WO2023083846A1 - Antibody molecules and conjugates - Google Patents

Antibody molecules and conjugates Download PDF

Info

Publication number
WO2023083846A1
WO2023083846A1 PCT/EP2022/081225 EP2022081225W WO2023083846A1 WO 2023083846 A1 WO2023083846 A1 WO 2023083846A1 EP 2022081225 W EP2022081225 W EP 2022081225W WO 2023083846 A1 WO2023083846 A1 WO 2023083846A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
region
acid sequence
egfr
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2022/081225
Other languages
English (en)
French (fr)
Inventor
Frank Irvine COMER
Yariv Mazor
Srinath Kasturirangan
Qun DU
Chunning YANG
Andrew Grier Buchanan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
AstraZeneca AB
Original Assignee
AstraZeneca AB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202280086269.9A priority Critical patent/CN118556084A/zh
Priority to AU2022384597A priority patent/AU2022384597B2/en
Priority to KR1020247018705A priority patent/KR20240099430A/ko
Priority to IL312566A priority patent/IL312566A/en
Priority to EP22817545.1A priority patent/EP4429765A1/en
Priority to CA3237211A priority patent/CA3237211A1/en
Application filed by AstraZeneca AB filed Critical AstraZeneca AB
Priority to MX2024005712A priority patent/MX2024005712A/es
Priority to JP2024527384A priority patent/JP2024544520A/ja
Publication of WO2023083846A1 publication Critical patent/WO2023083846A1/en
Anticipated expiration legal-status Critical
Priority to CONC2024/0007192A priority patent/CO2024007192A2/es
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68037Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a camptothecin [CPT] or derivatives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35Valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77Internalization into the cell
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present disclosure relates to antibody molecules that bind epidermal growth factor receptor (EGFR) and/or c-Met and conjugates containing these antibody molecules.
  • EGFR epidermal growth factor receptor
  • the antibody molecules and conjugates find application in the treatment of cancer, for example.
  • Overcoming drug resistance is a major challenge facing targeted cancer therapies.
  • Mechanisms of resistance include secondary mutations, activation of oncogenic downstream signaling modules such as KRAS, ligand upregulation, and amplification of alternate growth factor receptors.
  • KRAS oncogenic downstream signaling modules
  • ligand upregulation ligand upregulation
  • amplification of alternate growth factor receptors For example, MET amplification or protein overexpression has been well established as an important mechanism of clinical resistance to EGFR inhibitors.
  • ADC antibody drug conjugates
  • ADC are a growing class of targeted therapies designed to selectively deliver cytotoxic drugs directly to tumor cells (Angevin, 2017; Junutula, 2016; Lambert, 2017; Nasiri, 2018; Sau, 2017; Phillips, 2016).
  • the antigen targeted by the antibody is primarily used as a handle for delivery of the cytotoxic drug and the mechanism of killing is generally distinct from the biology of the target.
  • ADC’s have the potential to largely avoid resistance due to activation of alternative receptors or downstream signaling pathways, provided that the target is present.
  • adverse events due to engagement of the target on normal cells can limit the therapeutic index of ADC’s (Hinrichs, 2015; Donaghy, 2016; Sau, 2017).
  • Bispecific antibody technology may confer additional specificity to ADC’s by engaging two distinct targets on tumor cells to effectively deliver the cytotoxic payload when both targets are present (Comer, 2018; Andreev, 2017; Kontermann, 2015; Lii, 2017; Brinkmann, 2017; Fan, 2015; Mazor, 2017).
  • bispecific ADC bispecific ADC
  • the Epidermal Growth Factor Receptor (EGFR, HER1 , Erbbl) is the founding member of the Human Epidermal Growth Factor Receptor (HER) tyrosine kinase family, which also includes HER2/Erbb2, HER3/Erbb3, and HER4/Erbb4 (Arteaga, 2014; Rocha-Lima, 2007; Seshacharyulu, 2012; Vecchione, 2011 ; Nicholson, 2001).
  • Numerous therapies directed against EGFR have been approved, in both the biologies and small molecule tyrosine kinase inhibitor (TKI) classes (Troiani, 2016; Chong, 2013; Chan, 2017; Remon, 2018; Dokala, 2016).
  • TKI small molecule tyrosine kinase inhibitor
  • c-MET is the gene product of the proto-oncogene, MET, which is encoded on chromosome 7.
  • the c-MET protein is a receptor tyrosine kinase, expressed primarily on the surface of epithelial cells, which recognizes only one known ligand, the hepatocyte growth factor (HGF), also known as scatter factor (Giordano, 1989; Prat, 1991).
  • HGF hepatocyte growth factor
  • the c-MET/HGF signaling axis has an essential role in regulating proliferation, differentiation, motility, and morphogenesis in a number of normal processes, including wound healing, tissue regeneration and organogenesis during development (Organ, 2011).
  • Aberrant expression and dysregulation of the c-MET pathway has been reported for a wide variety of human cancers, including non-small cell lung, colorectal, gastrointestinal, head and neck, pancreatic, renal, and hepatocellular cancers, among many others (Organ, 2011 ; Birchmeier, 2003; Mo, 2017; Sierra, 2011 ; Trusolino, 2010; Peters, 2012; Vsiansky, 2018).
  • c-MET overexpression is negatively associated with prognosis and survival (Yan, 2015; Kim, 2017a; Kim, 2017b; Kim, 2017c; Li, 2011 ; Kondo, 2013; Miyamoto, 2011 ; Liu, 2015; Miyamoto, 2011 ; Xu, 2016; Sacco, 2015; Gisterek, 2011 ; Belalcazar, 2012; Guo, 2014; Cappuzzo, 2009).
  • c- MET is associated with a cancer stem cell phenotype, which has been implicated in resistance to EGFR targeted therapies (Li, 2011 ; Boccaccio, 2014; Luraghi, 2014; Jun, 2013; De Bacco, 2012).
  • crizotinib a dual inhibitor of c-MET and ALK
  • other c-MET targeting drugs such as the one-armed c-MET antibody, MetMAb (onartuzumab), and the small molecule inhibitor, tivantinib
  • MetMAb onartuzumab
  • tivantinib small molecule inhibitor
  • ADC antibody drug conjugates
  • ABT-414 depatuxizumab mafodotin
  • ABT-414 was previously tested in Phase II trials for multiple additional solid tumor indications (ClinicalTrials.gov: NCT01741727).
  • the ADC showed limited efficacy at tolerated doses in these indications, and concerning ocular toxicities were frequently observed in treated patients (Tolcher, 2014).
  • a second generation EGFR ADC ABBV-221 was in clinical development but was discontinued due to safety concerns (Phillips, 2018; Calvo, 2017; company presentation).
  • c-MET targeted ADC Telisotuzumab Vedotin (ABBV-399)
  • NSCLC non-small cell lung cancer
  • erlotinib Angevin, 2017; Wang, 2017.
  • the c-MET ADC + EGFR TKI combination has shown clinical activity in Phase I trials in this selected patient population, with peripheral neuropathy and skin rash as the most frequent treatment related adverse events (Angevin, 2017; Calvo, 2017).
  • the nature of bispecific antibodies allows for fine tuning of the interactions between each target to impact the overall properties of the molecule, which could produce an ADC with an acceptable therapeutic window (Comer, 2018).
  • This concept has been tested for EGFR and c-MET in vitro, but investigators have yet to demonstrate proof of concept in vivo of an improvement in safety or efficacy compared to the EGFR and c-MET ADC’s noted above (Sellmann, 2016). Therefore, it would be beneficial take advantage of bispecific antibody strategies to develop an EGFR-cMET ADC that demonstrates both efficacy and an acceptable safety profile.
  • the present disclosure provides antibody molecules and conjugates having combinations of desirable biophysical and/or functional properties as compared to antibody molecules disclosed in the prior art.
  • aspects of the disclosure relate to an antibody molecule capable of binding both EGFR and c-Met.
  • EGFR and c-Met are co-expressed in many cancer types and antibody molecules that target both molecules (“bispecific antibody molecules”) provide an opportunity for broad clinical benefit across multiple indications.
  • the antibody molecule represents an improved treatment for cancers as compared to monospecific EGFR or c-Met antibodies of the prior art, because the bispecific antibody molecules described herein are capable of binding to both targets simultaneously and therefore have increased selectively for tumours co-expressing EGFR and c-MET as compared to normal tissues.
