purchased from the Korea human gene bank (clone ID: hMU013040, hMU014012).
  • cDNA encoding the rabbit antibody variable region was obtained from an expression control vector for CHO expression system (Thermo Fisher Scientific).
  • a nucleotide encoding the human/rabbit chimeric antibody and a nucleotide encoding the human antibody Fc (hFc) were obtained by PCR amplification with primers containing EcoRV and AgeI restriction enzymes.
  • the PCR product and the pcDNA 3.1-Myc His A vector were cut with EcoRV and AgeI restriction enzymes for 1 hour at 37°C, purified with a 1% agarose gel, and then purified with T4 linking enzyme (Enzynomics Co., Ltd.) Mixed for 1 hour at room temperature. Then, TOP competent cells (Thermo Fisher Scientific) were transformed with the ligase reaction product. After cloning, a WER, EW-RVT or KiH mutation was introduced into the CH3 domain of the antibody as an Fc mutation for heterodimer formation.
  • An expression vector encoding a protein having a rabbit antibody variable region in the heavy and light chains of a human antibody into which the Fc mutation was introduced and an expression vector encoding only the human antibody Fc into which the Fc mutation was introduced were prepared by CHO in the same manner as in Preparation Example 2-1. Cells were transfected. The total amount of vector used for transfection was maintained the same, but the ratio was adjusted by adding an excessive amount of a vector encoding a light chain protein with a low expression level.
  • the yield was about 57% when using the KiH mutation, and the yield was about 70% in the case of EW-RVT.
  • the yield was about 98%, and it was confirmed that the yield of the heterodimer was far superior to that of conventional Fc variants.
  • CH3 variants A and B Two Fc CH3 domain mutation sets (CH3 variants A and B) of different combinations were additionally designed in consideration of heterodimer production yield and structural modification minimization, and heterodimeric proteins were prepared by introducing them.
  • an expression vector encoding a human IgG1 Fc region into which a CH3 domain mutation of the first Fc chain has been introduced and an antibody into which a CH3 domain mutation of the second Fc chain has been introduced are prepared.
  • Expression vectors encoding the heavy chain (HC) and light chain (LC) were designed respectively.
  • first Fc chain expression vector of each variant were constructed based on pcDNA 3.1. Based on the polynucleotide sequence encoding 221 to 446 of IgG1 (according to EU numbering in Kabat literature), the first Fc chain expression vector of CH3 variant A is the amino acid sequence of the Fc chain containing the T366W / Q347R mutation (SEQ ID NO: 6), and the nucleotide sequence of the first Fc chain expression vector of CH3 variant B was changed to encode the amino acid sequence (SEQ ID NO: 8) of the Fc chain including the T366W/Q347R/K360R mutation. After amplifying them by PCR technique, they were produced through overlapping using NEBuilder HiFi DNA assembly kit (NEB). Through this, an expression vector expressing the first Fc chain protein of each CH3 variant including the signal peptide of human serum albumin was prepared.
  • NEB NEBuilder HiFi DNA assembly kit
  • an expression vector encoding the heavy chain (HC) and light chain (LC) of the antibody including the second Fc chain of each of the CH3 variants A and B was prepared by pTRIOZ (Invivogen). made based on it.
  • the heavy and light chain sequences of the antibody were designed to include the variable region sequences of the anti-PD-1 antibody described in Applicant's International Publication No. WO 2022/169274 (incorporated herein by reference).
  • the IgG1 Fc region of the heavy chain sequence including the second Fc chain of each variant is based on the polynucleotide sequence encoding 221 to 446 of IgG1 (according to EU numbering in Kabat literature), the second Fc chain of CH3 variant A
  • the nucleotide sequence was changed to encode an antibody comprising the amino acid sequence (SEQ ID NO: 7) containing the K360E/T366S/L368A/Y407V mutation
  • Q347E/K360E /T366S/L368A/Y407V was prepared by changing the nucleotide sequence to encode an antibody comprising an amino acid sequence (SEQ ID NO: 9) including mutations.
  • each antibody herein heavy chain variant and light chain
  • the signal peptide of human serum albumin and the second Fc chain protein of each CH3 variant
  • the light chain amino acid sequence refers to SEQ ID NO: 10.
  • SEQ ID NOs: 11 and 12 For the entire heavy chain amino acid sequence introduced with the second Fc chain mutation of CH3 variant A or B, see SEQ ID NOs: 11 and 12, respectively.
  • the first Fc chain expression vector and the second Fc chain expression vector (ie, antibody expression vector) for each of the CH3 variants A and B prepared in Experimental Example 4-1 were co-transfected into ExpiCHO cells to express proteins.
  • the transfection was performed under conditions of an initial cell density of 6 x 10 6 cells/mL and an expression vector concentration of 0.8 ⁇ g DNA/mL in total.
  • ExpiCHO TM Expression Medium, OptiPRO TM SFM, and ExpiFectamine TM transfection kit (Gibco) was used according to manufacturer instructions.
  • the amount of the total expression vector used for transfection was maintained the same, but the ratio was adjusted by adding an excessive amount of an expression vector encoding an antibody protein with a low expression level (approximately 1:4).
  • the transfected cells were cultured for 18 hours at 37°C, 8% CO 2 conditions, and then treated with ExpiCHO TM Feed and ExpiCHO TM Enhancer according to the transfection kit (Gibco) manufacturer's instructions, and then 32°C, 5% CO 2 cultured under the condition.
  • the cell culture medium and cells containing each protein were separated by centrifugation, and the cell viability at this time was 75% or more.
  • Affinity chromatography was performed using Pierce® Protein A Agarose resin (Thermo Scientific TM ) to separate target proteins from the culture medium containing each recombinant protein.
  • the culture medium from which aggregates and cell-derived impurities were removed was added to the resin equilibrated with 10CV (column volume) of Protein A IgG Binding Buffer (Thermo Scientific TM ) by centrifugation at 13000 xg. Thereafter, the resin was washed sequentially with 10CV of Protein A IgG Binding Buffer (Thermo Scientific TM ) and 1CV of IgG Elution buffer (Thermo Scientific TM ), and then protein was eluted using 3CV of IgG Elution buffer (Thermo Scientific TM ). . To neutralize the pH of the eluted protein to 7.4, 1M Tris pH 8.5 corresponding to 1/10 the volume of the IgG Elution buffer used for elution was added to the eluted protein.
  • Some of the eluted proteins were concentrated to 1 mg/mL using an Amicon tube (Merck, MWCO: 3K) to check the yield of heterodimeric protein.
  • Another fraction of the eluted proteins was separated and purified from heterodimeric proteins using a size exclusion chromatography column to measure FcRn binding and Tm. Specifically, purification was performed using AKTA york 25 FPLC, and a HiLoad 16/600 Superdex 200 pg (Cytiva) column was used.
  • WRE variant CH3 domain, Fc region or heterodimer into which the mutation of CH3 variant A was introduced
  • WRREE variant CH3 variant of Example 3 of the present invention
  • expression vectors were constructed in the same manner as in Experimental Example 4, except that IgG1 wild-type Fc, KiH Fc, and EW-RVT Fc were used, and proteins were produced therefrom.
  • FIG. 7 is a schematic diagram of heterodimers produced when the first Fc chain expression vector and the second chain expression vector prepared in Experimental Example 4 were co-transfected for each of KiH, WER, WRE, and WRREE.
  • IgG1 wild-type Fc (Fc WT) in which no mutation has been introduced forms a homodimer.
  • Heterodimeric proteins including KiH Fc, EW-RVT Fc, WRE Fc or WRREE Fc produced in Experimental Example 4 were purified with Protein A and then subjected to size exclusion chromatography (Thermo Scientific TM , HPLC (Thermo Scientific TM , Vanquish VC-P20-A) analysis was performed using MAbPac TM SEC-1). PBS was used as an elution buffer and the process was performed at a flow rate of 0.7 mL/min.
  • KiH 1st chain expression vector Knob
  • 2nd chain expression vector Hole
  • the heterodimer production yield when the control variant of the prior art was introduced was approximately 64-70%, whereas the heterodimer production yield when the CH3 variant of Examples 2 and 3 of the present invention was introduced It was confirmed that the heterodimer production yield significantly improved to about 90 to 94%.
  • heterodimeric protein prepared according to Experimental Example 4 maintains its binding ability to FcRn compared to the wild-type homodimer, it was separated by FPLC using a size exclusion chromatography column. Heterodimeric proteins were analyzed using SRP (Surface Plasmon Resonance) equipment, Biacore 8K (Cytiva). Specifically, the FcRn protein diluted in 10 mM sodium acetate pH 5.0 was immobilized on a CM5 sensor chip (Cytiva) to a concentration of about 600 RU (response units).
  • the wild-type homodimer, the WRE heterodimer, and the WRREE heterodimer were diluted 2.5-fold at a concentration of 1500-2.5 nM in PBS (pH6.0) containing 0.005% Tween20 and flowed at a rate of 30 ⁇ L/min for 120 seconds to conduct a binding assay.
  • the dissociation assay was performed by flowing the same buffer solution without protein at a rate of 30 ⁇ L/min for 600 seconds.
  • Regeneration of the CM5 sensor chip was performed by flowing HBS-EP (pH 8.0) buffer solution at a rate of 30 ⁇ L/min for 60 seconds.
  • FIG. 11a to 11c show graphs in which affinity analysis was performed through steady-state RU based on sensorgrams obtained after analysis of binding and dissociation of each recombinant protein to FcRn.
  • the FcRn affinity calculated based on the sensorgram is shown in Table 5 below.
  • the WRE and WRREE heterodimers of the present invention maintain the same FcRn binding ability as the wild-type homodimer (IgG1 (Fc WT)) despite the introduction of mutations.
  • thermodynamic stability of the heterodimeric protein prepared according to Experimental Example 4 prepared according to Experimental Example 4, a differential scanning heat capacity analyzer (Differential Scanning Calorimetry (DSC), MicroCal PEAQ-DSC Automated (Malvern Panalytical) was used to measure the thermal transition midpoint (T m ). Thermodynamic denaturation was measured at a rate of 1 °C/min from 10 °C to 110 °C, and the measured value was corrected through the same composition buffer except for protein.
  • DSC differential scanning heat capacity analyzer
  • T m thermal transition midpoint
  • the WRE and WRREE heterodimers of the present invention maintain the same thermodynamic stability as the wild-type IgG1 homodimer (IgG1 Fc WT) despite the introduction of mutations (CH3 domain of WRE and WRREE heterodimers).
  • the midpoint of the thermal transition overlapped with the peak of Fab and was not specified the thermodynamic stability of the CH3 domain of WRE and WRREE heterodimers was similar to that of WT, since the change was not large compared to the midpoint of the Fab thermal transition of IgG1 Fc WT and appeared similar. can be known).
  • Immunogenicity computer virtual analysis was performed to analyze the possibility of increasing immunogenicity by the mutation introduced for heterodimer formation.
  • CD4 T cell immunogenicity prediction http://tools.iedb.org/CD4episcore/ ), an analysis system provided by IEDB Analysis Resource, was used.
  • IEDB recommended which predicts the 7-allele method and immunogenicity method together, was selected, and the maximum percentile rank threshold was selected as 50 to proceed with the analysis.
  • the wild-type Fc amino acid sequence of human IgG1 and the Fc amino acid sequence of WRE and WRREE heterodimers according to an embodiment of the present invention were used.
  • peptides indicate sites predicted to act as epitopes. Each score is a value that predicts the degree to which immunogenicity can be induced, and the lower the value, the higher the possibility of inducing immunogenicity.
  • the immunogenicity prediction analysis results of WRE Fc and WRREE Fc of the present invention are shown in Table 7 below.
  • the range of peptides likely to be epitopes in the sequences of WRE Fc and WRREE Fc was predicted to be the same as the analysis result of wild-type Fc of human IgG1 used as a control.
  • Immunogenicity is predicted to be low. Taken together, it was predicted that the possibility that mutations introduced into WRE Fc and WRREE Fc would cause additional or higher immunogenicity besides the immunogenicity possible by IgG1 wild type was very low.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법에 관한 것이다. 본 발명의 Fc 변이체에 따르면, 동일한 서열을 갖는 사슬 간에는 결합이 거의 형성되지 않고 상이한 서열을 갖는 사슬 간에는 결합력이 향상되어 이종이합체의 제조 수율을 현저하게 향상시킬 수 있다. 또한, 본 발명의 변이체는 변이에 의한 구조 변형을 최소화할 수 있으므로 야생형 Fc 영역과 구조적 유사성이 매우 우수하다. 이에 따라, 본 발명의 이종이합체 형성 기술을 이용하면 Fc 영역의 기능이 유지된 다양한 형태의 항체를 고수율로 제조할 수 있다.