  • the disclosure provides an antibody molecule comprising: a first antigen-binding domain that binds epidermal growth factor receptor (EGFR); and a second antigen-binding domain that binds c-Met, wherein the first antigen-binding domain comprises:
  • VH heavy chain variable region comprising the following complementarity determining regions (CDRs): HCDR1 having the amino acid sequence of SEQ ID NO: 1
  • HCDR2 having the amino acid sequence of SEQ ID NO: 2
  • HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid;
  • VL light chain variable
  • LCDR1 having the amino acid sequence of SEQ ID NO: 4
  • LCDR2 having the amino acid sequence of SEQ ID NO: 5
  • LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid.
  • conjugates containing this antibody molecule are able to selectively deliver a drug (also referred to as a “payload” or “warhead”) to tumours co-expressing these targets and treat these tumours with a high degree of efficacy.
  • a drug also referred to as a “payload” or “warhead”
  • warhead e.g. a tubulysin or a topoisomerase I inhibitor
  • the disclosure provides a conjugate comprising an antibody molecule described herein conjugated to a drug.
  • the drug is a topoisomerase I inhibitor, e.g. a topoisomerase inhibitor having formula A*
  • the antibody molecule is conjugated to a topoisomerase I inhibitor having the following formula:
  • the antibody molecule comprises a first antigen-binding domain that binds to human EGFR with a “low affinity”.
  • “low affinity” refers to a first antigen-binding domain that binds to human EGFR with a dissociation constant (Kd) that is equal to or higher than 10 nM.
  • antibodies and conjugates disclosed herein comprising such a low affinity EGFR antigen-binding domain display reduced on-target toxicity in normal tissues such as skin toxicity and therefore have an improved safety profile compared to conjugates comprising an EGFR antigen-binding domain that binds human EGFR with a “higher affinity”.
  • “higher affinity” or “high affinity” refers to a first antigen binding domain that binds to human EGFR with a Kd that is lower than 10 nM.
  • conjugates comprising a low affinity EGFR antigen-binding domain are more efficacious at treating cancer compared to conjugates comprising a higher affinity EGFR antigenbinding domain (e.g., FIG 12).
  • the disclosure also provides antibody molecules comprising a first antigen-binding domain that binds EGFR and antibody molecules comprising a second antigen-binding domain that binds c-Met, as defined herein.
  • compositions comprising the antibody molecules defined herein or the conjugates defined herein.
  • the disclosure provides antibody molecules, conjugates and pharmaceutical compositions, all as defined herein, for use in a method of treatment of the human or animal body, such as a method of treatment of a cancer.
  • the disclosure provides methods of treating cancer comprising administering an antibody molecule, conjugate or pharmaceutical composition as defined herein.
  • the disclosure provides methods of treating a cancer selected from pancreatic cancer, colorectal cancer, non-small cell lung cancer (NSCLC) and squamous head and neck carcinoma (SQHN), comprising administering an antibody molecule, conjugate or pharmaceutical composition as defined herein.
  • the cancer for treatment is NSCLC.
  • the disclosure also provides nucleic acids, vectors and host cells as defined herein. Further, the disclosure provides a method of producing an antibody molecule as defined herein.
  • the disclosure includes the combination of the aspects and preferred features described except where such a combination is clearly impermissible or expressly avoided.
  • FIG 1 A Graphical depiction of RAA22/B09-57. Shown are the Fabs of anti-EGFR RAA22, Fab of anti- cMET B09-57 and Hole and Knob heavy chains. The structural rendering is a composite of individual domain structures.
  • FIG 1B Graphical depiction of QD06/B09-57. Shown are the Fabs of anti-EGFR QD06, Fab of anti-cMET B09-57 and Hole and Knob heavy chains. The structural rendering is a composite of individual domain structures.
  • FIG 3A ELISA results showing EGFR and c-Met species cross reactivity.
  • FIG 3B ELISA results showing EGFR and c-Met family specificity. None of the antibodies tested showed any appreciable binding to any of the EGFR HER family proteins (HER2, HER3, or HER4) or any of the c- Met family members (Ron (CD136) or Semaphorin 3a).
  • FIG 4 Internalization of RAA22/B09 bispecific mAb and trafficking to acidified intracellular compartments was visualized using antibodies labeled with pHAb pH sensitive dye (Promega).
  • Control antibodies included R347 isotype control and the monovalent bispecific control antibodies anti-EGFR RAA22/R347 and anti-cMET B09/R347.
  • the pHAb labelled antibodies were incubated with NCI-H1975 lung cancer cells at a concentration of 1 .25 ug/mL in a humidified incubator at 37°C and 5% CO2. Fluorescent images were captured at the indicated time points on an Operetta High Content Imaging system using the Cy3 filter. Increased cellular fluorescence intensity over time was deemed evidence of internalization and trafficking to acidic intracellular compartments as measured by the pH sensitive fluor.
  • FIG 5 As in FIG 4, internalization of RAA22/B09 bispecific mAb and trafficking to acidified intracellular compartments was visualized using antibodies labeled with pHAb pH sensitive dye, but the cells were treated with antibodies at the lower concentration of 0.625 ug/mL.
  • FIG 6A Kinetic of QD6/B09 and RAA22/B09 monoclonal antibody (mAb) internalization in H1975 cells, (a) Image overlays of cells labeled with CellTracker Blue CMAC for cytoplasm (blue) and with 2.5 ug/mL of QD6/B09-AlexaFluor647 (magenta, top panel) or 2.5 ug/mL of RAA22/B09AlexaFluor-647 (magenta, bottom panel) at the start of internalization and 1 hr after. Cells were labeled with CellTracker Blue CMAC, then bound with mAbs-AlexaFuor6457 at 2-8°C and subjected to internalization condition: (37°C, 70% humidity and 5% CO2).
  • FIG 6B Kinetic of QD6/B09 and RAA22/B09 monoclonal antibody (mAb) internalization in H1975 cells.
  • Time course of mAb-AlexaFluor647 internalization determined by quantitative analysis of kinetic images using the algorithm (Material and Methods). Kinetic images taken at 5-minute intervals were processed using the algorithm (Vainshtein, 2015) to determine antibody accumulation in cytoplasm.
  • Antibody signals in cytoplasm normalized to antibody fluorescence in the cell (fraction in cytoplasm) for QD6/B09- AlexaFluor647 (red) versus RAA22/B09-AlexaFluor647 (blue) are shown for one of the three independent experiments.
  • FIG 7A Internalization profiles of QD6/B09 DuetMab and its respective single-arm control antibodies. Internalization profiles are displayed via time course of the respective membrane and cytoplasm signals for each construct. QD6/B09 set was acquired using an Opera confocal fluorescence microscope.
  • FIG 7B Internalization profiles of RAA22/B09 DuetMab and its respective single-arm control antibodies. Internalization profiles are displayed via time course of the respective membrane and cytoplasm signals for each construct. The set was acquired using a Zeiss spinning-disc confocal fluorescence microscope.
  • FIG 8A Internalization profile of RAA22/B09-AZD1508 ADC in cells expressing moderate and high target c-MET and EGFR cell surface receptors. Shown are membrane, cytoplasm and total signals for RAA22/B09-AF647 ADC in H1975 cells. One representative experiment of 2 is shown. H1975 cells show concurrent drop in total and membrane intensities indicating dissociation of antibody from the cell surface.
  • FIG 8B is equivalent to FIG 8A but in HCC827 cells.
  • HCC827 cells have stable total signal over experimental time course. Decrease of membrane signal is derived antibody internalization.
  • FIG 9A Internalization of RAA22/B09-AZD1508 ADC single arm control antibodies in HCC827cells. Intensity profiles of the RAA22/lgG single arm is ⁇ 10 fold lower than RAA22/B09 due to weaker binding to EGFR through single arm binding
  • FIG 9B B09/lgG single arm dissociates from cell membrane as signaled by simultaneous drop in total and membrane signals over time.
  • FIG 10. Blockade of EGFR or cMETR reduces bispefic ADC activity in vitro. NCI H1975 cells were pretreated with an excess of unarmed parental antibodies to block either EGFR or cMET. Next, EGFR- cMET ADC (RAA22/B09-AZ1508) was added to cells in a 4X serial dilution series with a final concentration ranging from 67 nM down to 0.0009 nM. The treated cells were cultured for 72 hours in a humidified incubator at 37°C and 5% CO2.
  • the metabolic activity was determined using CellTiter-Glo Luminescent Viability Assay (Promega). Data are plotted as percent metabolic activity relative to untreated control. IC50 values were determined using logistic non-linear regression analysis between the maximal viability (untreated cells) and the maximal response (peak inhibition) with GraphPad Prism software.
  • FIG 11. Monovalent ADCs against EGFR or cMET have reduced activity in vitro compared to bispecifc EGFR/cMET ADC.
  • Monovalent ADCs were constructed by pairing each binding arm with a non-binding isotype control arm (R347) to produce EGFR ADC (RAA22/R347-AZ1508) and anti-cMET ADC (B09/R347-AZ1508), The ADCs were added to NCI H1975 cells in a 4X serial dilution series with a final concentration ranging from 67 nM down to 0.0009 nM. Percent metabolic activity was determined as described in FIG 9.
  • FIG 12A Shows results of mouse PDX trials carried out to determine the efficacy of high affinity (QD6/B09-AZ1508) and low affinity (RAA22/B09-AZ1508) EGFR-cMET ADCs in a large number of patient derived xenograft (PDX) models of human cancer in immunodeficient mice. Each compound was tested at a single dose level of 3 mg/kg in a single mouse for each PDX model representing a different human tumor. Percent tumor growth relative to untreated control tumors (%T/C) was calculated for tumors that grew larger than the initial volume and percent tumor regression was calculated for tumors that showed a reduction in size compared to the initial tumor volume. (A) shows the direct comparison of the high and low affinity ADCs in each model and
  • FIG 12B shows waterfall plots for QD6/B09-AZ1508 in rank order of efficacy
  • FIG 12C shows waterfall plots for RAA22/B09-AZ1508 in rank order of efficacy
  • FIG 13 Dose range finding in vivo efficacy studies in PDX models were carried out in athymic nude mice implanted unilaterally on the flank with tumor fragments harvested from host animals.
  • Tumor volume measurements were taken twice weekly following the initiation of dosing and plotted as line graphs of tumor volume overtime. Error bars represent standard error of the means (SEM) and the inset images show the immunohistochemical staining of EGFR and cMET for each model, from tumor tissue taken from an earlier passage of the model.
  • FIG 14A In vivo efficacy of EGFR-cMET bispecific ADCs in a subcutaneous and orthotopic Pancreatic PDX model.
  • A) In vivo efficacy of the High Affinity QD6/B09 ADC in the subcutaneous MEDI-PANC-08 PDX model, • - Untreated, ⁇ - R347-AZ1508 (3 mg/kg - Q1V ⁇ ft ⁇ 4), ⁇ - QD6/B09-1508 (1 mg/kg - Q1 Wx4), ⁇ - QD6/B09-1508 (2 mg/kg - Q1Wx4) and • - QD6/B09-1508 (3 mg/kg - Q1 Wx4). Tumor volumes were measure twice a week.
  • FIG 14B In vivo efficacy of the Low Affinity RAA2/B09 ADC in the subcutaneous MEDI-PANC-08 PDX model. • - Untreated, ⁇ - R347-AZ1508 (3 mg/kg - Q1V ⁇ ft ⁇ 4), ⁇ - RAA2/B09-1508 (1 mg/kg - Q1Wx4), ⁇ - RAA2/B09-1508 (2 mg/kg - Q1 Wx4) and • - RAA2/B09-1508 (3 mg/kg - Q1Wx4). Tumor volumes were measure twice a week.
  • FIG 14C Luciferase imaging of the orthotopic MEDI-PANC-08 LUC (luciferase expressing) PDX model. Mice were imaged weekly using the I VIS Spectrum In vivo Imaging system. The images are normalized across all groups and timepoints with the radiance scale (Avg Radiance [p/s/cm2/sr]) set between the max signal (Day 21 Control Gp) and background.
  • radiance scale Avg Radiance [p/s/cm2/sr]
  • FIG 14D In vivo efficacy of the Low Affinity RAA2/B09 ADC in the subcutaneous MEDI-PANC-08 PDX model. • - Untreated, ⁇ - Gemcitabine (75 mg/kg - Q3/4Dx5), ⁇ R347-AZ1508 (3 mg/kg - Q1Wx4), ⁇ - RAA2/B09-1508 (2 mg/kg - Q1 Wx4) and • - RAA2/B09-1508 (3 mg/kg - Q1 Wx4). Treatment days are indicated by the arrows, tumor volumes were measure twice a week.
  • the data displayed in panels A and B are the group mean tumor volume (mm 3 ) ⁇ SEM, in panel D group mean Radiance [p/s/cm 2 /sr] ⁇ SEM.
  • FIG 15A Mean concentrations-time profiles and mean NCA PK parameters for RAA22/B09-57-AZ1508 in Mice. The target compound concentration and the total antibody concentration were measured with an immuno capture LC-MS/MS assay.
  • FIG 15B Mean concentrations-time profiles and mean NCA PK parameters for QD6/B09-57-AZ1508 in Mice. The target compound concentration and the total antibody concentration were measured with an immuno capture LC-MS/MS assay.
  • the signature tryptic peptide on the human antibody Fc region and the cleaved warhead was separated using reversed phase chromatography (RPLC) followed with detection using multiple reaction monitoring (MRM).
  • the signature peptide on the Fc region (VVSVLTVLHQDWLNGK) was used to calculate total Ab, while the digestion released warhead was used to calculate the RAA22/B09 ADC .
  • the internal standard used in this experiment are isotopically labeled peptide or protein (SiluMAb, Sigma-Aldrich) or isotopically labeled warhead.
  • the peak area ratio of the analyte against the internal standards was used to calculate against the standard curve.
  • the standard curves and QCs are prepared by spiking RAA22/B09 ADC at different levels into the same matrix as the samples.
  • the quantification range covers 100 ng/mL-15,000 ng/mL, with the dilution QC covering up to 525,000 ng/mL.
  • the standard curve was fitted with the simplest possible model. The accuracy and precision of the assay is within 20% for all levels except the LLOQ, which is at 25%.
  • FIG 16A Mean concentrations-time profiles for RAA22/B09-57-AZ1508 in Monkeys. Cynomolgus monkey plasma samples were collected and processed using the immuno capture LC-MS/MS assay and noncompartmental PK analysis as described in FIG 15.
  • FIG 16B Mean concentrations-time profiles for QD6/B09-57-AZ1508 in Monkeys. Cynomolgus monkey plasma samples were collected and processed using the immuno capture LC-MS/MS assay and noncompartmental PK analysis as described in FIG 15.
  • FIG 16C mean NCA PK parameters for QD6/B09-57-AZ1508 in Monkeys. NCA PK parameters for QD6/B09-57-AZ1508 at 3 mg/kg in 20067312 was based on PK data following second dose. All other results were based on PK data following first dose. Cynomolgus monkey plasma samples were collected and processed using the immuno capture LC-MS/MS assay and non-compartmental PK analysis as described in FIG 15. FIG 17 EGFR-cMET Maia Topoi ADC was evaluated in patient derived xenograft (PDX) models representing multiple types of human cancer in immunodeficient mice as a PDX trial.
  • PDX patient derived xenograft
  • %T/C Percent tumor growth relative to untreated control tumors
  • %TGI Tumor growth inhibition
  • Percent Tumor Regression (TXfinal avg - TXinitial avg)/(TXinitial avg) x 100).
  • Percent Tumor Regression (TXfinal avg - TXinitial avg)/(TXinitial avg) x 100).
  • FIG 19A Two different EGFR-cMET ADCs with different IgG Fc formats (Maia and TM) were evaluated for comparability in the SQHN-02 PDX model.
  • the ADCs were tested at 3 dose levels: 2.5, 5, and 10 mg/kg and tumor growth was compared against untreated control animals. A total of 10 animals were treated per treatment and control group.
  • FIG 19B Two different EGFR-cMET ADCs with different IgG Fc formats (Maia and TM) were evaluated for comparability in the Panc-08 PDX model.
  • the ADCs were tested at 3 dose levels: 2.5, 5, and 10 mg/kg and tumor growth was compared against untreated control animals. A total of 10 animals were treated per treatment and control group.
  • FIG 20 depicts the results of the non-small cell lung cancer NSCLC PDX models from FIG 17 above, highlighting the EGFR mutation status and histology, where known.