Description

Fc 변이체를 포함하는 이종이합체 및 이의 제조방법
본 발명은 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법에 관한 것으로, 보다 상세하게는 야생형의 Fc 영역과 구조적 유사성이 우수하고 이종이합체의 수율이 높은 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법에 관한 것이다.
항체 치료제는 질병의 원인이 되는 항원 에피토프에 결합하는 항체를 이용하여 질병의 진행을 막는 작용 기전을 가지고 있다. 항체 치료제들은 표적 항원에 대한 높은 결합 특이성 및 인체 내 안정성으로 인하여 치료 효능이 우수하고 상대적으로 부작용이 작은 것으로 알려져 있으며, Adalimumab (상품명: Humira)를 비롯한 다수의 항체 치료제들이 큰 성공을 거둔 바 있다.
종래의 항체 치료제는 항원에 강하게 결합하여 치료 효능을 향상시키는 전략을 가지고 있는데, 항체 치료제의 적용 범위 및 효능을 더욱 증대시키기 위하여 하나의 항체가 두 개의 상이한 항원에 결합하도록 설계된 항체가 개발되었다. 이와 같이 두 종류의 항원에 결합할 수 있는 항체를 이중특이적 항체(bispecific antibody)라 한다.
이중특이적 항체를 이용하면 단일특이적 항체에 비해 특이적 항원 결합 부위를 추가로 가지고 있어 질병과 관련된 조직 또는 세포를 더욱 특이적으로 표적화할 수 있으며 내성에서 보다 자유롭고 치료 효과를 높일 수 있다. 또한, 이중특이적 항체는 표적 세포 및 면역 세포에 동시에 결합하도록 조작될 수 있어 표적 세포에 면역 세포를 근접하게 위치시킬 수 있으며 이에 따라 면역 세포의 활성화를 유도하여 효과적으로 표적 세포를 사멸시킬 수 있다. 이중특이적 항체 치료제의 대표적인 예로는 유럽 등록특허공보 제1315520호에 기재된 이중특이적 항체로서 EpCAM 항원과 T 세포의 CD3에 결합 가능한 Catumaxomab 항체가 있다. 이외에, HER2/neu 항원과 T 세포의 CD3에 결합 가능한 Ertumaxomab 항체 등 다양한 이중특이적 항체가 임상 시험 단계에 있다.
그런데 자연에 존재하는 항체는 동일한 아미노산 서열을 가진 두 개의 중쇄와 동일한 서열을 가진 두 개의 경쇄가 조합된 형태로 존재하여 하나의 항원에 결합하는 구조를 가지며, 이중특이적 항체를 제조하기 위해서는 화학공학 또는 생명공학적 기술을 이용하여 접합체를 형성하여야 한다.
이러한 이중특이적 항체의 제조에 있어서, 원하는 항체를 고수율로 수득하기 위해서는 동일한 항원결합부를 갖는 사슬 간에는 결합이 형성되지 않고 상이한 항원결합부를 갖는 사슬 간에만 결합이 형성되도록 설계하는 것이 중요하다. 이에 따라 동일한 사슬 간의 반발력 및 상이한 사슬 간의 결합력을 향상시킬 수 있도록, Fc 영역의 CH3 도메인에 변이체를 도입한 Fc 이종이합체 형성 기술이 개발되었다.
Fc 영역에 이종이합체를 형성하기 위한 대표적인 기술로는 놉-인투-홀(knob-into-hole, KiH) 기술이 있다. 상기 KiH 방식에서는 CH3 도메인의 소수성 상호작용 영역에서 한쪽 사슬에서는 곁가지의 크기가 큰 아미노산을 곁가지의 크기가 작은 아미노산으로 치환하고, 다른 쪽 사슬에서는 작은 아미노산을 큰 아미노산으로 치환하는 변이를 이용한다. 예를 들어, 미국 등록특허공보 제8,216,805호에서는 T366을 Y, W의 큰 잔기로 치환하고, 반대 사슬의 Y407, T394, T366 등을 T, A 등의 작은 잔기로 치환한 형태의 헤테로머 폴리펩티드를 기재하고 있다. 그런데, KiH 방식의 경우 Fc 이종이합체의 수율이 약 60% 정도로 개선이 필요하였다.
제조 수율의 향상을 위한 새로운 변이체 기술로서, Fc 영역에 전하 및 소수성 아미노산 변이를 도입한 EW-RVT 변이체가 제안된 바 있다. 상기 변이체는 KiH에 비해 수율 개선에 효과를 보였으나, 삼차구조를 분석한 결과 돌연변이된 잔기의 구조적 충돌로 인하여 Fc 영역의 CH2 및 CH3 도메인의 삼차구조에 변형이 나타나는 것으로 확인되었다.
항체의 Fc 영역은 면역 세포와 결합하여 면역 반응을 유도하는 특성을 나타내며 항체의 반감기를 증가시켜 혈장 내 항체의 안정성을 조절하는 역할을 하는데, 상기와 같이 Fc 영역에 구조 변형이 일어나는 경우 야생형과의 구조적 유사성이 떨어지게 되어, Fc 영역의 기능이 저하되는 문제가 발생할 수 있다. 이러한 Fc 영역의 기능 저하 문제를 방지하기 위해서는 야생형 Fc 영역과 구조적 유사성이 우수한 변이체를 설계하는 것이 중요하다.
따라서, 높은 수율로 이종이합체를 수득할 수 있으면서 야생형과 비교하여 구조적 변형을 최소화할 수 있는 이종이합체 형성 기술의 개발이 요구되고 있다.
본 발명의 목적은 야생형 Fc 영역과 구조적 유사성이 높고 이종이합체 제조 수율이 우수한 Fc 변이체를 포함하는 이종이합체를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 이종이합체를 제조하는 방법을 제공하는 것이다.
상기 목적을 달성하기 위하여, 본 발명은 야생형 면역글로불린의 Fc 영역의 변이체, 구체적으로 CH3 도메인의 변이체를 포함하는 이종이합체를 제공한다.
본 발명의 일 측면에서, 본 발명의 이종이합체는 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366에서의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환을 포함하며, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 어느 한 도메인은 K360에서의 아미노산 치환을 더 포함하고, 다른 한 도메인은 Q347에서의 아미노산 치환을 더 포함한다.
본 발명에 있어서, CH3 도메인의 아미노산 번호는 KABAT 문헌[Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Ed., NIH Publication, 1991]의 EU 넘버링을 기준으로 한다.
본 발명의 일 측면에서, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 K360에서의 아미노산 치환을 포함하는 도메인은 Q347에서의 아미노산 치환을 더 포함할 수 있다. 본 발명의 일 측면에서, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 Q347에서의 아미노산 치환을 포함하는 도메인은 K360에서의 아미노산 치환을 더 포함할 수 있다. 본 발명의 일 측면에서, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 K360에서의 아미노산 치환을 포함하는 도메인이 Q347에서의 아미노산 치환을 더 포함하고, Q347에서의 아미노산 치환을 포함하는 도메인이 K360에서의 아미노산 치환을 더 포함할 수 있다.
본 발명의 일 측면에서, 상기 제1 CH3 도메인 및/또는 제2 CH3 도메인의 K360 및/또는 Q347에서의 아미노산 치환은 생리학적 pH에서 양전하 또는 음전하를 띠는 아미노산으로의 치환을 포함한다.
본 발명의 일 측면에서, 본 발명의 이종이합체는 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366에서의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환을 포함하며, 상기 제1 CH3 도메인 및 제2 CH3 도메인은 각각 K360 및 Q347 중 하나 이상에서의 아미노산 치환을 더 포함하되,
상기 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있는 경우, 다른 한 도메인의 K360은 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있고, 이 때 상기 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있는 도메인은 K360에서 생리학적 pH에서 양전하를 띠는 아미노산으로의 치환을 더 포함할 수 있고, 상기 K360이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 다른 한 도메인은 Q347에서 생리학적 pH에서 음전하를 띠는 아미노산으로의 치환을 더 포함할 수 있거나, 또는
상기 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 경우, 다른 한 도메인의 K360은 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 이 때 상기 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 도메인은 K360에서 생리학적 pH에서 음전하를 띠는 아미노산으로의 치환을 더 포함한다.
예를 들어, 본 발명의 이종이합체에서 제1 CH3 도메인과 제2 CH3 도메인은 Q347과 K360에서 각각 다음과 같은 아미노산 치환을 포함할 수 있다:
(a) 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 다른 한 도메인의 K360이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있거나,
(b) 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 다른 한 도메인의 K360 및 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있거나,
(c) 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347 및 K360이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 다른 한 도메인의 K360이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있거나,
(d) 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347 및 K360이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 다른 한 도메인의 K360 및 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있거나,
(e) 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347 및 K360이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있고, 다른 한 도메인의 K360이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있음.
본 발명의 일 측면에서, 본 발명은 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366 및 K360에서의 아미노산 치환을 포함하고, 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 Q347에서의 아미노산 치환을 포함하는 이종이합체를 제공한다.
본 발명의 일 측면에서, 본 발명은 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366 및 Q347에서의 아미노산 치환을 포함하고, 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 K360에서의 아미노산 치환을 포함하는 이종이합체를 제공한다.
본 발명의 일 측면에서, 본 발명은 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366, K360 및 Q347에서의 아미노산 치환을 포함하고, 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 K360 및 Q347에서의 아미노산 치환을 포함하는 이종이합체를 제공한다.
본 발명의 일 측면에서, 상기 제1 CH3 도메인은 T366W의 아미노산 치환을 포함하고, 제2 CH3 도메인은 T366S, L368A 및 Y407V의 아미노산 치환을 포함할 수 있다.
본 발명의 일 측면에서, 상기 제1 CH3 도메인 및 제2 CH3 도메인은 각각 K360E, K360D, K360R, Q347E, Q347D, Q347R 및 Q347K로 이루어진 군에서 선택된 하나 이상의 아미노산 치환을 포함할 수 있다. 이 때, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 어느 한 도메인이 Q347E 또는 Q347D의 아미노산 치환을 포함하는 경우, 다른 도메인의 아미노산 위치 360번의 라이신(K)은 치환되지 않을 수 있다. 이 때, Q347E 또는 Q347D의 아미노산 치환을 포함하는 도메인은 K360E 또는 K360D의 아미노산 치환을 추가로 포함하는 것이 바람직하다. 또한, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 어느 한 도메인이 K360에서의 아미노산 치환을 포함하지 않으면서 Q347에서의 아미노산 치환을 포함하는 경우, 상기 Q347에서의 아미노산 치환은 양전하를 띠는 아미노산으로의 치환이 바람직하다.
본 발명의 일 측면에서, 상기 이종이합체는 상기 CH3 도메인이 IgG, IgM, IgA, IgD 및 IgE로 이루어진 군으로부터 선택된 면역글로불린에 포함될 수 있으며, 바람직하게는 IgG, 더욱 바람직하게는 인간 IgG에 포함될 수 있다.
본 발명의 일 측면에서, 상기 이종이합체는 상기 제1 폴리펩티드 및 제2 폴리펩티드 중 하나 이상의 폴리펩티드에 연결된 하나 이상의 결합 도메인 단백질을 더 포함할 수 있다. 이 때, 상기 연결은 직접 연결, 또는 1 내지 50개의 아미노산으로 구성된 펩티드에 의한 연결일 수 있다.
본 발명의 일 측면에서, 상기 결합 도메인 단백질은 항체의 항원 결합 영역, 수용체 유래 단백질, 사이토카인 및 호르몬으로 구성된 군에서 선택되는 1종 이상일 수 있다.
본 발명의 일 측면에서, 상기 항원 결합 영역은 Fab, scFab, sdAb, scFv, di-scFv 또는 (dsFv)2 형태일 수 있다.
본 발명의 일 측면에서, 상기 이종이합체는 2개 이상의 표적 단백질에 결합 가능한 이중특이적 또는 다중특이적 항체, 또는 이중특이적 또는 다중특이적 융합 단백질일 수 있다.
본 발명의 일 측면에서, 상기 이종이합체에 하나 이상의 약물이 접합될 수 있다.
본 발명의 또다른 측면은 또한, 상기 이종이합체를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드를 포함하는 발현 벡터를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드 또는 이를 포함하는 발현 벡터를 포함하는 숙주 세포를 제공한다.
본 발명은 또한, 상기 이종이합체를 제조하는 방법을 제공한다.
본 발명의 일 측면에서, 상기 이종이합체 제조방법은 상기 이종이합체를 코딩하는 1종 이상의 발현 벡터를 준비하는 단계; 및 상기 발현 벡터를 숙주 세포에서 발현시키고 단백질을 수득하여 이종이합체를 형성하는 단계를 포함할 수 있다.
본 발명의 제조방법에서, 상기 발현 벡터는 제1 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열 및 제2 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 포함할 수 있다.
본 발명의 예시적인 실시태양에서, 상기 발현 벡터는 제1 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 포함하는 제1 발현 벡터, 및 제2 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 포함하는 제2 발현 벡터를 포함할 수 있다.
본 발명의 예시적인 실시태양에서, 상기 제1 발현 벡터 및 제2 발현 벡터를 숙주 세포에서 각각 발현시켜 2종의 단백질을 수득하고 혼합 반응시켜 이종이합체를 형성할 수 있다.
본 발명의 예시적인 실시태양에서, 제1 발현 벡터 및 제2 발현 벡터를 숙주 세포에서 동시 발현시켜 이종이합체를 수득할 수 있다.
본 발명은 또한, 상기 이종이합체 또는 이를 포함하는 약학 조성물을 개체에게 투여하는 단계를 포함하는, 질병의 치료 방법을 제공한다.
본 발명의 Fc 변이체에 따르면, 동일한 서열을 갖는 사슬 간에는 결합이 거의 형성되지 않고 상이한 서열을 갖는 사슬 간에는 결합력이 향상되어, 이종이합체의 제조 수율을 현저하게 향상시킬 수 있다. 또한, 본 발명의 Fc 변이체는 변이에 의한 구조 변형을 최소화할 수 있으므로 야생형 Fc 영역과 구조적 유사성이 매우 우수하다. 따라서 본 발명의 이종이합체 형성 기술을 이용하면 Fc 영역의 기능이 유지된 다양한 형태의 항체를 고수율로 제조할 수 있다.
도 1은 본 발명의 일 실시태양에 따른 이종이합체로서, Fc 영역에 항원 결합 영역이 연결된 이종이합체의 구조를 개략적으로 나타낸 것이다.
도 2a 및 2b는 각각 본 발명의 일 실시태양에 따른 이종이합체의 제1 Fc 사슬(a) 및 제2 Fc 사슬(b)의 아미노산 서열을 나타낸 것이다.