  • FIG 21 The pharmacokinetic profiles of EGFR-cMET bispecific antibodies INT-009 (RAA22/B09-Maia naked mAb) and INT-009-SG3932 DAR8 ADC (“MAIA ADC”) were compared to B09/RAA2-lgG1-TM mirror mAb (INT-017) and TM-mirror-SG3932 DAR6 ADC (“TM ADC”) in NOD-SCID mice at therapeutic doses of 5 mg/kg.
  • FIG 22 shows a comparison of EGFR and cMet receptor degradation after treatment with EGFR-cMET Topoi TM ADC vs Amivantamab
  • Human EGFR (also known as proto-oncogene c-ErbB-1 , receptor tyrosine-protein kinase erbB-1 and EC 2.7.10.1) is the protein identified by UniProt P00533.
  • Alternative splicing of mRNA encoded by the human EGFR gene (also known as ERBB, ERBB1 and HERT) yields four isoforms: isoform 1 (UniProt: P00533-1 , v2 (last sequence update: November 1 , 1997)); isoform 2 (UniProt: P00533-2, v1), which comprises the substitutions F404L and L405S relative to isoform 1 , and which lacks the amino acid sequence corresponding to positions 406 to 1210 of isoform 1 ; isoform 3 (UniProt: P00533-3, v1), which comprises substitutions at position 628 to 705 of isoform 1 , and which lacks the amino acid sequence corresponding to positions 706 to
  • EGFR is a transmembrane protein that is a receptor for members of the epidermal growth factor family (EGF family).
  • the receptor comprises a large extracellular region, a single spanning transmembrane domain, an intracellular juxtamembrane domain, a tyrosine kinase domain and a C-terminal regulatory region. Binding of EGFR to a ligand induces receptor dimerization and autophosphorylation of several tyrosine residues (Y992, Y1045, Y1068, Y1148 and Y1173) in the C-terminal regulatory region of EGFR.
  • EGFR refers to EGFR from any species and includes EGFR isoforms, fragments, variants or homologues from any species.
  • Human c-Met also known as Hepatocyte growth factor receptor (HGFR) or tyrosine-protein kinase Met
  • HGFR Hepatocyte growth factor receptor
  • Met tyrosine-protein kinase Met
  • isoform 1 UniProt: P08581-1 , v4 (last sequence update: July 7, 2009)
  • isoform 2 UniProt: P08581-2
  • isoform 3 (UniProt: P08581-3) also known as Soluble met variant 4, in which the amino acid sequence corresponding to positions 755 to 764 of isoform 1 are substituted with “RHVNIALIQR” and which further lacks the amino acid sequence corresponding to positions 765 to 1390 of isoform 1 .
  • c-Met is a heterodimer made of an alpha chain (50 kDa) and a beta chain (145 kDa), which are disulphide linked.
  • c-Met comprises a N-terminal Serna domain, which mediates binding to hepatocyte growth factor (HGF) and an intracellular kinase domain.
  • HGF hepatocyte growth factor
  • Ligand binding at the cell surface induces autophosphorylation of c-Met on its intracellular domain that provides docking sites for downstream signalling molecules and the activation of several signalling cascades.
  • c-Met is expressed in normal tissues on the surface of epithelial cells.
  • c-Met overexpression is observed in many human tumors and cancers, which is frequently associated with a metastatic phenotype and poor prognosis.
  • cancers where high levels of c-Met expression has been observed includes nonsmall cell lung cancer, pancreatic cancer, colorectal cancer, head and neck squamous cell carcinoma, breast cancer and esophageal-gastric cancer. In these cancers, co-expression of EGFR and c-Met is often observed.
  • Antibody molecules according to the present disclosure may be provided in isolated form, in the sense of being free from contaminants, such as antibodies able to bind other polypeptides and/or serum components.
  • antibody molecule describes an immunoglobulin whether natural or partly or wholly synthetically produced.
  • the antibody molecule may be human or humanised.
  • the antibody molecule is preferably a monoclonal antibody molecule.
  • examples of antibodies are the immunoglobulin isotypes, such as immunoglobulin G (IgG), and their isotypic subclasses, such as IgG 1 , lgG2, lgG3 and lgG4, as well as fragments thereof.
  • antibody molecule thus includes antibody fragments, as long as they display binding to the relevant target molecule(s).
  • antibody fragments include Fv, scFv, Fab, scFab, F(ab’)2, Fab2, diabodies, triabodies, scFv-Fc, minibodies and single domain antibodies (e.g. VhH), etc.).
  • antibody molecule is thus equivalent to “antibody molecule or fragment thereof’.
  • Antibody molecules and methods fortheir construction and use are well-known in the art and are described in, for example, Holliger & Hudson, Nature Biotechnology 23(9):1126-1136 (2005). It is possible to take monoclonal and other antibody molecules and use techniques of recombinant DNA technology to produce other antibody or chimeric molecules which retain the specificity of the original antibody. Such techniques may involve introducing CDRs or variable regions of one antibody molecule into a different antibody molecule (EP-A-184187, GB 2188638A and EP-A-239400).
  • antibody molecules can be prepared to most antigens.
  • the antigen-binding domain may be a part of an antibody (for example a Fab fragment) or a synthetic antibody fragment (for example a single chain Fv fragment (ScFv)).
  • Suitable monoclonal antibodies to selected antigens may be prepared by known techniques, for example those disclosed in “Monoclonal Antibodies: A manual of techniques ", H Zola (CRC Press, 1988) and in “Monoclonal Hybridoma Antibodies: Techniques and Applications ", J G R Hurrell (CRC Press, 1982). Chimaeric antibodies are discussed by Neuberger, 1988.
  • Antibody molecules according to the present disclosure comprise an antigen-binding domain.
  • An “antigen-binding domain” describes the part of a molecule that binds to all or part of the target antigen. Where an antigen is large, an antibody may only bind to a particular part of the antigen, which part is termed an epitope.
  • An antibody antigen-binding site may be provided by one or more antibody variable domains.
  • An antibody antigen-binding site preferably comprises a variable light (VL) region and variable heavy (VH) region. The VH and VL region of an antigen-binding domain together constitute the Fv region.
  • An antigen-binding domain generally comprises six complementarity-determining regions (CDRs); three in the VH region: HCDR1 , HCDR2 and HCDR3, and three in the VL region: LCDR1 , LCDR2, and LCDR3.
  • the six CDRs together define the paratope of the antigen-binding domain, which is the part of the antigen-binding domain which binds to the target antigen.
  • VH region and VL region comprise framework regions (FRs) either side of each CDR, which provide a scaffold for the CDRs.
  • FRs framework regions
  • VH regions comprise the following structure: N term-[HFR1]-[HCDR1]-[HFR2]-[HCDR2]-[HFR3]-[HCDR3]-[HFR4]-C term; and VL regions comprise the following structure: N term-[LFR1]-[LCDR1]-[LFR2]-[LCDR2]-[LFR3]-[LCDR3]-[LFR4]-C term.
  • antibody CDRs and FRs There are several different conventions for defining antibody CDRs and FRs, such as those described in Kabat, 1991 , Chothia, 1987, IMGT numbering as described in LeFranc, 2015, and VBASE2, as described in Retter, 2005.
  • the CDRs and FRs of the VH regions and VL regions of the antibody molecules described herein were defined according to Kabat (Kabat, 1991).
  • Antibody molecules that comprise at least two antigen-binding domains, each of which being capable of binding to a different target may be termed “bispecific antibody molecules”.
  • antibody molecules that only bind a single target e.g. EGFR or c-Met
  • the present disclosure provides a bispecific antibody molecule that comprises a first antigen binding domain that binds EGFR and a second antigen-binding domain that binds c-Met.
  • the antigen-binding domain that binds EGFR comprises the CDRs of an antibody molecule which is capable of binding to EGFR.
  • the antigen-binding domain that binds EGFR additionally comprises the FRs of an antibody molecule which is capable of binding to EGFR. That is, in some instances the antigen-binding domain that binds EGFR comprises the VH region and the VL region of an antibody molecule which is capable of binding to EGFR.
  • the antigen-binding domain that binds EGFR comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of an EGFR-binding antibody clone described herein (i.e. anti-EGFR antibody clones RAA22 or QD6).
  • the antigen-binding domain that binds EGFR comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of RAA22.
  • the antigen-binding domain that binds EGFR comprises the three HCDRs or three LCDRs, preferably the three VH CDRs and the three VL CDRs, of anti-EGFR antibody clones RAA22 or QD6, preferably RAA22.
  • the VH and VL domain sequences of antibodies RAA22 and QD6 are described herein, and the three VH and three VL domain CDRs of said antibodies may thus be determined from said sequences.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (1) or (2) below:
  • VH region comprising the following CDRs:
  • HCDR1 having the amino acid sequence of SEQ ID NO: 1
  • HCDR2 having the amino acid sequence of SEQ ID NO: 2
  • HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 ,
  • HCDR2, or HCDR3 are substituted with another amino acid, or
  • HCDR1 having the amino acid sequence of SEQ ID NO: 1
  • HCDR2 having the amino acid sequence of SEQ ID NO: 7
  • HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (1) above.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (1) or (2) above, wherein the VH region additionally comprises the FRs according to (3) below:
  • HFR2 having the amino acid sequence of SEQ ID NO: 9
  • HFR3 having the amino acid sequence of SEQ ID NO: 10
  • HFR4 having the amino acid sequence of SEQ ID NO: 11 , or a variant thereof in which one or two or three amino acids in one or more of HFR1 , HFR2, HFR3, or HFR4 are substituted with another amino acid.
  • the antigen-binding domain that binds EGFR comprises a VH region comprising the CDRs according to (1) or (2) above, and the FRs according to (3) above.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (4) or (5) below:
  • VH region comprising the CDRs according to (2) and the FRs according to (3).
  • the antigen-binding domain that binds EGFR comprises a VH region according to (4) above.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (6) or (7) below:
  • VH region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 16.
  • VH region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 18.
  • the antigen-binding domain that binds EGFR comprises a VH region according to (6) above.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (8) or (9) below:
  • VL region comprising the following CDRs:
  • LCDR1 having the amino acid sequence of SEQ ID NO: 4
  • LCDR2 having the amino acid sequence of SEQ ID NO: 5
  • LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of LCDR1 , LCDR2, or LCDR3 are substituted with another amino acid.
  • a VL region comprising the following CDRs:
  • LCDR1 having the amino acid sequence of SEQ ID NO: 4
  • LCDR2 having the amino acid sequence of SEQ ID NO: 66
  • LCDR3 having the amino acid sequence of SEQ ID NO: 67, or a variant thereof in which one or two or three amino acids in one or more of LCDR1 , LCDR2, or LCDR3 are substituted with another amino acid.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (8) above.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (8) or (9) above, wherein the VL region additionally comprises the FRs according to (10) below:
  • LFR2 having the amino acid sequence of SEQ ID NO: 13
  • LFR3 having the amino acid sequence of SEQ ID NO: 14
  • LFR4 having the amino acid sequence of SEQ ID NO: 15, or a variant thereof in which one or two or three amino acids in one or more of LFR1 ,
  • LFR2, LFR3, or LFR4 are substituted with another amino acid.
  • the antigen-binding domain that binds EGFR comprises a VL region comprising the CDRs according to (8) or (9) above, and the FRs according to (10) above.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (11) or (12) below:
  • the antigen-binding domain that binds EGFR comprises a VL region according to (11) above.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (13) or (14) below:
  • VL region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 20.
  • VL region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 22.
  • the antigen-binding domain that binds EGFR comprises a VL region according to (13) above.
  • the antigen-binding domain that binds EGFR comprises a VH region according to any one of (1) to (7) above, and a VL region according to any one of (8) to (14) above.
  • the antigen-binding domain comprises a VH region according to any one of (1), (4) and (6) and a VL region according to any one of (8), (11) and (13).
  • the antigen-binding domain comprises a VH region according to any one of (2), (5) and (7) and a VL region according to any one of (9), (12), and (14).
  • the antigen-binding domain that binds c-Met comprises the CDRs of an antibody molecule which is capable of binding to c-Met.
  • the antigen-binding domain that binds c-Met additionally comprises the FRs of an antibody molecule which is capable of binding to c-Met. That is, in some instances the antigen-binding domain that binds c-Met comprises the VH region and the VL region of an antibody molecule which is capable of binding to c-Met.
  • the antigen-binding domain that binds c-Met comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of a c-Met-binding antibody clone described herein (i.e. anti-c-Met antibody clone B09-GL).
  • the antigen-binding domain that binds c-Met comprises the three HCDRs or three LCDRs, preferably the three VH CDRs and the three VL CDRs, of c-Met-binding antibody clone B09-GL.
  • the VH and VL domain sequences of antibodies B09-GL are described herein, and the three VH and three VL domain CDRs of said antibodies may thus be determined from said sequences.
  • the antigen-binding domain that binds c-Met comprises a VH region according to (15) below:
  • VH region comprising the following CDRs:
  • HCDR1 having the amino acid sequence of SEQ ID NO: 24
  • HCDR2 having the amino acid sequence of SEQ ID NO: 25
  • HCDR3 having the amino acid sequence of SEQ ID NO: 26, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid.
  • the antigen-binding domain that binds c-Met comprises a VH region according to (15) above, wherein the VH region additionally comprises the FRs according to (16) below:
  • HFR1 having the amino acid sequence of SEQ ID NO: 30
  • HFR2 having the amino acid sequence of SEQ ID NO: 31
  • HFR3 having the amino acid sequence of SEQ ID NO: 32
  • HFR4 having the amino acid sequence of SEQ ID NO: 33, or a variant thereof in which one or two or three amino acids in one or more of HFR1 , HFR2, HFR3, or HFR4 are substituted with another amino acid.
  • the antigen-binding domain that binds c-Met comprises a VH according to (17) below: (17) a VH region comprising the CDRs according to (15) and the FRs according to (16).
  • the antigen-binding domain that binds c-Met comprises a VH region according to (18) below:
  • VH region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 38.
  • the antigen-binding domain that binds c-Met comprises a VL region according to (19) below:
  • VL region comprising the following CDRs:
  • LCDR1 having the amino acid sequence of SEQ ID NO: 27
  • LCDR2 having the amino acid sequence of SEQ ID NO: 28
  • LCDR3 having the amino acid sequence of SEQ ID NO: 29, or a variant thereof in which one or two or three amino acids in one or more of LCDR1 , LCDR2, or LCDR3 are substituted with another amino acid.
  • the antigen-binding domain that binds c-Met comprises a VL region according to (19) above, wherein the VL region additionally comprises the FRs according to (20) below:
  • LFR2 having the amino acid sequence of SEQ ID NO: 35
  • LFR3 having the amino acid sequence of SEQ ID NO: 36
  • LFR4 having the amino acid sequence of SEQ ID NO: 37, or a variant thereof in which one or two or three amino acids in one or more of LFR1 ,
  • LFR2, LFR3, or LFR4 are substituted with another amino acid.
  • the antigen-binding domain that binds c-Met comprises a VL region according to (21) below:
  • the antigen-binding domain that binds c-Met comprises a VL region according to (22) below:
  • VL region comprising an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 40.
  • the antigen-binding domain that binds c-Met comprises a VH region according to any one of (15) to (18) above, and a VL region according to any one of (19) to (22) above.
  • Antigen-binding domains of a bispecific antibody molecule comprises a VH region according to any one of (15) to (18) above, and a VL region according to any one of (19) to (22) above.
  • the invention provides an antibody molecule (i.e. a bispecific antibody molecule) comprising a first antigen-binding domain that comprises the CDRs of an antigen-binding domain which is capable of binding to EGFR, and a second antigen-binding domain that comprises the CDRs of an antigen-binding domain which is capable of binding to c-Met.
  • the first antigen-binding domain comprises the CDRs and the FRs of an antigen-binding domain which is capable of binding to EGFR
  • the second antigen-binding domain comprises the CDRs and the FRs of an antigen-binding domain which is capable of binding to c-Met.
  • the antibody molecule comprises a first antigenbinding domain comprising the VH region and the VL region of an antigen-binding domain which is capable of binding to EGFR and a second antigen-binding domain comprising the VH region and the VL region of an antigen-binding domain which is capable of binding to c-Met.