도 3a 및 3b는 각각 본 발명의 일 실시태양에 따른 이종이합체에서, Fc 사슬 간 소수성 상호작용 부위(a) 및 전하쌍 상호작용 부위(b)의 구조 모델을 나타낸 것이다.
도 4는 본 발명의 일 실시태양에 따른 Fc 이종이합체, 종래 기술의 Fc 이종이합체 및 야생형 Fc 영역의 구조를 나타낸 것이다.
도 5a 및 5b는 각각 도 4의 구조에서 B-chain 영역만을 대상으로 하여, 본 발명의 일 실시태양에 따른 이종이합체와 야생형의 구조 비교(a) 및 종래 기술의 이종이합체와 야생형의 구조 비교(b)를 나타낸 것이다.
도 6은 본 발명의 일 실시태양에 따른 이종이합체 및 종래 기술의 이종이합체의 SDS-PAGE 결과를 나타낸 것이다.
도 7은 본 발명의 일 실시태양에 따른 이종이합체 및 종래 기술의 이종이합체의 구조를 개략적으로 나타낸 것이다.
도 8은 본 발명의 일 실시태양에 따라 Fc 영역의 한 사슬에 항원 결합 영역이 연결된 비대칭 구조의 이종이합체 형태를 제조하는 경우 발생 가능한 단백질 형태를 도시한 것이다.
도 9는 본 발명의 일 실시태양에 따른 CH3 변이체 또는 종래 기술의 CH3 변이체가 도입된 발현 벡터로부터 발현 및 정제된 재조합 단백질의 크기 배제 크로마토그래피(SEC)-HPLC 그래프 분석 프로파일이다.
도 10은 도 9의 SEC-HPLC 그래프 분석 프로파일로부터 얻어진 동종이합체, 이종이합체 및 단량체의 생성 비율을 나타낸 그래프이다.
도 11a, 11b 및 11c는 각각 야생형 IgG1 동종이합체(WT Fc)(a) 및 본 발명의 일 실시태양에 따른 이종이합체 2종(각각 WRE(b) 및 WRREE(c))에 대하여, FcRn에 대한 결합 및 해리 분석을 통해 얻어진 센소그람을 바탕으로 평형상태(steacy-state) RU를 통해 친화도 분석을 진행한 그래프이다.
도 12a, 12b 및 12c는 각각 야생형 IgG1 동종이합체(WT Fc)(a) 및 본 발명의 일 실시태양에 따른 이종이합체 2종(각각 WRE(b) 및 WRREE(c))의 시차주사 열용량 분석 결과 프로파일이다.
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명은 야생형 항체의 Fc 영역의 변이체, 구체적으로 CH3 도메인의 변이체를 포함하는 이종이합체에 관한 것이다.
이종이합체(heterodimer)는 서로 다른 두 개의 단량체(monomer)에 의해 형성되는 이합체(dimer)를 의미한다. 본 발명에서, 용어 "이종이합체"는 항체의 Fc 영역 또는 CH3 도메인이 아미노산 서열이 서로 다른 두개의 사슬로 형성되어 상호 결합된 단백질 복합체인 Fc 이종이합체 또는 CH3 이종이합체 뿐만 아니라, 이를 포함하는 항체의 일부 또는 전체, 그리고 상기 이종이합체에 다른 폴리펩티드 및/또는 단백질이 연결된 형태의 융합 단백질, 이중특이적 항체 및 다중특이적 항체와, 이들에 약물이 접합된 항체-약물 접합체 형태를 모두 포괄하는 의미로 해석된다.
본 발명의 이종이합체에서, Fc 영역의 각 사슬은 제1 Fc 사슬 및 제2 Fc 사슬로 구분될 수 있다. 또 다르게는, 본 발명의 이종이합체는 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드로 구분될 수 있다. 상기 제1 Fc 사슬(또는 제1 폴리펩티드) 및 제2 Fc 사슬(또는 제2 폴리펩티드)은 3차 구조를 형성할 수 있으며, 이들은 이황화 결합과 같은 공유 결합이나, 수소 결합, 이온 결합, 반데르발스 결합, 소수성 상호작용과 같은 비공유 상호작용에 의해 서로 상호작용할 수 있다.
본 발명에서, 용어 "항체"란 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린(immunoglobulin, Ig) 분자를 포함하며, 다클론항체 및 단일클론항체를 모두 포함한다. 또한, 상기 용어는 인간 이외의 포유동물 항체(예를 들면, 뮤린(murine) 항체), 키메라 항체, 인간화 항체, 인간 항체 및 이종결합항체(예를 들면, 이중특이적 항체)와 같은 유전공학에 의해 생산된 형태를 포함한다. 상기 면역글로불린은 IgG1, IgG2, IgG3, IgG4와 같은 IgG, IgA, IgE, IgD 또는 IgM일 수 있다.
본 발명에서, 용어 "Fc 영역"은 항체의 중쇄불변영역 중 CH2 및 CH3 도메인(또는, CH2, CH3 및 CH4 도메인)을 포함하는 C-말단 영역을 의미하며, 야생형(wild-type, WT) Fc 영역 및 그의 변이체를 포괄하는 의미로 사용된다. 본 발명에서, 상기 Fc 영역은 인간 IgG1 중쇄의 221번 잔기로부터 C-말단에 이르는 영역, 또는 상기 영역에 힌지를 더 포함하는 영역을 의미할 수 있다. Fc 영역에서 아미노산 잔기의 번호는 Kabat 문헌에서 인간 면역글로불린 중쇄 내의 잔기 번호를 정의하는 EU 넘버링에 따른다.
본 발명에서, 용어 "야생형 Fc 영역"은 자연에서 발견되는 면역글로불린의 Fc 영역의 아미노산 서열과 일치하는 아미노산 서열을 포함한다.
본 발명에서, 용어 "Fc 영역의 변이체"는 야생형 Fc 영역과 상이한 하나 이상의 아미노산 잔기를 포함하는 것으로서, "Fc 변이체"로 약칭할 수 있다. 본 발명에서, 상기 Fc 변이체는 모체가 되는 야생형 Fc 영역 서열과 약 80% 이상, 바람직하게는 약 90% 이상의 상동성을 가질 수 있다. 본 발명의 이종이합체에서, Fc 변이체는 각 사슬의 CH3 도메인에 서로 다른 변이체를 도입하여 형성된 것이다. 본 발명에서, 상기 "Fc 변이체"는 경우에 따라 CH2 도메인의 아미노산 변이를 추가로 포함할 수 있다.
본 발명에서, 용어 "CH3 도메인의 변이체"는 항체 중쇄의 야생형 CH3 도메인과 상이한 하나 이상의 아미노산 잔기를 포함하는 것으로서, "CH3 변이체"로 약칭할 수 있다. 본 발명에서, 상기 CH3 변이체는 야생형 CH3 도메인의 서열과 대략 95% 이상, 바람직하게는 96% 이상, 더욱 바람직하게는 97% 이상의 상동성을 가질 수 있다.
본 발명에서, 용어 "변이"는 아미노산 잔기의 치환, 삽입 및/또는 결실을 포함하는 의미로, 바람직하게, 본 발명의 변이체는 아미노산 잔기의 치환을 포함한다. 아미노산 잔기의 치환은 모체가 되는 야생형 항체의 Fc 영역에 존재하는 아미노산 잔기, 아미노산 잔기의 번호 및 치환된 아미노산 잔기의 순서로 나타낸다.
본 발명의 이종이합체에서, Fc 영역을 이루는 각 사슬은 제1 Fc 사슬 및 제2 Fc 사슬로 구분할 수 있으며, 각 사슬은 야생형 Fc를 모체로 하여 하나 이상의 변이를 포함한다. 이 때 두 사슬의 상호작용 부위에 서로 상보적인 변이를 도입하여, 동일한 사슬 간에는 결합이 형성되지 않도록 조절하여 이종이합체를 형성한다.
본 발명에서는 야생형 Fc와 구조적 유사성이 높고 수율이 우수한 Fc 이종이합체를 개발하기 위하여, 단백질 삼차구조 모델링을 통하여 야생형 Fc 이합체 상호작용 부위의 잔기들을 다양한 세트(set)로 돌연변이하고, 각 돌연변이 세트에 대해 삼차구조의 에너지 최소화 및 구조변형 분석을 통하여 구조변형 및 상호작용 에너지가 최적화된 세트를 탐색하는 방식으로 돌연변이를 설계하였다.
본 발명의 일 실시태양에서, 본 발명의 이종이합체는 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하고, 상기 제1 CH3 도메인은 T366에서의 아미노산 치환을 포함하며, 상기 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환을 포함하고, 상기 제1 CH3 도메인 및 제2 CH3 도메인은 각각 K360 및 Q347 중 하나 이상에서의 아미노산 치환을 더 포함한다.
본 발명의 일 실시태양에서, 상기 제1 폴리펩티드의 T366에서의 아미노산 치환은 트립토판(W), 티로신(Y), 아르기닌(R) 또는 페닐알라닌(F)으로의 치환일 수 있다. 바람직하게, 상기 T366에서의 아미노산 치환은 T366W일 수 있다.
본 발명의 일 실시태양에서, 상기 제2 폴리펩티드는 제1 폴리펩티드의 아미노산 위치 366번 잔기와 상호작용하기 위하여, T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환을 포함한다. 상기 제2 폴리펩티드에서, T366, L368 또는 Y407에서의 아미노산 치환은 각각 세린(S), 알라닌(A) 또는 발린(V)으로의 치환일 수 있다. 바람직하게, 상기 제2 폴리펩티드의 T366에서의 아미노산 치환은 T366S일 수 있으며, L368에서의 아미노산 치환은 L368A일 수 있고, Y407에서의 아미노산 치환은 Y407V일 수 있다.
본 발명의 일 실시태양에서, 상기 K360 또는 Q347에서의 아미노산 치환은 생리학적 pH(대략 pH 7.4)에서 양전하 또는 음전하를 띠는 아미노산으로의 치환을 포함한다. 본 발명에서, 생리학적 pH에서 양전하를 띠는 아미노산은 아르기닌(R), 라이신(K) 또는 히스티딘(H)을 포함한다. 생리학적 pH에서 음전하를 띠는 아미노산은 글루탐산(E) 또는 아스파르트산(D)을 포함한다.
본 발명의 일 실시태양에서, 상기 K360 또는 Q347에서의 아미노산 치환은 제1 CH3 도메인 및 제2 CH3 도메인 사이에서 서로 반대의 전하를 띠는 아미노산으로 각각 치환되어 양 도메인 사이에 정전기적 인력이 형성되도록 상호작용할 수 있다. 이러한 의미에서, 아미노산 위치 360번의 라이신(K)은 그 자체로 생리학적 pH에서 양전하를 띠므로 반대편 도메인의 Q347번에서의 아미노산 치환이 음전하를 띠는 아미노산으로의 변경인 경우 치환되지 않을 수 있다.
본 발명의 일 실시태양에서, 상기 K360에서의 아미노산 치환은 글루탐산(E), 아스파르트산(D), 히스티딘(H) 또는 아르기닌(R)으로의 치환일 수 있으며, 바람직하게는 K360E 또는 K360R일 수 있다.
본 발명의 일 실시태양에서, 상기 K360에서의 아미노산 치환을 포함하는 폴리펩티드 사슬의 아미노산 위치 360번 잔기와 상호작용하기 위하여, 다른 폴리펩티드 사슬은 Q347에서의 아미노산 치환을 포함한다. 상기 Q347에서의 아미노산 치환은 아르기닌(R), 라이신(K), 히스티딘(H), 글루탐산(E) 또는 아스파르트산(D)으로의 치환일 수 있으며, 바람직하게는 Q347R 또는 Q347E일 수 있다.
본 발명의 일 실시태양에서, 본 발명의 이종이합체는 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 어느 한 도메인이 Q347에서의 아미노산 치환을 포함하지 않는 경우, 다른 한 도메인은 K360에서의 아미노산 치환을 포함하지 않는 것이 바람직하다.
본 발명의 일 실시태양에서, 본 발명의 이종이합체는 상기 제1 CH3 도메인 및/또는 제2 CH3 도메인에서 Y349, D356, F405 및 K409 중 하나 이상에서의 아미노산 치환을 포함하지 않을 수 있다.
본 발명에서는, Fc 영역에서 소수성 계면이 충돌하지 않도록 소수성 잔기들을 조정하고 전하를 도입하여, 최적화된 소수성 계면으로 인해 구조 변형을 방지할 수 있으면서 Fc 이합체 형성의 수율을 높일 수 있는 변이체를 설계하였다.
따라서, 본 발명에 따르면 종래 Fc 이종이합체 형성 기술에 비해 높은 수율로 이종이합체를 수득할 수 있다. 또한, Fc 영역의 CH2 도메인은 Fc 수용체 등이 결합하여 면역활성화의 이펙터 기능을 일으키는 곳으로 CH2 도메인의 구조가 변하면 면역 이펙터 기능이 저하될 수 있는데, 본 발명에 따른 상기 변이체의 CH2 및 CH3 도메인은 야생형의 Fc와 구조적 유사성이 매우 우수하여 Fc 영역의 면역 이펙터 기능(effector function)을 유지할 수 있다. 아울러, Fc 영역에 의한 FcRn(neonatal Fc receptor) 결합 특성을 그대로 유지할 수 있어 혈장에서의 안정성 효과 또한 보존할 수 있다.
본 발명의 바람직한 일 실시태양에서, K360에서의 아미노산 치환은 제1 Fc 사슬에 형성될 수 있고, Q347에서의 아미노산 치환은 제2 Fc 사슬에 형성될 수 있다. 이에 따라, 제1 Fc 사슬은 T366 및 K360에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 Q347에서의 아미노산 치환을 포함할 수 있다. 더 바람직하게, 제1 Fc 사슬은 T366 및 K360에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368, Y407 및 Q347에서의 아미노산 치환을 포함할 수 있다.
본 발명의 바람직한 일 실시태양에서, 상기 제1 Fc 사슬이 T366W 및 K360E의 치환을 포함하고, 제2 Fc 사슬이 T366S, L368A, Y407V 및 Q347R의 치환을 포함할 수 있다. 본 발명에서, 상기 변이체를 "WER 변이체"로 명명한다.
상기 WER 변이체는 아래 인간 IgG1의 (Kabat 문헌의 EU 넘버링에 따름) 221 내지 447번 아미노산 서열을 모체로 하여 형성될 수 있다.
[서열번호 3] IgG1 221-447 (야생형 Fc)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
WER 변이체 사슬의 아미노산 서열은 아래 서열번호 1 및 2로 나타낼 수 있다.
[서열번호 1] IgG1 221-447 T366W/K360E (WER Fc mutant chain 1)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTENQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
[서열번호 2] IgG1 221-447 T366S/L368A/Y407V/Q347R (WER Fc mutant chain 2)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPRVYTLPPSRDELTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
본 발명의 바람직한 일 실시태양에서, Q347에서의 아미노산 치환은 제1 Fc 사슬에 형성될 수 있고, K360에서의 아미노산 치환은 제2 Fc 사슬에 형성될 수 있다. 이에 따라, 제1 Fc 사슬은 T366 및 Q347에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 K360에서의 아미노산 치환을 포함할 수 있다. 더 바람직하게, 제1 Fc 사슬은 T366 및 Q347에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368, Y407 및 K360에서의 아미노산 치환을 포함할 수 있다.
본 발명의 바람직한 일 실시태양에서, 상기 제1 Fc 사슬이 T366W 및 Q347R의 치환을 포함하고, 제2 Fc 사슬이 T366S, L368A, Y407V 및 K360E의 치환을 포함할 수 있다. 본 발명에서, 상기 변이체를 "WRE 변이체"로 명명한다(서열번호 6 및 7 참조).
본 발명의 바람직한 일 실시태양에서, 제1 Fc 사슬 및 제2 Fc 사슬은 K360 및 Q347에서의 아미노산 치환을 모두 가질 수 있다. 이에 따라, 제1 Fc 사슬은 T366, K360 및 Q347에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환 및 K360 및 Q347에서의 아미노산 치환을 포함할 수 있다. 더 바람직하게, 제1 Fc 사슬은 T366, K360 및 Q347에서의 아미노산 치환을 포함하고, 제2 Fc 사슬은 T366, L368, Y407, K360 및 Q347에서의 아미노산 치환을 포함할 수 있다.
본 발명의 바람직한 일 실시태양에서, 상기 제1 Fc 사슬이 T366W, K360R 및 Q347R의 치환을 포함하고, 제2 Fc 사슬이 T366S, L368A, Y407V, K360E 및 Q347E의 치환을 포함할 수 있다. 본 발명에서, 상기 변이체를 "WRREE 변이체"로 명명한다(서열번호 8 및 9 참조).
본 발명의 또다른 바람직한 실시태양에서, 상기 제1 Fc 사슬이 T366W, K360E 및 Q347E의 치환을 포함하고, 제2 Fc 사슬이 T366S, L368A, Y407V, K360R 및 Q347R의 치환을 포함할 수 있다. 본 발명에서, 상기 변이체를 "WEERR 변이체"로 지칭한다.
상기 본 발명의 바람직한 실시태양에 따른 변이체들에 의하면, Fc 영역에서 소수성 계면이 충돌하지 않도록 소수성 잔기들을 조정하고 전하를 도입하여, 최적화된 소수성 계면으로 인해 구조 변형을 최소화하고 Fc 이합체 형성의 수율을 현저히 향상시킬 수 있다.
따라서 이들 변이체를 이용하면 종래 Fc 이종이합체 형성 기술보다 높은 수율로 이중특이성 항체를 제조할 수 있다. 또한, 본 발명의 변이체는 야생형의 Fc와 구조적 유사성이 매우 우수하여 Fc 영역의 면역 이펙터 기능(effector function)을 유지할 수 있고, 혈장에서의 안정성 효과 또한 보존할 수 있다는 특장점을 갖는다.
본 발명의 일 실시태양에 따른 이종이합체는 상기 CH3 돌연변이를 포함하는 Fc 영역 및 이에 연결된 하나 이상의 결합 도메인 단백질을 포함할 수 있다.