  • the first antigen-binding domain that binds EGFR comprises VH region and a VL region which is, or which is derived from, the VH/VL region of a EGFR-binding antibody clone described herein (e.g., anti-EGFR antibody clones RAA22 or QD6, preferably RAA22) and the second antigenbinding domain that binds c-Met comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of a c-Met-binding antibody clone described herein (e.g., anti-c-Met antibody clone B09-GL).
  • a EGFR-binding antibody clone described herein e.g., anti-EGFR antibody clones RAA22 or QD6, preferably RAA22
  • the second antigenbinding domain that binds c-Met comprises a VH region and a VL region which is, or which is derived from, the
  • a bispecific antibody comprising a first antigen-binding domain that binds EGFR and comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of EGFR- binding antibody clone RAA22, and a second antigen-binding domain that binds c-Met and comprises a VH region and a VL region which is, or which is derived from, the VH/VL region of c-Met-binding antibody clone B09-GL may be termed “RAA22/B09” or “RAA22/B09 bispecific antibody molecule”.
  • the first antigen-binding domain comprises: a VH region according to any one of (1) to (7) above and a VL region according to any one of (8) to (14) above; and the second antigen-binding domain comprises: a VH region according to any one of (15) to (18) above, and a VL region according to any one of (19) to (22) above.
  • the first antigen-binding domain comprises: a VH region according to any of (1), (4) and (6) above and a VL region according to any of (8), (11) and (13) above; and the second antigen-binding domain comprises: a VH region according to any of (15) to (18) above, and a VL region according to any of (19) to (22) above.
  • an antibody molecule of the disclosure comprises: a first antigen-binding domain that binds epidermal growth factor receptor (EGFR); and a second antigen-binding domain that binds c-Met, wherein the first antigen-binding domain comprises: (i) a heavy chain variable (VH) region comprising the following complementarity determining regions (CDRs):
  • VH heavy chain variable
  • HCDR1 having the amino acid sequence of SEQ ID NO: 1
  • HCDR2 having the amino acid sequence of SEQ ID NO: 2
  • HCDR3 having the amino acid sequence of SEQ ID NO: 3, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid
  • VL light chain variable
  • LCDR1 having the amino acid sequence of SEQ ID NO: 4
  • LCDR2 having the amino acid sequence of SEQ ID NO: 5
  • LCDR3 having the amino acid sequence of SEQ ID NO: 6, or a variant thereof in which one or two or three amino acids in one or more of HCDR1 , HCDR2, or HCDR3 are substituted with another amino acid.
  • the first antigen-binding domain comprises: a VH region comprising an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 16; and a VL region comprising an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 20, and/or the second antigen-binding domain comprises: a VH region comprising an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 38; and a VL region comprising an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 40.
  • substitutions may conservative substitutions, for example according to the following Table.
  • amino acids in the same block in the middle column are substituted, i.e. a non-polar amino acid is substituted for another non-polar amino acid for example.
  • amino acids in the same line in the rightmost column are substituted, i.e. G is substituted for A or P for example.
  • substitution(s) may be functionally conservative. That is, in some instances the substitution may not affect (or may not substantially affect) one or more functional properties (e.g. binding affinity) of the antigen-binding domain comprising the substitution as compared to the equivalent unsubstituted antigen-binding domain.
  • the antibody molecule described herein comprises an immunoglobulin heavy chain constant (CH) region.
  • CH immunoglobulin heavy chain constant
  • the CH is, or is derived from, the heavy chain constant sequence of an IgG (e.g. IgG 1 , lgG2, lgG3, lgG4), IgA (e.g. lgA1 , lgA2), IgD, IgE or IgM.
  • the CH region is human immunoglobulin G1 constant (IGHG1 ; UniProt: P01857-1 , v1 ; SEQ ID NO: 42) or a fragment thereof.
  • the CH region comprises an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 42, 43, 44, 45, 46, 63 or 64.
  • the CH region comprises an amino acid sequence having at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of SEQ ID NO: 63 or 64.
  • the antibody molecule comprises a heavy chain that comprises or consists of a VH region as described herein and a CH region as described herein.
  • the antibody molecule described herein comprises an immunoglobulin light chain constant (CL) region or a fragment thereof.
  • the CL region is, or is derived from a kappa CL region set forth in SEQ ID NO: 47 or SEQ ID NO: 48.
  • the CL region is, or is derived from a lambda CL region set forth in SEQ ID NO: 49 or SEQ ID NO: 65.
  • the antibody molecule comprises: a first CL region that is, or is derived from, a kappa CL region set forth in SEQ ID NO: 47 or 48; and a second CL region that is, or is derived from, a lambda CL region set forth in SEQ ID NO: 49 or 65.
  • the antibody molecule described herein comprises: a first heavy chain, wherein the first heavy chain comprises the VH region of the first antigenbinding domain, and a first heavy chain constant (CH) region or a fragment thereof; a first light chain, wherein the first light chain comprises the VL region of the first antigen-binding domain, and a first light chain constant (CL) region or a fragment thereof; a second heavy chain, wherein the second heavy chain comprises the VH region of the second antigen-binding domain, and a second heavy chain constant (CH) region or a fragment thereof; and a second light chain, wherein the second light chain comprises the VL region of the second antigen-binding domain, and a second light chain constant (CL) region or a fragment thereof.
  • a first heavy chain wherein the first heavy chain comprises the VH region of the first antigenbinding domain, and a first heavy chain constant (CH) region or a fragment thereof
  • a first light chain wherein the first light chain comprises the VL region of the first antigen-binding
  • the first and second CH region may be identical or different.
  • the first and second CH region may form a homodimer or heterodimer.
  • asymmetrical bispecific antibody molecules have different first and second CH regions, as described in more detail below.
  • the first and second CL regions may be identical or different.
  • the first CL region is, or is derived from, a kappa CL region set forth in SEQ ID NO: 47 or 48; and a second CL region that is, or is derived from, a lambda CL region set forth in SEQ ID NO: 49 or 65.
  • an antibody molecule comprises a first VH region and a first CH region, that these regions together form a first heavy chain of the antibody molecule, that is that the first VH and first CH regions are connected to each other.
  • a second VH region and a second CH region forms a second heavy chain of the antibody molecule;
  • a first VL region and a first CL region form a first light chain of the antibody molecule;
  • a second VL region and a second CL region form a second light chain of the antibody molecule.
  • the antibody molecule comprises a heavy chain having an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL heavy chain set forth in SEQ ID NO: 50, the QD6 heavy chain set forth in SEQ ID NO: 53, the RAA22 heavy chain set forth in SEQ ID NO: 56, the heavy chain set forth in SEQ ID NO: 59, or the heavy chain set forth in SEQ ID NO: 60.
  • the antibody molecule comprises a first and second heavy chain, wherein
  • the first heavy chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL heavy chain set forth in SEQ ID NO: 56; and
  • the second heavy chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the RAA22 heavy chain set forth in SEQ ID NO: 50.
  • the antibody molecule comprises a first and second heavy chain, wherein
  • the first heavy chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the heavy chain set forth in SEQ ID NO: 59; and
  • the second heavy chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the heavy chain set forth in SEQ ID NO: 60.
  • the antibody molecule described herein comprises a light chain that comprises or consists of a VL region as described herein and a CL region as described herein.
  • the antibody molecule described herein comprises a light chain having an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL light chain set forth in SEQ ID NO: 52, the QD6 light chain set forth in SEQ ID NO: 55, the RAA22 light chain set forth in SEQ ID NO: 58, the light chain set forth in SEQ ID NO: 61 , or the light chain set forth in SEQ ID NO: 62.
  • the antibody molecule described herein comprises a first and second light chain, wherein
  • the first light chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the RAA22 light chain set forth in SEQ ID NO: 58; and
  • the second light chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the B-09-GL light chain set forth in SEQ ID NO: 52
  • the antibody molecule described herein comprises a first and second light chain, wherein
  • the first light chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the light chain set forth in SEQ ID NO: 61 ; and
  • the second light chain comprises an amino acid sequence which has at least 70% sequence identity, more preferably one of at least 75%, 80%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, sequence identity to the amino acid sequence of the light chain set forth in SEQ ID NO: 62.
  • the CH, CL, heavy chain and/or light chain of the antibody molecules described herein may comprise one or more modifications, for example to abrogate or reduce Fc effector functions, promote formation of a heterodimeric antibody molecule, to increase the efficacy of cognate heavy and light chain pairing, and/or to assist with conjugate formation as described in more detail below.