구체적으로, 상기 결합 도메인 단백질은 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드 중 하나 이상의 폴리펩티드에 연결될 수 있다. 이와 같은 구조를 통해, 본 발명의 이종이합체 형성 기술을 융합 단백질, 이중특이적 항체, 다중특이적 항체 등 다양한 형태의 이종이합성 단백질 및 항체에 적용할 수 있다. 이 때, 상기 연결은 직접 연결, 또는 1 내지 50개의 아미노산으로 구성된 펩티드에 의한 연결일 수 있다. 또한, 상기 결합 도메인 단백질은 상기 제1 및/또는 제2 폴리펩티드의 N-말단 및/또는 C-말단에 연결될 수 있다.
본 발명의 일 실시태양에서, 상기 결합 도메인 단백질은 항체의 항원 결합 영역, 사이토카인, 성장 인자, 호르몬, 수용체 유래 단백질로 구성된 군에서 선택되는 1종 이상을 포함할 수 있다.
본 발명의 일 실시태양에서, 상기 항원 결합 영역은 항원의 일부 또는 전부에 특이적으로 결합하고 항원의 일부 또는 전부에 상보적인 영역을 포함하는 항체의 일부를 의미할 수 있다. Fc 영역에 연결되는 항원 결합 영역의 형태는 특별히 제한되지 않으며, Fab 형태 뿐만 아니라 scFab, sdAb, scFv, di-scFv, dsFv, (dsFv)2 등의 재조합 도메인 형태일 수 있다.
Fab 형태는 중쇄의 가변영역(VH) 도메인 및 불변영역 중 CH1 도메인, 및 경쇄의 가변영역(VL) 도메인 및 불변영역인 CL 도메인을 포함하고, 상기 CH1 도메인 및 CL 도메인 사이에 이황화결합이 형성된 형태이다. scFab 형태는 VH-CH1 중쇄절편과 VL-CL 경쇄가 펩티드 링커(linker)로 이어진 형태의 단쇄 항체 단편을 의미한다. 또한, sdAb 형태는 단일 도메인 가변 단편(single-domain variable fragment)을 의미하며, 하나의 가변영역 도메인을 의미한다.
한편, scFv 형태는 가변영역이 이어진 형태의 단쇄 가변 단편(single-chain variable fragment)을 의미하는 것으로, VH 및 VL 영역을 펩티드 링커로 연결한 재조합 도메인을 의미한다. 또한, di-scFv 형태는 두개의 scFv가 링커로 연결된 재조합 도메인을 의미한다. 상기 링커는 당해 기술 분야에 알려진 링커를 적절하게 사용할 수 있으며, 5 내지 20개의 아미노산으로 이루어진 펩티드일 수 있다. 바람직하게, 상기 링커는 G, A, S, P, E, T, D 및 K로 구성된 군에서 선택된 1종 이상의 아미노산으로 구성될 수 있다. 예를 들어, 링커는 (GGGGX)n일 수 있으며, X는 A 또는 S인 것이 바람직하고, n은 1 내지 4의 자연수인 것이 바람직하다.
또한, dsFv 형태는 이황화-결합 가변 단편(disulfide-linked variable fragment)으로서 가변영역이 이어진 형태라는 점에서 scFv와 유사하나, VH 및 VL 영역을 링커가 아닌 이황화결합으로 연결한 재조합 도메인을 의미한다. (dsFv)2 형태는 두 개의 dsFv가 링커로 연결된 재조합 도메인을 의미한다.
상기 항원 결합 영역은 Fc 영역의 각 사슬의 C-말단 및 N-말단 중 하나 이상에 연결될 수 있으며, 바람직하게는 각 사슬의 N-말단 중 하나 이상에 연결될 수 있다. 각 연결은 힌지 또는 링커에 의해 형성될 수 있다.
본 발명에서, 상기 결합 도메인 단백질은 IL-1α, IL-1β, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-25, GM-CSF, G-CSF, M-CSF, SLF, TNFα, TNFβ, IFNα, IFNβ, IFNγ, TGFβ, LIF, Eta-1, Oncostatin M 등의 사이토카인; 신경 성장 인자(NGF), 혈소판 유래 성장 인자(PDFG) 등의 성장 인자; 성장 호르몬(GH), 갑상선 자극 호르몬(TSH) 등의 호르몬과 같은 생체 단백질을 포함할 수 있다.
본 발명에서, 상기 결합 도메인 단백질은 수용체 유래 단백질을 포함할 수 있다. 상기 수용체는 하나 이상의 리간드에 결합할 수 있는 폴리펩티드로, 다양한 세포 표면 수용체, 사이토카인 수용체, 면역세포 수용체 등을 포함하는 의미로 해석되며, 예를 들어 가용성 T 세포 수용체일 수 있다. 상기 수용체 유래 단백질은 수용체 단백질의 전부, 일부 또는 이의 변이체를 의미할 수 있으며, 바람직하게, 수용체의 세포외도메인(ectodomain) 유래 단백질을 포함할 수 있다. 다만, 상기 결합 도메인 단백질은 상술한 예에 제한되는 것은 아니며, 표적 분자에 결합할 수 있는 단백질을 목적에 따라 선택하여 사용할 수 있다.
이에 따라, 본 발명의 이종이합체는 2개 이상의 표적 단백질에 결합 가능한 이중특이적 또는 다중특이적 항체로 사용될 수 있다.
본 발명의 예시적인 실시태양에서, 상기 이중특이적 항체는, 상기 Fc 영역 중 하나의 사슬에 표적 항원에 결합하는 항원 결합 도메인을 연결하고, 다른 사슬에 면역세포 활성화 수용체에 결합하는 도메인을 연결한 형태일 수 있다. 이러한 이중특이적 항체는 표적 항원 및 면역세포 활성화 수용체에 동시에 결합함으로써, 항체의존성 세포독성(antibody dependent cellular cytotoxicity, ADCC)에 의해 표적 항원의 사멸을 유도할 수 있다. 또는, 서로 상이한 표적 항원에 결합하는 것도 가능하다.
예를 들어, 본 발명의 이중특이적 항체는 IL-1 alpha, IL-1 beta, IL-1R, IL-4, IL-5, IL-6R, IL-9, IL-12, IL-13, IL-18, IL-18R, IL-25, TARC, MDC, MEF, TGF-β, LHR agonist, TWEAK, CL25, SPRR2a, SPRR2b, ADAM8, PED2, TNF alpha, TGF beta, VEGF, MIF, ICAM-1, PGE4, PEG2, RANK 리간드, Te38, BAFF, CTLA-4, GP130, HER1, HER2, HER3, HER4, VEGF-A, PDGF, VEGF-A, VEGF-C, VEGF-D, DR5, MET, EGFR, MAPG, CSPGs, CTLA-4, IGF1, IGF2, Erb2B, MAG, RGM A, NogoA, NgR, OMGp, PDL-I, NRP1, NRP2, CD3, CD8, CD16, CD19, CD20, CD22, CD28, CD40 및 CD64 중 2종의 표적 분자에 결합할 수 있다. 또는, 이들 중 1종 이상의 추가의 표적 분자에 결합하여 다중특이적 항체 형태로 이용하는 것도 가능하다.
본 발명의 일 실시태양에서, 상기 이종이합체에 하나 이상의 약물을 접합하여 항체-약물 접합체(antibody-drug conjugate, ADC)를 형성할 수 있다.
본 발명에서, 상기 약물은 각 사슬의 C-말단 및/또는 N-말단 뿐 아니라 사슬 내의 아미노산 중 하나 이상의 잔기에 연결될 수 있다. 상기 약물은 적절한 링커(linker)를 이용하여 접합될 수 있다. 상기 약물로는 당해 기술 분야에 공지된 약물 화합물, 성장 억제제, 독소, 방사성 동위원소, miRNA, siRNA, shRNA 등을 이용할 수 있다.
이와 같은 항체-약물 접합체를 이용하면, 표적 항원에 약물을 인도하여 약효를 향상시킬 수 있다. 또는, 특정 수용체에 결합하는 항체에 약물을 부착하는 경우, 수용체를 통한 항체의 트랜스사이토시스(transcytosis)를 이용하여 약물이 조직 내로 전달되도록 유도할 수 있다. 예를 들어, 항체의 Fc 영역에 트랜스페린 수용체에 대한 항체의 항원 결합 영역 유래의 단백질을 연결하고 치료용 단백질 또는 약물을 추가 접합하면, 항체가 트랜스사이토시스를 통해 뇌혈관장벽을 통과할 수 있다. 이를 통해, 뇌혈관장벽을 통과하기 어려운 치료용 단백질 또는 약물의 전달 효율을 향상시킬 수 있다.
본 발명의 이종이합체는, 해당 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 발현 벡터를 숙주 세포에서 발현시켜 제조할 수 있다.
본 발명에서, 상기 이종이합체의 제조방법은, 상기 이종이합체를 코딩하는 1종 이상의 발현 벡터를 준비하는 단계; 및 상기 발현 벡터를 숙주 세포에서 발현시켜 단백질을 수득하는 단계를 포함할 수 있다.
본 발명에서, 폴리뉴클레오티드는 단일가닥 또는 이중가닥 형태의 디옥시리보뉴클레오티드 또는 리보뉴클레오티드의 중합체를 포함하는 의미로 해석된다. 본 발명에서, 상기 폴리뉴클레오티드는 야생형 Fc 사슬을 코딩하는 폴리뉴클레오티드 서열을 본 발명의 Fc 변이체 서열에 따라 변경하여 생성될 수 있으며, 각 사슬의 신호 펩티드, 힌지, 링커, 히스티딘 태그 등을 코딩하는 폴리뉴클레오티드를 더 포함할 수 있다.
또한, 이종이합체가 Fc 사슬에 연결된 다른 단백질(예를 들어, 항원 결합 영역, 치료용 단백질 등의 결합 도메인 단백질)을 포함하는 경우, 이를 포함하는 전체 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 이용하여 제조할 수 있다.
발현 벡터는 숙주 세포에서 목적 유전자를 발현시키기 위한 것으로, 역할 및 숙주 세포에 따라 다양한 성분을 함유할 수 있다. 예를 들어, 벡터는 숙주 세포에 의해 인식 및 프로세싱되는 신호 서열, 복제 기점, 마커 유전자, 전사조절인자들이 결합하는 프로모터, DNA의 전사를 증가시키기 위한 인핸서, 리보솜 결합 부위, 전사 종결 서열 등을 포함할 수 있으나, 이에 제한되지는 않는다.
구체적으로, 본 발명의 이종이합체 생산을 위하여 이종이합체의 각 사슬을 코딩하는 핵산, 즉 폴리뉴클레오티드를 얻은 후 이를 이용하여 발현 벡터를 구축할 수 있다.
본 발명에서, 상기 발현 벡터는 제1 Fc 사슬의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열 및 제2 Fc 사슬의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함할 수 있다. 이 때, 각 폴리뉴클레오티드 서열은 동일한 벡터 또는 별개의 벡터에 포함될 수 있다.
본 발명에서, 상기 발현 벡터는 각 Fc 사슬을 코딩하는 폴리뉴클레오티드 서열 외에도, Fc 이종이합체에 연결될 수 있는 다른 폴리펩티드 및/또는 단백질을 코딩하는 폴리뉴클레오티드 서열을 더 포함할 수 있다. 따라서, 이종이합체의 구조에 따라 1개 또는 2개의 발현 벡터, 또는 그 이상의 발현 벡터를 사용할 수 있다.
본 발명의 예시적인 실시태양에서, 상기 발현 벡터는 제1 Fc 사슬의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 제1 발현 벡터, 및 제2 Fc 사슬의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 제2 발현 벡터를 포함할 수 있다.
발현 벡터가 제작되면, 숙주 세포에서 이를 발현시켜 목적하는 단백질을 얻을 수 있다. 구체적으로, 숙주 세포에 발현 벡터를 트랜스펙션(transfection, 형질주입)한 후 배양시켜, 단백질을 발현할 수 있다.
상기 숙주 세포는 당해 기술 분야에 공지되어 있는 상용 기법을 이용하여, 본 발명에 사용하기에 적합한 것을 실험적으로 결정하여 선택할 수 있다. 예를 들어, 상기 숙주 세포로는 차이니즈 햄스터 난소(CHO) 세포, 베이비 햄스터 신장 세포(BHK), 원숭이 신장 세포(COS), 대장균 세포 등을 이용할 수 있다.
본 발명의 예시적인 실시태양에서, 상기 발현 벡터가 제1 발현 벡터와 제2 발현 벡터를 포함하는 경우, 각 발현 벡터를 개별적인 숙주 세포에 주입하여 발현시킬 수 있다. 또는, 각 발현 벡터를 동일한 숙주 세포에 함께 주입하여 동시발현(co-expression)시키는 것도 가능하다.
배양이 완료되면, 세포로부터 단백질을 단리(isolation)할 수 있다. 구체적으로, 배양된 세포를 원심분리하여, 목적 단백질을 함유하는 세포 배양액을 얻을 수 있다. 이후, 배양액에서 단백질을 분리하고 정제하는 과정을 수행할 수 있다. 상기 분리에는 친화도 크로마토그래피, 겔 전기영동 등을 이용할 수 있으며, 정제를 위하여 추가의 크로마토그래피, SDS-PAGE 등을 이용할 수 있다.
본 발명에서, 제1 발현 벡터와 제2 발현 벡터를 각각 발현시키는 경우, 단리된 단백질을 혼합하여 이종이합체를 형성할 수 있다.
본 발명의 이종이합체(즉, 본 발명의 Fc 이종이합체 및 이를 이용한 융합 단백질, 이중특이적 항체, 다중특이적 항체 및 항체-약물 접합체)는 약학 조성물에 이용될 수 있다. 이에 따라, 본 발명은 상기 이종이합체를 포함하는 질병의 예방 또는 치료용 약학 조성물을 제공할 수 있다.
본 발명의 약학 조성물의 예방 또는 치료의 대상이 되는 질환은 이종이합체에서 Fc 영역에 연결되는 결합 도메인 단백질 및/또는 약물의 종류에 따라 결정될 수 있다.
본 발명의 약학 조성물은 이종이합체 외에 약학적으로 허용가능한 담체를 포함할 수 있다.
상기 약학적으로 허용가능한 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약학 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다.
본 발명의 약학 조성물은 경구 또는 비경구로 투여할 수 있고, 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있다.
본 발명의 약학 조성물은, 당해 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약학적으로 허용가능한 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 상기 약학 조성물은 통상의 방법에 따라 멸균 주사용액, 동결건조(lyophilized) 제형, 사전 충전식 주사(pre-filled syringe) 용액제, 경구형 제형, 외용제 또는 좌제 등의 형태로 제형화될 수 있다. 경구 투여시, 단백질 또는 펩티드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화될 수 있다.
본 발명의 약학 조성물은 추가로 적어도 하나의 다른 치료제 또는 진단제를 포함할 수 있다. 예를 들어, 상기 이종이합체와 함께 인터페론, 항-S 단백질 단일클론 항체, 항-S 단백질 폴리클로날 항체, 뉴클레오시드 유사체, DNA 폴리머라제 저해제, siRNA 제제 또는 치료백신을 추가로 포함할 수 있다.
본 발명의 약학 조성물을 인간을 포함하는 포유동물에게 투여함으로써 질병을 예방 또는 치료할 수 있다. 이때, 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하게 처방될 수 있다. 예를 들어, 본 발명의 약학 조성물의 1일 투여량은 0.001 내지 100㎎/㎏일 수 있다.
본 발명은 또한, 본 발명의 이종이합체(즉, 본 발명의 Fc 이종이합체 및 이를 이용한 융합 단백질, 이중특이적 항체, 다중특이적 항체 및 항체-약물 접합체)를 투여하는 단계를 포함하는, 질병의 예방 또는 치료 방법을 제공할 수 있다.
본 발명의 예시적인 실시태양에서, 예방 또는 치료 대상이 되는 질병은 유방암, 결장직장암, 폐암, 신세포 암종, 신경교종 또는 난소암과 같은 암; 알레르기성 또는 염증성 질환; 자가면역 질환 등일 수 있으나, 이에 제한되는 것은 아니다. 예방 또는 치료 대상이 되는 질병의 종류는 Fc 영역에 연결된 결합 도메인 단백질 및/또는 약물에 따라 달라질 수 있으며, 예를 들어, 본 발명의 이종이합체의 Fc 영역에 HER2에 결합하는 결합 도메인 단백질이 연결된 이중특이적 또는 다중특이적 항체를 이용하면, 유방암, 결장직장암, 폐암, 신세포암종, 신경교종, 또는 난소암의 치료를 위해 사용될 수 있다.
본 발명의 이종이합체 또는 약학 조성물은 이를 필요로 하는 개체(subject), 즉 해당 질병을 갖고 있거나, 해당 질병이 발생할 위험이 있는 개체에 투여될 수 있다. 상기 개체는 동물일 수 있고, 통상적으로 포유동물, 예를 들어 인간일 수 있다.
실시예
이하 실시예를 통하여 본 발명을 보다 상세하게 설명한다. 단, 이들 실시예는 본 발명을 예시적으로 설명하기 위하여 일부 실험방법과 조성을 나타낸 것으로, 본 발명의 범위가 이러한 실시예에 의해 제한되는 것은 아니다.
실험 준비: 수율 및 구조가 최적화된 Fc 이종이합체의 설계
야생형의 Fc 이합체의 구조를 이용하여, 이합체 상호작용 부위의 잔기들을 돌연변이 함으로써 수율 및 구조가 최적화된 이종이합체가 형성되도록 설계하였다.
잔기의 돌연변이를 위하여 구조모델링 프로그램인 Coot를 사용하였고, 동일 프로그램을 사용하여 돌연변이된 잔기들을 포함하는 Fc 이합체 전체의 구조를 에너지 최소화(energy minimization) 한 후, 소수성 잔기들의 충돌, 도메인 위치변형의 정도 등 구조적 변형을 분석하였다.
이러한 구조 분석에서, 가장 구조 변형이 좋으면서 상호작용 에너지가 최적화된 돌연변이 세트(set)를 선정하였다.
제조예 1: 폴리뉴클레오티드 서열 설계 및 발현 벡터 제작
발현 벡터는 pcDNA 3.1 / Myc His-A (Invitrogen)을 바탕으로 단백질의 C-말단에 폴리히스티딘 태그를 갖도록 제작되었다.
IgG1의 221 내지 447(Kabat 문헌의 EU 넘버링에 따름)을 코딩하는 폴리뉴클레오티드 서열을 기준으로, 변이체의 아미노산 서열을 코딩하는 폴리뉴클레오티드를 설계하고, PCR 기법으로 증폭한 뒤 제한효소와 연결효소를 통해 클로닝하였다. 이를 통해 인간 면역글로불린 G1 (IgG1) 중쇄의 신호 펩티드를 포함하는 Fc 영역의 단백질을 발현하는 발현 벡터를 제작하였다.
이 때, 제1 Fc 사슬(Fc chain 1) 발현 벡터는 T366W/K360E 돌연변이를 유발하도록 뉴클레오티드 서열을 변경하여 제작하였으며, 제2 Fc 사슬(Fc chain 2) 발현 벡터는 T366S/L368A/Y407V/Q347R 돌연변이를 유발하는 뉴클레오티드 서열을 도입하여 제작하였다.
각 발현 벡터가 코딩하는 아미노산 서열을 도 2에 나타내었다. 도 2a 및 도 2b는 각각 chain 1 발현 벡터가 코딩하는 아미노산 서열(a)(서열번호 4) 및 chain 2 발현 벡터가 코딩하는 아미노산 서열(b)(서열번호 5)을 나타낸다. IgG1 221~447에 해당하는 영역을 밑줄로 표시하였으며, 변이가 형성된 잔기를 별표로 표시하였다. 그 외 신호 펩티드, 제한효소 인식부위 및 히스티딘 태그 영역은 표시하지 않았다.
제조예 2: 단백질 발현 및 이종이합체 단백질 제조
2-1. 단백질 발현
ExpiCHO™ 세포에 제조예 1의 발현 벡터를 트랜스펙션(transfection)하여 일시적으로 각 단백질을 발현하였다.
상기 트랜스펙션은 초기 세포 밀도 6 x 106 세포/mL 및 발현 벡터 농도 0.8 μgDNA/mL 조건에서 진행되었으며, 이 과정에서 ExpiCHO™ Expression Medium, OptiPRO™ SFM 및 ExpiFectamine™ 트랜스펙션 키트(Gibco)를 제조사 지침에 따라 사용하였다.
트랜스펙션 과정을 거친 세포들을 이산화탄소 인큐베이터에서 8일간 배양한 후, 원심분리를 통해 각 단백질을 함유하는 세포 배양액과 세포로 분리하였다.
2-2. 정제
각각의 재조합 단백질을 포함하는 배양액에서 목표 단백질들을 분리하기 위해 Ni-NTA (Qiagen) 컬럼을 이용한 친화도 크로마토그래피(affinity chromatography)를 실시하였다.
구체적으로, Ni-NTA 컬럼에 50mM Tris-HCl pH 7.5 및 200mM NaCl을 포함하는 완충용액을 채운 후, 원심분리를 통해 획득된 배양액을 0.45μm 여과지로 여과하여 투입하였다. 배양액과 반응을 마친 뒤, 컬럼을 50mM Tris-HCl pH 7.5 및 500mM NaCl을 포함하는 완충용액과 50mM Tris-HCl pH 7.5, 200mM NaCl 및 30mM imidazole을 포함하는 완충용액으로 순차적으로 세척하였다.
최종적으로 50mM Tris-HCl pH 7.5, 200mM NaCl 및 500mM imidazole을 포함하는 완충용액을 사용하여, 컬럼에 결합한 단백질을 용출하였다. 용출 후, Hitrap™ Desalting (GE healthcare) 컬럼을 이용하여 상기 단백질을 포함하는 완충용액의 조성을 인산염완충식염수(PBS)로 교체하였다.
2-3. 이종이합체 단백질 조합
정제된 Fc chain 1 단백질과 Fc chain 2 단백질을 정량한 후, 동일 분자 비율로 혼합하였다. 혼합한 단백질 용액에 최종농도 0.1M arginine, 5mM L-glutathione (reduced)이 되도록 시약을 추가하여, 37℃에서 2시간 동안 이종이합체 단백질이 형성되도록 반응시켰다. 반응이 끝난 단백질은 SDS-PAGE 기법을 통하여 이종이합체가 형성되었음을 확인하였다. 이하, 생성된 이종이합체를 "WER Fc"(본 발명의 실시예 1의 CH3 변이체)로 지칭한다.
2-4. WER Fc의 결정화 및 결정구조 확인
상기 제조예에서 수득한 WER Fc에 대해, 초기 결정화 스크리닝(initial crystallization screen) 및 결정 시드화(crystal seeding)를 거쳐 결정화를 수행하였다. 결정화에는 저농도의 Tri-Cl 과 salt 조건을 사용하였다.
결정의 X-선 회절 데이터를 포항가속기 빔라인 11C에서 측정하였다. WER Fc 결정은 3.39Å 해상도로 회절하였고, 측정 결과를 표 1에 나타내었다.
데이터 수집 항목 결과
공간군(space group) P21
해상도 범위 (Å) 45.5 - 3.4 (3.5 - 3.4)
셀 파라미터 a, b, c (Å) 64.72, 147.06, 66.41
α, β, γ (°) 90.00, 119.15, 90.00
완성도(completeness, %) 92.4 (74.7)
R-merge (%) 9.8 (24.9)
I/σ 8.1 (3.2)
중복도(redundancy) 2.8 (2.1)
표 1의 회절 데이터를 사용하여 분자치환법으로 결정의 3차 구조를 규명하고, 정밀화(refinement) 결과를 표 2에 나타내었다.
정밀화 결과 항목 결과
반사수 14318 (1166)
수소를 제외한 원자의 개수 단백질 6642
비(非)단백질 348
R-work (%) 22.6
R-free (%) 25.5
RMS 길이 (Å) 0.006
각도 (°) 1.14
라마찬드란 플롯
(Ramachandran plot)
Favored (%) 95.1
Allowed (%) 4.9
Outliers (%) 0
또한 상기 WER Fc에서, 사슬 간 소수성 상호작용 부위(a) 및 전하쌍 상호작용 부위(b)의 구조 모델을 도 3a 및 3b에 각각 나타내었다.
실험예
이하, 실험예를 통해 본 발명의 일 실시태양에 따른 Fc 변이체를 야생형 IgG1 Fc 영역(WT Fc) 및 종래 기술의 Fc 이종이합체인 EW-RVT Fc 및 KiH Fc와 비교하였다.
상기 EW-RVT Fc는 WT Fc의 한 사슬에 K409W/K360E 변이가 형성되고, 다른 사슬에 F405T/D399V/Q347R 변이가 형성된 이종이합체이다. 상기 KiH Fc는 WT Fc의 한 사슬에 T366W 변이가 형성되고, 다른 사슬에 T366S/L368A/Y407V 변이가 형성된 이종이합체이다.
실험예 1: Fc 영역의 구조 비교
1-1. WER Fc와 WT Fc의 Fc 영역 구조 비교
WER 이종이합체로 이루어진 Fc 영역(WER Fc), 야생형 Fc 영역(WT Fc) 및 EW-RVT 이종이합체의 Fc 영역(EW-RVT Fc)의 구조를 도 4에 나타내었다. 도 4에서, 자홍색으로 표시한 구조는 WER Fc이고, 녹색으로 표시한 구조는 WT Fc이며, 청록색(cyan)으로 표시한 구조는 EW-RVT Fc이다.
구체적으로, 각각의 Fc 구조를 A-chain (제2 Fc 사슬에 해당)을 이용하여 중첩하였고 이때 B-chain (제1 Fc 사슬에 해당)의 구조가 비틀어지는 정도를 비교하였다.
그 결과, EW-RVT Fc에서는 구조가 많이 비틀어지는 반면, 본 발명의 WER Fc는 그다지 변화가 크지 않고, WT의 Fc 영역과 구조적으로 매우 유사한 것을 확인할 수 있다. 이에 따라, 본 발명의 아미노산 변이는 Fc 영역의 구조 변형을 거의 일으키지 않는 것을 알 수 있었다.
1-2. WER Fc와 WT 및 EW-RVT Fc의 CH2 도메인 구조 비교
WT Fc와 WER Fc 및 EW-RVT Fc의 CH2 도메인 구조를 비교하여 구조적 유사성을 확인하였다.
도 4의 구조 중 B-chain 영역만을 대상으로 하여, WER Fc와 WT Fc의 구조 비교(a) 및 EW-RVT Fc와 WT Fc의 구조 비교(b)를 도 5a 및 5b에 각각 나타내었다. 도 5a에서 확인 가능한 바와 같이 WER은 WT와 CH2 도메인 구조에 차이가 거의 없는 반면, 도 5b에 따르면 EW-RVT는 구조 변형(displacement)에 의해 WT와의 구조적 유사성이 현저히 떨어지는 것을 확인할 수 있었다.
도 5a 및 5b의 비교 결과, 종래 기술의 이종이합체의 경우 면역 반응에 중요한 CH2 도메인이 야생형 구조와 비교하여 16.3Å이나 비틀어진 것으로 나타났다. 이에 반해, 본 발명의 구조는 그다지 변화가 크지 않은 것을 알 수 있었다.
실험예 2: WER Fc와 EW-RVT Fc의 RMS deviation 비교
이종이합체의 Fc 영역과 WT Fc 영역의 구조적 유사성을 확인하기 위하여, 평균 제곱 거리(RMS deviation)를 측정하였다.
C-alpha alignment를 사용하여 WER Fc와 WT Fc에 대해 한쪽 chain (chain A, 제2 Fc 사슬에 해당)의 3차 구조의 중첩(superposition)을 수행한 후, 겹쳐진 원자들 사이에 RMS deviation을 측정하였다.
이때 3차 구조 중첩에 사용하지 않은 다른 쪽 chain (chain B, 제1 Fc 사슬에 해당)의 구조가 비틀어지는 것을 비교하기 위하여 chain B의 RMS deviation을 계산하였다.
비교를 위하여, EW-RVT Fc에 대해서도 상기 방법으로 WT Fc와의 RMS deviation을 측정하였다.
상기 RMS deviation 측정 결과를 아래 표 3에 나타내었다.
RMS deviation WER EW-RVT
A-chain (중첩) 1.50Å 1.74Å
B-chain 4.14Å 7.95Å
표 3의 결과로부터, 구조 중첩에 사용한 A-chain의 경우 WER 및 EW-RVT 모두 WT Fc와 약 2Å 내외의 deviation을 보이는 반면, 구조 중첩에 사용하지 않은 B-chain의 경우, EW-RVT의 deviation은 약 8Å 정도로 매우 큰 것에 비해 WER의 deviation 은 상당히 작은 것을 확인하였다.
이를 통해, 본 발명의 WER Fc는 EW-RVT Fc에 비해 WT Fc와의 구조적 유사성이 매우 높은 것을 확인할 수 있었다.
실험예 3: WER Fc와 EW-RVT 및 KiH Fc의 수율 비교
본 발명의 일 실시태양에 따른 Fc 변이체의 이종이합체 생성 수율을 평가하기 위해서, Fc 이종이합체를 포함하는 융합단백질을 제조하고, SDS-PAGE 분석을 수행하여 수율을 측정하였다.
실험을 위해, 인간 항체의 중쇄(HC)와 경쇄(LC)에 토끼 항체의 가변 영역을 갖는 단백질을 코딩하는 발현 벡터를 설계하고, 인간 항체 Fc (hFc)를 코딩하는 벡터와 동시 발현(co-expression)시켜 융합단백질을 제조하였다.
인간 항체 카파 경쇄 및 중쇄 IgG1 유전자는 한국인간유전자뱅크(Korea human gene bank, clone ID: hMU013040, hMU014012)에서 구입하였다. 토끼 항체 가변 영역을 코딩하는 cDNA는 CHO expression system용 발현 조절 벡터(Thermo Fisher Scientific)에서 확보하였다. 인간/토끼 키메라 항체를 코딩하는 뉴클레오티드와 인간 항체 Fc (hFc)를 코딩하는 뉴클레오티드는 EcoRV 및 AgeI 제한효소를 포함하는 프라이머로 PCR 증폭하여 확보하였다.
상기 PCR 산물 및 pcDNA 3.1-Myc His A 벡터(Thermo Fisher Scientific)를 EcoRV 및 AgeI 제한효소로 37℃에서 1시간 자른 후 1% 아가로스 젤로 정제하고, T4 연결효소(Enzynomics Co., Ltd.)와 상온에서 1시간 동안 혼합하였다. 이후 연결효소 반응 산물로 TOP competent cell(Thermo Fisher Scientific)을 형질전환 시켰다. 클로닝 후, 이종이합체 생성을 위한 Fc 돌연변이로서 WER, EW-RVT 또는 KiH 돌연변이가 항체의 CH3 도메인에 도입되도록 하였다.
Fc 돌연변이가 도입된 인간 항체의 중쇄와 경쇄에 토끼 항체의 가변 영역을 갖는 단백질을 코딩하는 발현 벡터와 Fc 돌연변이가 도입된 인간 항체 Fc만을 코딩하는 발현 벡터를 제조예 2-1과 동일한 방법으로 CHO 세포에 트랜스펙션하였다. 트랜스펙션에 사용한 전체 벡터 양은 동일하게 유지하되, 발현량이 적은 경쇄 단백질을 코딩하는 벡터를 과량 첨가하여 비율을 조절하였다.
수득한 이종이합체 융합단백질에 대해 SDS-PAGE 분석을 수행하고, 그 결과를 도 6에 나타내었다. 도면에서, 1열은 KiH, 2열은 EW-RVT, 3열은 WER의 결과를 나타낸다.
도 6에서 확인 가능한 바와 같이, KiH 돌연변이를 이용한 경우 수율이 약 57%로 나타났으며, EW-RVT의 경우 수율이 약 70%로 나타났다. 반면, 본 발명의 WER의 경우 수율이 약 98%로, 종래의 Fc 변이체들에 비하여 이종이합체의 수득 효율이 월등하게 우수한 것을 확인하였다.
실험예 4: 추가 조합의 CH3 변이체를 도입한 이종이합체 단백질의 제조
이종이합체 생성 수율 및 구조 변형 최소화를 고려하여 다른 조합의 Fc CH3 도메인 돌연변이 세트 2종(CH3 변이체 A 및 B)을 추가로 설계하고 이를 도입하여 이종이합체 단백질을 제조하였다.
4-1. 발현 벡터 설계 및 제작
CH3 변이체 A 및 B가 도입된 이종이합체 단백질의 제조를 위해, 제1 Fc 사슬의 CH3 도메인 돌연변이가 도입된 인간 IgG1 Fc 영역을 코딩하는 발현 벡터와 제2 Fc 사슬의 CH3 도메인 돌연변이가 도입된 항체의 중쇄(HC) 및 경쇄(LC)를 코딩하는 발현 벡터를 각각 설계하였다.
먼저, CH3 변이체 A 및 B 각각에 대해 인간 IgG1 Fc 영역만을 코딩하는 발현 벡터(각 변이체의 제1 Fc 사슬 발현 벡터)를 pcDNA 3.1을 바탕으로 제작하였다. IgG1의 221 내지 446(Kabat 문헌의 EU 넘버링에 따름)을 코딩하는 폴리뉴클레오티드 서열을 기준으로, CH3 변이체 A의 제1 Fc 사슬 발현 벡터는 T366W/Q347R 돌연변이를 포함하는 Fc 사슬의 아미노산 서열(서열번호 6)을 코딩하도록 뉴클레오티드 서열을 변경하였고, CH3 변이체 B의 제1 Fc 사슬 발현 벡터는 T366W/Q347R/K360R 돌연변이를 포함하는 Fc 사슬의 아미노산 서열(서열번호 8)을 코딩하도록 뉴클레오티드 서열을 변경하였다. 이들을 PCR 기법으로 증폭한 뒤 NEBuilder HiFi DNA assembly kit (NEB)를 이용하여 중첩 (overlapping)을 통해 제작하였다. 이를 통해 인간 세럼 알부민의 신호 펩티드를 포함하는 각 CH3 변이체의 제1 Fc 사슬 단백질을 발현하는 발현 벡터를 제조하였다.
다음으로, CH3 변이체 A 및 B 각각의 제2 Fc 사슬을 포함하는 항체의 중쇄(HC) 및 경쇄(LC)를 코딩하는 발현 벡터(각 변이체의 제2 Fc 사슬 발현 벡터)를 pTRIOZ (Invivogen)를 바탕으로 제작하였다. 상기 항체의 중쇄 및 경쇄 서열은 본 출원인의 국제공개공보 WO 2022/169274(본원에 참고로 인용됨)에 기재된 항-PD-1 항체의 가변 영역 서열을 포함하도록 설계하였다.
각 변이체의 제2 Fc 사슬을 포함하는 중쇄 서열의 IgG1 Fc 영역은, IgG1의 221 내지 446(Kabat 문헌의 EU 넘버링에 따름)을 코딩하는 폴리뉴클레오티드 서열을 기준으로, CH3 변이체 A의 제2 Fc 사슬 발현 벡터의 경우 K360E/T366S/L368A/Y407V 돌연변이를 포함하는 아미노산 서열(서열번호 7)을 포함하는 항체를 코딩하도록 뉴클레오티드 서열을 변경하였고, CH3 변이체 B의 제2 Fc 사슬 발현 벡터의 경우 Q347E/K360E/T366S/L368A/Y407V 돌연변이를 포함하는 아미노산 서열(서열번호 9)을 포함하는 항체를 코딩하도록 뉴클레오티드 서열을 변경하여 제작하였다. 이들을 PCR 기법으로 증폭한 뒤 NEBuilder HiFi DNA assembly kit (NEB)를 이용하여 중첩 (overlapping)을 통해 제작하였다. 이를 통해 인간 세럼 알부민의 신호 펩티드 및 각 CH3 변이체의 제2 Fc 사슬 단백질을 포함하는 각각의 항체(중쇄 변이체 및 경쇄)를 발현하는 발현 벡터를 제작하였다. 여기서, 경쇄 아미노산 서열은 서열번호 10을 참조한다. CH3 변이체 A 또는 B의 제2 Fc 사슬 돌연변이가 도입된 전체 중쇄 아미노산 서열은 각각 서열번호 11 및 12를 참조한다.
4-2. 단백질 발현 및 정제
상기 실험예 4-1에서 제작한 CH3 변이체 A 및 B 각각에 대한 제1 Fc 사슬 발현 벡터와 제2 Fc 사슬 발현 벡터(즉, 항체 발현 벡터)를 ExpiCHO 세포에 co-transfection하여 단백질을 발현하였다.
상기 트랜스펙션은 초기 세포 밀도 6 x 106 cells/mL 및 발현 벡터 농도가 총 0.8 μg DNA/mL인 조건에서 진행되었으며, 이 과정에서 ExpiCHOTM Expression Medium, OptiPROTM SFM 및 ExpiFectamineTM 트랜스펙션 키트(Gibco)를 제조사 지침에 따라 사용하였다. 트렌스펙션에 사용한 전체 발현 벡터 양은 동일하게 유지하되, 발현량이 적은 항체 단백질을 코딩하는 발현 벡터를 과량 첨가하여 비율을 조절하였다(대략 1:4).
트렌스펙션 과정을 거친 세포들을 37℃, 8% CO2 조건에서 18시간 배양한 뒤 트랜스펙션 키트(Gibco) 제조사 지침에 따라 ExpiCHOTM Feed와 ExpiCHOTM Enhancer를 처리한 뒤 32℃, 5% CO2 조건에서 배양하였다. 트렌스펙션으로부터 6일 뒤 원심분리를 통해 각 단백질을 함유하는 세포 배양액과 세포를 분리하였으며, 이 때 세포 생존율은 75% 이상이었다.
각각의 재조합 단백질을 포함하는 배양액에서 목표 단백질들을 분리하기 위해 Pierce® Protein A Agarose 레진 (Thermo ScientificTM)을 이용한 친화도 크로마토그래피를 실시하였다.