  • a CH, CL, heavy chain and light chain that has been modified may be referred to as a modified CH, CL, heavy chain and light chain, respectively.
  • the antibody molecule may comprise a mutation in the CH region(s) of the heavy chain(s) to reduce or abrogate binding of the antibody molecule to one or more Fey receptors, such as FcyRI, FcyRlla, FcyRllb, FcyRIII and/or to complement. Such mutations abrogate or reduce Fc effector functions. Mutations for reduce or abrogate binding of antibody molecule to one or more Fey receptors and complement are known and include the “triple mutation” or “TM” of L234F/L235E/P331 S described for example in Organesyan, 2008. Other mutations that are known to modulate antibody effector function are described for example in Wang, 2018.
  • the first and/or second heavy chain (preferably both) comprise phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331 , wherein the numbering is as per the EU index.
  • one or both (preferably both) of the first and second heavy chains may comprise a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95% sequence identity to the sequence set forth in SEQ ID NO: 42 and comprise a phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331 , wherein the numbering is as per the EU index.
  • including the TM in the heavy chain was demonstrated to improve pharmacokinetic properties of the exemplified antibody molecules and ADCs.
  • CH regions comprising the triple mutation are SEQ ID NOs: 63 and 64.
  • one of the first and second heavy chains comprises a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 63 and the other heavy chain comprises a CH region having an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 64, wherein one or both (preferably both) of the CH regions comprise a phenylalanine at position 234, glutamic acid at position 235, and serine at position 331 , wherein the numbering is as per the EU index.
  • heavy chains comprising a CH region containing the triple mutation are SEQ ID NOs: 59 and 60.
  • one of the first and second heavy chains has an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 59 and the other heavy chain has an amino acid sequence having at least 70%, at least 80%, at least 90%, at least 95%, or 100% sequence identity to the sequence set forth in SEQ ID NO: 60, wherein one or both (preferably both) of the have chains comprise a phenylalanine at position 234, glutamic acid at position 235, and serine at position 331 , wherein the numbering is as per the EU index.
  • the VL and CL region, and the VH region and CH1 region of an antibody molecule together constitute the Fab region.
  • the remainder of the antibody molecule constitute the Fc region.
  • amino acid residue positions in the constant domain including the position of amino acid sequences, substitutions, deletions and insertions as described herein, are numbered according to EU numbering (Edelman, 2007).
  • Bispecific antibody molecules may be provided in any suitable format. Suitable formats for a bispecific antibody molecule described herein, and methods for producing the same, are described in Kontermann, MAbs 2012, 4(2):182-197 and Kontermann and Brinkmann 2015, 20(7): 838-847, both of which are herein incorporated by reference in their entirety. See in particular FIG 2 of Kontermann MAbs 2012, 4(2): 182-19.
  • Bispecific antibody molecules can also be generated from existing antibodies by chemical conjugation.
  • two IgG molecules or two Fab' fragments can be coupled using homo- or heterobifunctional coupling reagents, e.g. as described in Graziano and Guptill, Methods Mol Biol. 2004; 283:71-85.
  • the bispecific antibody molecules may be an immunoglobulin G-like (IgG-like) bispecific antibody molecule.
  • IgG-like bispecific antibody molecule may comprise an Fv region, Fab region or sVD specific for one antigen, an Fv/Fab/sVD specific for another antigen, and an Fc region.
  • IgG-like bispecific antibody molecules may be either symmetrical or asymmetrical.
  • the bispecific antibody molecule is preferably asymmetrical.
  • Symmetrical IgG-like bispecific antibody molecules generally contain an antigen-binding domain that is fused to the N- or C-terminus of the heavy of light chain of an IgG molecule, e.g. in the form of a scFv fragment or a variable single domain.
  • a characteristic property of these symmetrical IgG-like bispecific antibody molecules is that they contain a two identical heavy chains.
  • symmetrical IgG-like bispecific antibody molecules are typically bivalent for each epitope. Valency as used herein refers to the number of antigen-binding regions in the antibody molecule that are able to bind a single epitope.
  • a monoclonal monospecific IgG antibody molecule is bivalent for a single epitope - it contains two antigenbinding domains, each of which are able to bind an epitope on a single target molecule.
  • a symmetrical IgG-like bispecific antibody molecule is bivalent for each epitope - it typically contains four antigenbinding domains, two of which are able to bind a first epitope on a target molecule and two of which are able to bind to a second epitope on a target molecule.
  • symmetrical IgG-like bispecific antibody molecules include DVD-IgG, IgG-scFv, scFv-IgG, scFv4-lg, IgG-scFab, scFab-IgG, IgG-sVD, sVD-IgG, 2 in 1 -IgG, mAb 2 , tandemab common LC. These can be formed by methods known in the art, for example chemical crosslinking, somatic hybridisation or the redox method.
  • Asymmetrical IgG-like bispecific antibody molecules in contrast, are typically monovalent for each target.
  • the concept of monovalent bispecific IgG is thought to have a unique therapeutic niche in that they (i) do not cause receptor homodimerization, (ii) potentially have reduced toxicity on non-target tissues due to loss of avidity for each antigen, and (iii) have better selectivity when both antigens are either selectively restricted or abundantly expressed on target cells.
  • the antibody molecule is an asymmetrical IgG-like bispecific antibody molecule.
  • Asymmetrical IgG-like bispecific antibody molecules involve heterodimerization of two distrinct heavy chain and correct pairing of the cognate light chain and heavy chain.
  • Heterodimerization of the heavy chains can be addressed by several techniques, such as knobs-into-holes, electrostatic steering of CH3, CH3 strand exchanged engineered domains and leucine zippers.
  • the pairing of the correct light and heavy chain can be ensured by using one of these heavy chain heterodimerization techniques along with the use of a common light chain, domain cross-over between CH1 and CL, coupling of the heavy and light chains with a linker, in vitro assembly of heavy chain-light chain dimers from two separate monoclonals, interface engineering of an entire Fab domain, or disulfide engineering of the CH1/CL interface.
  • assymmetrical IgG-like bispecific antibody molecules include DuetMab, kih IgG, kih IgG common LC, CrossMab, kih IgG-scFab, mAb-Fv, charge pairs and SEED-body.
  • the antibody molecules comprise one or more modifications in one or more of the CH1 , CH2 and CH3 domains that promotes formation of a heterodimeric antibody molecule.
  • the DuetMab antibody molecule described above may additionally comprise one or more modifications in one or more of the CH1 , CH2 and CH3 domains that promotes formation of a heterodimeric antibody molecule. This may involve a Knobs into Holes (KiH) strategy based on single amino acid substitutions in the CH3 domains that promote heavy chain heterodimerization is described in Ridgway, 1996. The knob variant heavy chain CH3 has a small amino acid has been replaced with a larger one, and the hole variant has a large amino acid has replaced with a smaller one. Additional modifications may also introduced to stabilise the association between the heavy chains.
  • CH3 modifications to enhance heterodimerization include, for example, Y407V/T366S/L368A on one heavy chain and T366W on the other heavy chain; and S354C/T366W on one heavy chain and Y349C/Y407V/T366S/L368A on the other heavy chain, wherein the numbering of the constant region is as per the EU index.
  • CH3 modification to enhance heterodimerization are described in, e.g. Table 1 of Brinkmann and Kontermann, 2017 MABS 9(2), 182-212, which is herein specifically incorporated by reference.
  • the antibody molecule comprises a first and second heavy chain that form a heterodimer, wherein one of the first and second heavy chains comprises a cysteine (C) residue at position 354 and a tryptophan (W) residue at position 366 and the other heavy chain comprises a cysteine (C) residue at position 349, a valine (V) residue at position 407, a serine (S) at position 366 and an alanine (A) at position 368, wherein the numbering of the constant region is as per the EU index.
  • the one of the first and second heavy chains may have the sequence set forth in SEQ ID NO: 42 and further comprise a cysteine (C) residue at position 354 and a tryptophan (W) residue at position 366
  • the other heavy chain have the sequence set forth in SEQ ID NO: 42 and further comprise a cysteine (C) residue at position 349, a valine (V) residue at position 407, a serine (S) at position 366 and an alanine (A) at position 368, wherein the numbering of the constant region is as per the EU index.