구체적으로 10CV(컬럼 부피)의 Protein A IgG Binding Buffer (Thermo ScientificTM)로 평형시킨 레진에 13000 xg 원심분리를 통해 aggregate 및 세포 유래 불순물을 제거한 배양액을 투입하였다. 이 후 레진을 10CV의 Protein A IgG Binding Buffer (Thermo ScientificTM) 및 1CV의 IgG Elution buffer (Thermo ScientificTM)로 순차적으로 세척한 뒤 3CV의 IgG Elution buffer (Thermo ScientificTM)를 이용하여 단백질을 용출하였다. 용출된 단백질의 pH를 7.4까지 중화시키기 위해 용출에 사용한 IgG Elution buffer의 1/10 부피에 해당하는 1M Tris pH8.5를 용출된 단백질에 첨가했다.
용출된 단백질 중 일부 분획은 이종이합체 단백질 생성 수율을 확인하기 위해 Amicon tube (Merck, MWCO: 3K)를 이용하여 1 mg/mL까지 농축하였다.
용출된 단백질 중 또다른 분획을 FcRn binding 및 Tm 측정을 위해 크기 배제 크로마토그래피 컬럼을 이용하여 이종이합체 단백질을 분리 정제하였다. 구체적으로 AKTA avant 25 FPLC를 이용하여 정제하였으며, HiLoad 16/600 Superdex 200 pg (Cytiva) 컬럼을 사용하였다. 1.5CV의 PBS (10 mM Na2HPO4, 1.8 mM KH2PO4, 137 mM NaCl, 2.7 mM KCl pH 7.4)로 평형시킨 컬럼에 친화도 크로마토그래피 용출 단백질 500 μL를 주입한 뒤 1 mL/min의 속도로 PBS buffer를 흘려주었다. 크기에 따라 분리된 단백질은 1.3 mL씩 분액하여 모았으며 4-12% 비환원성 SDS-PAGE를 통해 이종이합체 단백질의 형성을 확인하였다.
이하, CH3 변이체 A의 돌연변이가 도입된 CH3 도메인, Fc 영역 또는 이종이합체를 "WRE 변이체"(본 발명의 실시예 2의 CH3 변이체)로 지칭하고, CH3 변이체 B의 돌연변이가 도입된 CH3 도메인, Fc 영역 또는 이종이합체를 "WRREE 변이체"(본 발명의 실시예 3의 CH3 변이체)로 지칭한다. 또한, 대조군으로서, IgG1 야생형 Fc, KiH Fc 및 EW-RVT Fc를 사용하는 것을 제외하고는 본 실험예 4와 동일한 방식으로 발현 벡터를 제작하고 이로부터 단백질을 생산하였다.
도 7은 KiH, WER, WRE 및 WRREE 각각에 대하여, 본 실험예 4에서 제작된 제1 Fc 사슬 발현 벡터 및 제2 사슬 발현 벡터를 co-transfection 하였을 때 생산되는 이종이합체를 도식화한 것이다. 돌연변이가 도입되지 않은 IgG1 야생형 Fc(Fc WT)는 동종이합체를 형성한다.
실험예 5: WRE Fc 및 WRREE Fc를 도입한 이종이합체 단백질의 분석
5-1. 이종이합체 형성 수율 분석
상기 실험예 4에서 제작한 제1 Fc 사슬 발현 벡터 및 제2 Fc 사슬 발현 벡터를 co-transfection하여 단백질을 생산하였을 때 발생 가능한 단백질 형태는 도 8에 도시한 바와 같다. 이 중에서, 본 발명의 실시예 2 및 3의 CH3 변이체(각각 WRE 변이체 및 WRREE 변이체)를 도입함에 따라 이종이합체의 형성이 선호되는지 여부를 확인하기 위해 이종이합체 단백질의 형성 수율을 분석하였다.
상기 실험예 4에서 생산된 KiH Fc, EW-RVT Fc, WRE Fc 또는 WRREE Fc를 포함하는 이종이합체 단백질을 Protein A로 정제한 후 크기 배제 크로마토그래피 (Thermo ScientificTM, MAbPacTM SEC-1)를 이용하여 HPLC (Thermo ScientificTM, Vanquish VC-P20-A) 분석을 수행하였다. 용출 완충액으로 PBS를 사용하였으며 유속 0.7 mL/min에서 진행되었다. 동종이합체 및 단량체 크기 확인을 위해 KiH의 제1 사슬 발현 벡터(Knob) 및 제2 사슬 발현 벡터(Hole)를 각각 단독 transfection 및 발현하여 정제한 단백질을 함께 분석함으로써, 동종이합체, 이종이합체 및 단량체의 피크를 특정하였다.
그 결과를 도 9에 나타내었다. 도 9의 SEC-HPLC 그래프 분석 프로파일로부터 분석된 각각의 동종이합체, 이종이합체 및 단량체의 생성 비율을 표 4에 정리하고, 이들 생성 비율을 막대 그래프로 도식화하여 도 10에 나타내었다.
(%) KiH EW-RVT WRE
(본 발명의 실시예 2)
WRREE
(본 발명의 실시예 3)
Molar ratio of constructs
(SEC-HPLC)
Hole Dimer 0.00 0.77 0.00 0.00
Heterodimer 64.15 70.41 89.65 93.69
Hole Monomer 0.00 0.00 0.00 0.00
Knob Dimer 24.17 28.82 8.57 4.99
Knob monomer 11.68 0.00 1.78 1.32
위에서 보는 바와 같이, 종래 기술의 대조군 변이체를 도입한 경우의 이종이합체 생성 수율은 대략 64~70%을 보이는 것에 비하여, 본 발명의 실시예 2 및 3의 CH3 변이체를 도입한 경우의 이종이합체 생성 수율은 대략 90~94%로 현저히 향상된 이종이합체 생성 수율을 나타내는 것이 확인되었다.
5-2. 이종이합체 FcRn 결합능 분석
상기 실험예 4에 따라 제조된 본 발명의 일 실시태양에 따른 이종이합체 단백질이 야생형 동종이합체와 비교하여 FcRn에 대한 결합능을 유지하고 있는지 확인하기 위해, 크기 배제 크로마토그래피 컬럼을 이용하여 FPLC에서 분리한 이종이합체 단백질에 대해 SRP (Surface Plasmon Resonance) 장비인 Biacore 8K (Cytiva)를 이용하여 분석하였다. 구체적으로 CM5 센서칩 (Cytiva)에 10 mM Sodium acetate pH 5.0에 희석한 FcRn 단백질을 약 600 RU (response units)이 되도록 고정하였다. 야생형 동종이합체, WRE 이종이합체 및 WRREE 이종이합체를 1500-2.5 nM의 농도로 2.5배씩 0.005% Tween20이 함유된 PBS (pH6.0)에 희석하여 120초 동안 30 μL/min의 속도로 흘려 결합 분석을 진행하였으며, 단백질을 포함하지 않은 동일한 완충 용액을 600초 동안 30 μL/min의 속도로 흘려 해리 분석을 진행하였다. CM5 센서칩의 재생은 HBS-EP (pH8.0) 완충용액을 60초 동안 30 μL/min의 속도로 흘려 진행하였다.
도 11a 내지 11c는 각 재조합 단백질의 FcRn에 대한 결합 및 해리 분석 후 얻어진 센소그람을 바탕으로 평형상태 (steady-state)의 RU를 통해 친화도 분석을 진행한 그래프를 나타낸 것이다. 상기 센소그람을 바탕으로 계산된 FcRn 친화도를 아래 표 5에 표기하였다.
IgG1 (Fc WT) WRE WRREE
Steady-state KD (nM) 490 411 458
이로부터 본 발명의 WRE 및 WRREE 이종이합체는 돌연변이 도입에도 불구하고 야생형 동종이합체 (IgG1 (Fc WT))와 동일한 FcRn 결합능을 그대로 유지하고 있는 것을 확인하였다.
5-3. 이종이합체 열역학적 안정성 분석
상기 실험예 4에 따라 제조된 본 발명의 일 실시태양에 따른 이종이합체 단백질의 열역학적 안정성을 평가하기 위하여, 크기 배제 크로마토그래피 컬럼을 이용하여 FPLC에서 분리한 이종이합체 단백질에 대해 시차주사 열용량 분석기 (Differential Scanning Calorimetry, DSC)인 MicroCal PEAQ-DSC Automated (Malvern Panalytical)를 사용하여 열전이 중간점(thermal transition midpoint, Tm)을 측정하였다. 열역학적 변성은 10℃에서 110℃까지 1℃/min의 속도로 측정하였으며, 단백질을 제외한 동일 조성 완충액을 통해 측정값을 보정하였다.
도 12a 내지 12c는 각 재조합 단백질의 시차주사 열용량 분석 결과 프로파일을 나타낸 것이다. 상기 프로파일을 바탕으로 계산된 각 재조합 단백질의 CH2 도메인 및 Fab/(CH3) 도메인의 열 전이 중간점(Tm)을 아래 표 6에 정리하였다.
Tm IgG1 (Fc WT) WRE WRREE
CH2 72.78 71.75 71.32
Fab/(CH3) 77.96/83.96 77.53 77.57
표 6에서 보는 바와 같이, 본 발명의 WRE 및 WRREE 이종이합체는 돌연변이 도입에도 불구하고 야생형 IgG1 동종이합체 (IgG1 Fc WT)와 동일한 열역학적 안정성을 유지하고 있는 것으로 확인되었다(WRE 및 WRREE 이종이합체의 CH3 도메인의 열전이 중간점은 Fab의 피크와 겹쳐져 특정되지 않았으나, IgG1 Fc WT의 Fab 열전이 중간점에 비해 변화가 크지 않고 유사하게 나타난 점으로부터 WRE 및 WRREE 이종이합체의 CH3 도메인의 열역학적 안정성이 WT과 유사함을 알 수 있다).
5-4. 컴퓨터 가상 분석을 통한 이종이합체의 면역원성 분석 ( in silico CD4 T cell immunogenicity prediction)
이종이합체 형성을 위해 도입한 돌연변이에 의해 면역원성 증가 가능성을 분석하기 위해 면역원성 컴퓨터 가상 분석을 진행하였다. 분석에는 IEDB Analysis Resource에서 제공하는 분석 시스템인 CD4 T cell immunogenicity prediction (http://tools.iedb.org/CD4episcore/)을 사용하였다. 분석 방법은 7-allele method와 immunogenicity method를 함께 예측하는 IEDB recommended (combined)을 선택하였으며, maximum percentile rank threshold는 50을 선택하여 분석 진행하였다. 분석에는 인간 IgG1의 야생형 Fc 아미노산 서열과 본 발명의 일 실시태양에 따른 WRE 및 WRREE 이종이합체의 Fc 아미노산 서열을 사용하였다. 분석 결과표에서 펩티드는 항원결정기(epitope)로 작용할 것으로 예측되는 부위를 나타낸다. 각 점수는 면역원성을 유발할 수 있는 정도를 예측한 값으로 그 값이 낮을수록 면역원성을 유발할 가능성이 높음을 의미한다.
본 발명의 WRE Fc 및 WRREE Fc의 면역원성 예측 분석 결과를 아래 표 7에 나타내었다. WRE Fc 및 WRREE Fc의 서열에서 항원결정기 가능성이 있는 펩티드 범위가 대조군으로 사용된 인간 IgG1의 야생형 Fc의 분석 결과와 동일하게 예측되었다. WRE Fc 및 WRREE Fc 각각의 제2 사슬(Hole 사슬)의 항원결정기 펩티드(3번째 펩티드)에 이종이합체 형성을 위해 도입한 돌연변이가 존재하여 점수의 변화가 나타났지만, 계산된 점수가 야생형 대비 높으므로 면역원성이 낮을 것으로 예측된다. 종합하면, WRE Fc 및 WRREE Fc에 도입된 돌연변이가 IgG1 야생형에 의해 발생 가능한 면역원성 외에 추가적인 혹은 더 높은 면역원성을 일으킬 가능성은 매우 낮을 것으로 예측되었다.
Peptide Combined Score Immunogenicity Score Median
percentile Rank
(7-Allele)
IgG1 Fc WT KPKDTLMISRTPEVT 47.92904 89.8226 20.0
YNSTYRVVSVLTVLH 48.60732 94.5183 18.0
DGSFFLYSKLTVDKS 48.28376 83.2094 25.0
WRE
Fc
Knob KPKDTLMISRTPEVT 47.92904 89.8226 20.0
YNSTYRVVSVLTVLH 48.60732 94.5183 18.0
DGSFFLYSKLTVDKS 48.28376 48.28376 83.2094
Hole KPKDTLMISRTPEVT 47.92904 89.8226 20.0
YNSTYRVVSVLTVLH 48.60732 94.5183 18.0
DGSFFLVSKLTVDKS 49.45232 90.6308 22.0
WRREE
Fc
Knob KPKDTLMISRTPEVT 47.92904 89.8226 20.0
YNSTYRVVSVLTVLH 48.60732 94.5183 18.0
DGSFFLYSKLTVDKS 48.28376 48.28376 83.2094
Hole KPKDTLMISRTPEVT 47.92904 89.8226 20.0
YNSTYRVVSVLTVLH 48.60732 94.5183 18.0
DGSFFLVSKLTVDKS 49.45232 90.6308 22.0
이상으로 본 발명의 내용의 특정부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시 형태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
서열 리스트
SEQ ID No. Description Sequences
1 WER Fc mutant chain 1 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT E NQVSL W CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
2 WER Fc mutant chain 2 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP R VYTLPPSRDELTKNQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
3 Wild Type IgG1 221-447 (EU numbering) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
4 WER Fc mutant chain 1 - vector coding sequences MDWTWRVFCLLAVAPGAHSDIDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT E NQVSL W CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGHHHHHH
5 WER Fc mutant chain 2 - vector coding sequences MDWTWRVFCLLAVAPGAHSDIDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP R VYTLPPSRDELTKNQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKTGHHHHHH
6 WRE Fc mutant chain 1 (CH3 mutant A chain 1) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP R VYTLPPSRDELTKNQVSL W CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
7 WRE Fc mutant chain 2 (CH3 mutant A chain 2) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT E NQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
8 WRREE Fc mutant chain 1 (CH3 mutant B chain 1) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP R VYTLPPSRDELT R NQVSL W CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
9 WRREE Fc mutant chain 2 (CH3 mutant B chain 2) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP E VYTLPPSRDELT E NQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
10 Light chain amino acids DIVLTQTPLSLPVSLGDQASISCRSSQNIVHSNGDTYLEWYLQKPGQSPKLLIYKVSKRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
11 WRE heavy chain amino acids EVQLQQSGAELVKPGASVKLSCKASGYTFTGYWMHWVKQRPGQGLEWIGMIHPNSDTTTYNEKFKNRATLTVDKSSGTAYMQLSSLTSEDSAVYYCTGTDQAAWFAFWGQGTLVTVSAASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT E NQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
12 WRREE heavy chain amino acids EVQLQQSGAELVKPGASVKLSCKASGYTFTGYWMHWVKQRPGQGLEWIGMIHPNSDTTTYNEKFKNRATLTVDKSSGTAYMQLSSLTSEDSAVYYCTGTDQAAWFAFWGQGTLVTVSAASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP E VYTLPPSRDELT E NQVSL S C A VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL V SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

Claims (20)

  1. 항체의 제1 CH3 도메인을 포함하는 제1 폴리펩티드 및 제2 CH3 도메인을 포함하는 제2 폴리펩티드를 포함하는 이종이합체로서,
    상기 제1 CH3 도메인은 T366에서의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인은 T366, L368 및 Y407 중 하나 이상에서의 아미노산 치환을 포함하며,
    상기 제1 CH3 도메인 및 제2 CH3 도메인 중 어느 한 도메인은 K360에서의 아미노산 치환을 더 포함하고, 다른 한 도메인은 Q347에서의 아미노산 치환을 더 포함하며, 여기서 상기 아미노산 번호는 KABAT 문헌의 EU 넘버링을 기준으로 하는 것인, 이종이합체.
  2. 제1항에 있어서, 상기 제1 CH3 도메인 및 제2 CH3 도메인 중 K360에서의 아미노산 치환을 포함하는 도메인이 Q347에서의 아미노산 치환을 더 포함하거나,
    상기 제1 CH3 도메인 및 제2 CH3 도메인 중 Q347에서의 아미노산 치환을 포함하는 도메인이 K360에서의 아미노산 치환을 더 포함하거나, 또는
    상기 제1 CH3 도메인 및 제2 CH3 도메인 중 K360에서의 아미노산 치환을 포함하는 도메인이 Q347에서의 아미노산 치환을 더 포함하고, Q347에서의 아미노산 치환을 포함하는 도메인이 K360에서의 아미노산 치환을 더 포함하는 것인, 이종이합체.
  3. 제1항 또는 제2항에 있어서, K360 또는 Q347에서의 아미노산 치환이 생리학적 pH에서 양전하 또는 음전하를 띠는 아미노산으로의 치환을 포함하는 것인, 이종이합체.
  4. 제3항에 있어서, (a) 상기 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있는 경우, 다른 한 도메인의 K360은 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있고,
    이 때 상기 Q347이 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있는 도메인은 K360에서 생리학적 pH에서 양전하를 띠는 아미노산으로의 치환을 더 포함할 수 있고,
    상기 K360이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 다른 한 도메인은 Q347에서 생리학적 pH에서 음전하를 띠는 아미노산으로의 치환을 더 포함할 수 있거나, 또는
    (b) 상기 제1 CH3 도메인과 제2 CH3 도메인 중 어느 한 도메인의 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 경우, 다른 한 도메인의 K360은 생리학적 pH에서 양전하를 띠는 아미노산으로 치환되어 있고, 이 때 상기 Q347이 생리학적 pH에서 음전하를 띠는 아미노산으로 치환되어 있는 도메인은 K360에서 생리학적 pH에서 음전하를 띠는 아미노산으로의 치환을 더 포함하는 것인, 이종이합체.
  5. 제3항에 있어서, 양전하를 띠는 아미노산이 라이신(K) 또는 아르기닌(R)이고, 음전하를 띠는 아미노산이 아스파르트산(D) 또는 글루탐산(E)인, 이종이합체.
  6. 제1항 또는 제2항에 있어서,
    (A1) 상기 제1 CH3 도메인이 T366W 및 K360E의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인이 T366S, L368A, Y407V 및 Q347R의 아미노산 치환을 포함하거나,
    (A2) 상기 제1 CH3 도메인이 T366W 및 Q347R의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인이 T366S, L368A, Y407V 및 K360E의 아미노산 치환을 포함하거나,
    (A3) 상기 제1 CH3 도메인이 T366W, K360R 및 Q347R의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인이 T366S, L368A, Y407V, K360E 및 Q347E의 아미노산 치환을 포함하거나, 또는
    (A4) 상기 제1 CH3 도메인이 T366W, K360E 및 Q347E의 아미노산 치환을 포함하고, 상기 제2 CH3 도메인이 T366S, L368A, Y407V, K360R 및 Q347R의 아미노산 치환을 포함하는 것인, 이종이합체.
  7. 제1항 또는 제2항에 있어서, 상기 CH3 도메인이 IgG, IgM, IgA, IgD 및 IgE로 이루어진 군으로부터 선택된 면역글로불린에 포함되는 것인, 이종이합체.
  8. 제1항 또는 제2항에 있어서, 상기 제1 폴리펩티드 및 제2 폴리펩티드 중 하나 이상의 폴리펩티드에 연결된 하나 이상의 결합 도메인 단백질 또는 약물을 더 포함하는, 이종이합체.
  9. 제8항에 있어서, 상기 연결이 직접 연결, 또는 1 내지 50개의 아미노산으로 구성된 펩티드에 의한 연결인, 이종이합체.
  10. 제8항에 있어서, 상기 결합 도메인 단백질이 항체의 항원 결합 영역, 수용체 유래 단백질, 사이토카인 및 호르몬으로 구성된 군에서 선택되는 1종 이상인, 이종이합체.
  11. 제10항에 있어서, 상기 항원 결합 영역이 Fab, scFab, sdAb, scFv, di-scFv 또는 (dsFv)2 형태인, 이종이합체.
  12. 제8항에 있어서, 상기 이종이합체가 2개 이상의 표적 단백질에 결합 가능한 이중특이적 또는 다중특이적 항체 또는 이중특이적 또는 다중특이적 융합 단백질인, 이종이합체.
  13. 제1항 또는 제2항의 이종이합체를 코딩하는 폴리뉴클레오티드.
  14. 제13항의 폴리뉴클레오티드를 포함하는 발현 벡터.
  15. 제13항의 폴리뉴클레오티드 또는 이를 포함하는 발현 벡터를 포함하는 숙주 세포.
  16. 제1항 또는 제2항의 이종이합체를 코딩하는 1종 이상의 발현 벡터를 준비하는 단계; 및
    상기 발현 벡터를 숙주 세포에서 발현시키고 단백질을 수득하여 이종이합체를 형성하는 단계
    를 포함하는, 이종이합체 제조방법.
  17. 제16항에 있어서, 상기 발현 벡터가, 제1 폴리펩티드의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열 및 제2 폴리펩티드의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 것인, 이종이합체 제조방법.
  18. 제16항에 있어서, 상기 발현 벡터가, 제1 폴리펩티드의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 제1 발현 벡터, 및 제2 폴리펩티드의 아미노산 서열을 코딩하는 폴리뉴클레오티드 서열을 포함하는 제2 발현 벡터를 포함하는 것인, 이종이합체 제조방법.
  19. 제18항에 있어서, 이종이합체 형성 단계에서, 상기 제1 발현 벡터 및 제2 발현 벡터를 숙주 세포에서 각각 발현시켜 2종의 단백질을 수득하고 혼합 반응시켜 이종이합체를 형성하는 것인, 이종이합체 제조방법.
  20. 제18항에 있어서, 이종이합체 형성 단계에서, 상기 제1 발현 벡터 및 제2 발현 벡터를 숙주 세포에서 동시 발현시켜 이종이합체를 수득하는 것인, 이종이합체 제조방법.
PCT/KR2022/017565 2021-11-09 2022-11-09 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법 Ceased WO2023085779A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020247019363A KR20240116743A (ko) 2021-11-09 2022-11-09 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2021-0153428 2021-11-09
KR20210153428 2021-11-09

Publications (1)

Publication Number Publication Date
WO2023085779A1 true WO2023085779A1 (ko) 2023-05-19

Family

ID=86336195

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/017565 Ceased WO2023085779A1 (ko) 2021-11-09 2022-11-09 Fc 변이체를 포함하는 이종이합체 및 이의 제조방법

Country Status (2)

Country Link
KR (1) KR20240116743A (ko)
WO (1) WO2023085779A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101247908B1 (ko) * 2004-09-02 2013-03-26 제넨테크, 인크. 항-fc-감마 riib 수용체 항체 및 그의 용도
KR20140067944A (ko) * 2012-11-27 2014-06-05 아주대학교산학협력단 항체 중쇄불변부위의 이종이중체 고효율 형성을 유도하는 ch3 도메인 변이체 쌍, 이의 제조방법, 및 용도
KR20180026279A (ko) * 2016-09-02 2018-03-12 고려대학교 산학협력단 항체 중쇄불변부위 이종이중체 (heterodimeric Fc)에 융합된 IL-21 (heterodimeric Fc-fused IL-21) 및 이를 포함하는 약제학적 조성물
US20180362668A1 (en) * 2015-12-16 2018-12-20 Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Heterodimer molecule based on ch3 domain, and preparation method and use thereof
KR20210064199A (ko) * 2018-08-16 2021-06-02 데날리 테라퓨틱스 인크. 조작된 이중특이성 단백질

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101247908B1 (ko) * 2004-09-02 2013-03-26 제넨테크, 인크. 항-fc-감마 riib 수용체 항체 및 그의 용도
KR20140067944A (ko) * 2012-11-27 2014-06-05 아주대학교산학협력단 항체 중쇄불변부위의 이종이중체 고효율 형성을 유도하는 ch3 도메인 변이체 쌍, 이의 제조방법, 및 용도
US20180362668A1 (en) * 2015-12-16 2018-12-20 Jiangsu Alphamab Biopharmaceuticals Co., Ltd. Heterodimer molecule based on ch3 domain, and preparation method and use thereof
KR20180026279A (ko) * 2016-09-02 2018-03-12 고려대학교 산학협력단 항체 중쇄불변부위 이종이중체 (heterodimeric Fc)에 융합된 IL-21 (heterodimeric Fc-fused IL-21) 및 이를 포함하는 약제학적 조성물
KR20210064199A (ko) * 2018-08-16 2021-06-02 데날리 테라퓨틱스 인크. 조작된 이중특이성 단백질

Also Published As

Publication number Publication date
KR20240116743A (ko) 2024-07-30

Similar Documents

Publication Publication Date Title
JP7847584B2 (ja) 免疫細胞機能をモジュレートするためのcd8抗原結合分子を有する融合物
WO2014084607A1 (ko) 항체 중쇄불변부위의 이종이중체 고효율 형성을 유도하는 ch3 도메인 변이체 쌍, 이의 제조방법, 및 용도
WO2017052241A1 (en) Novel anti-mesothelin antibody and composition comprising the same
CN114786708A (zh) 用于调节免疫细胞功能的突变体白介素-2多肽与抗原结合分子的融合物
KR20210134725A (ko) Enpp3과 cd3에 결합하는 이종이량체 항체
CA3115020A1 (en) Antibodies binding to cd3
WO2017065484A1 (ko) 효모접합을 이용한 항체 ch3 도메인 이종이중체 돌연변이쌍 제조방법 및 이에 의하여 제조된 ch3 돌연변이체 쌍
US12122827B2 (en) IL-21 polypeptides and targeted constructs
WO2021071319A1 (ko) 다중 특이적 융합 단백질 및 이의 용도
WO2020231199A1 (ko) 신규 변형 면역글로불린 fc 융합단백질 및 그의 용도
WO2022169269A1 (ko) 항 ctla-4 항체 및 이의 용도
JP2023552829A (ja) 免疫細胞機能を調節するための変異インターロイキン-10ポリペプチドの抗原結合分子との融合物
WO2023043123A1 (ko) Fcγrⅲa 선택적 결합력 향상 당화 fc 변이체들
WO2022146003A1 (ko) 이중 또는 다중 특이적 항체
US20250339519A1 (en) Combination of cytokine fusion proteins with cd8 antigen binding molecules
WO2024242490A1 (ko) Ch3 도메인 변이체 또는 이를 포함하는 이중 특이적 항체
WO2022265331A1 (ko) 제어된 면역 작용 기작과 증가된 혈중 반감기를 갖는 fc변이체들
WO2023158027A1 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
WO2025147169A1 (en) Multispecific antibody for lysosomal degradation
KR20240116743A (ko) Fc 변이체를 포함하는 이종이합체 및 이의 제조방법
WO2018194376A1 (ko) 단백질의 순도 및 항원에 대한 친화성이 향상된 폴리펩티드, 이의 항체 또는 항원 결합 단편과의 복합체, 및 이들의 제조방법
WO2025092987A9 (zh) 基于Fc区的异二聚体分子及其用途
WO2026071797A1 (ko) 면역글로불린 fc-융합 단백질
EP4255924A1 (en) A fusion protein comprising an antigen binding domain and a cytokine trimer domain
AU2025205765A1 (en) Multispecific antibody for lysosomal degradation

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22893199

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 20247019363

Country of ref document: KR

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22893199

Country of ref document: EP

Kind code of ref document: A1