  • the antibody molecule comprises:
  • a first heavy chain comprising a first modified CH3 region, wherein the first modified CH3 region comprises a cysteine (C) residue at position 354 and a tryptophan (W) residue at position 366; and
  • a second heavy chain comprising a second modified CH3 region, wherein the second modified CH3 region comprises a cysteine (C) residue at position 349, a valine (V) residue at position 407, a serine (S) at position 366 and an alanine (A) at position 368, wherein the numbering of the constant region is as per the EU index.
  • C cysteine
  • V valine
  • S serine
  • A alanine
  • DuetMab A particular exemplified format of asymmetrical IgG-like bispecific antibody molecules is referred to as “DuetMab”. DuetMab antibody molecules uses KIH technology for heterodimerization of 2 distinct heavy chains and increases the efficacy of cognate heavy and light chain pairing by replacing the native disulphide bond in one of the CH1-CL interfaces with an engineered disulphide bond. Disclosure related to DuetMab can found e.g., in U.S. Pat. No. 9,527,927 and Mazor, 2015, which are herein incorporated by reference in their entirety.
  • the antibody molecule comprises:
  • modified CL comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid, wherein either:
  • the first heavy chain comprises the modified CH region and the first light chain comprises the modified corresponding CL region;
  • the second heavy chain comprises the modified CH region and the second light chain comprises the modified corresponding CL region.
  • the substituted cysteine of the modified CH region, resulting from the substitution of the native non-cysteine amino acid to the cysteine amino acid, and the substituted cysteine of the modified corresponding CL region, resulting from the substitution of the native non-cysteine amino acid to the cysteine amino acid can form a disulphide bond.
  • the modified CH region comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid at position 126; and the modified corresponding CL region comprises a substitution of a native non-cysteine amino acid to a cysteine at position 121 , wherein the numbering of the constant region is as per the EU index.
  • the modified CH region comprises a substitution of a native non-cysteine amino acid to a cysteine amino acid at position 126 and a substitution of a native cysteine amino acid to a non- cysteine amino acid at position 219, for example to a valine; and the modified corresponding CL region comprises a substitution of a native non-cysteine amino acid to a cysteine at position 121 and a substitution of a native cysteine amino acid to a non-cysteine amino acid at position 214, for example to a valine, where the numbering of the constant region is as per the EU index.
  • the antibody molecule comprises a second CH region and a second corresponding light chain, wherein the second CH region and second corresponding CL do not comprise a substitution of a native non-cysteine amino acid to a cysteine amino acid and do not comprise a substitution of a native cysteine to a non-cysteine amino acid.
  • the antibody molecule may be conjugated to a drug.
  • the antibody molecule may be referred to as a “conjugate” or an “antibody drug conjugate”.
  • conjugates find application in the treatment and/or diagnosis of diseases as described herein.
  • the drug may be referred to as a “payload” or “warhead”.
  • the drug comprises a cytotoxin, a radioisotope, an immunomodulator, a cytokine, a lymphokine, a chemokine, a growth factor, a tumor necrosis factor, a hormone, a hormone antagonist, an enzyme, an oligonucleotide, a DNA, an RNA, an siRNA, an RNAi, a microRNA, a photoactive therapeutic agent, an anti-angiogenic agent, a pro-apoptotic agent, a peptide, a lipid, a carbohydrate, a chelating agent, or combinations thereof.
  • a cytotoxin is a compound that is able to include death of the cell that is being targeted.
  • a cytotoxin is delivered to a cell targeted by the antibody molecule, where it is released into the cell and induces cell death.
  • the use of cytotoxins in antibody drug conjugates is described, for example, in Chalouni and Doll 2018 J Exp Clin Cancer Res. 37(1 ):20.
  • cytotoxin is a tubulysin, an auristatin, a maytansinoid, a topoisomerase inhibitor or a pyrrolobenzodiazepine (PBD).
  • the cytotoxin is or comprises a tubulysin.
  • Tubulysins are a class of cytostatic tetrapeptides which contain isoleucine and three other complex unnatural amino acids Mep (R — N- Mepipecolic acid), Tuv (tubuvaline) and Tut (tubulyrosine) or Tup (tubuphenylalanine).
  • Mep R — N- Mepipecolic acid
  • Tuv tubuvaline
  • Tut tubulyrosine
  • Tup tubuphenylalanine
  • Tubulysins are extremely potent cytotoxic molecules and are potent against multidrug resistant cell lines (Domling, 2005). These compounds show high cytotoxicity tested against a panel of cancer cell lines with IC50 values in the low picomolar range; thus, they are of interest as anticancer therapeutics. See, e.g., W02012019123.
  • Tubulysin conjugates are disclosed, e.g., in U.S.
  • tubulysin 1508 is tubulysin 1508, also referred to as “AZ1508” and described in more detail in WO 2015157594.
  • Tubulysin 1508 has the following chemical structure:
  • the cytotoxin is or comprises a topoisomerase inhibitor.
  • topoisomerase inhibitor refers to a cytotoxic agent that inhibits the activity of one or more of the topoisomerase enzymes (topoisomerase I and II), which are enzymes that play an important role in DNA replication and transcription by regulating DNA supercoiling.
  • Antibody drug conjugates comprising a topoisomerase inhibitor as a cytotoxin are therefore expected to interfere with normal processes involving DNA, therefore leading to cell death.
  • Conjugates containing topoisomerase inhibitors have been demonstrated to be effective against a variety of tumor containing cell lines as well as having anticancer activity in clinical trials. See for example Ogitani, 2016a; Ogitani, 2016b; Cardillo, 2015; and Bardia, 2017.
  • the antibody molecule is conjugated to a topoisomerase I inhibitor.
  • topoisomerase I inhibitors include, but are not limited to, camptothecins and its analogues topotecan, irinotecan, belotecan, exatecan, lurotecan and sinotecan.
  • topoisomerase II inhibitors include, but are not limited to, amsacrine, daunorubicin, doxorubicin, epipodophyllotoxins, ellipticines, epirubicin, etoposide, razoxane, and teniposide.
  • camptothecin chemical structure is as follows:
  • topoisomerase I inhibitor A general example of a suitable topoisomerase I inhibitor is represented by the following compound:
  • the compound (e.g. A*) is preferably provided with a linker for connecting (preferably conjugating) to an antibody molecule described herein (which may be referred to as a “Ligand Unit” or alternatively a “Cell Binding Agent” (CBA)).
  • a linker for connecting (preferably conjugating) to an antibody molecule described herein (which may be referred to as a “Ligand Unit” or alternatively a “Cell Binding Agent” (CBA)).
  • the linker is attached (e.g. conjugated) in a cleavable manner to an amino residue, for example, an amino acid of an antibody molecule described herein.
  • linkers to be used in conjugates is known in the art and is described for example in Beck, 2017.
  • the linker used herein may be any of the linkers described in Beck, 2017.
  • topoisomerase I inhibitor is represented by the following compound, with the formula “I”: and salts and solvates thereof, wherein R L is a linker for connection to an antibody molecule described herein , wherein said linker is preferably selected from:
  • Q x is such that Q is an amino-acid residue, a dipeptide residue, a tripeptide residue or a tetrapeptide residue;
  • G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. the Ligand Unit or Cell Binding Agent); or
  • R L1 and R L2 are independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group; and e is 0 or 1 .
  • agent(s) e.g. topoisomerase I inhibitor
  • e.g. topoisomerase I inhibitor may be conjugated to the antibody molecule.
  • a conjugate e.g. antibody-drug conjugate
  • a conjugate of the disclosure may be of the general formula IV:
  • L - (D L ) P (IV) or a pharmaceutically acceptable salt or solvate thereof wherein L is an antibody molecule described herein (e.g. the Ligand Unit or CBA), D L is drug having a linker (e.g. a Drug Linker Unit), and p is a integer of from 1 to 20.
  • L is an antibody molecule described herein (e.g. the Ligand Unit or CBA)
  • D L is drug having a linker (e.g. a Drug Linker Unit)
  • p is a integer of from 1 to 20.
  • D L is a topoisomerase I inhibitor having a linker that is of formula III:
  • R LL is a linker connected to an antibody molecule described herein (e.g. the Ligand Unit), wherein the linker is preferably selected from
  • the drug loading is represented by p, the number of topoisomerase I inhibitor(s) (e.g. Drug units) per antibody molecule (e.g. Ligand Unit). Drug loading may range from 1 to 20 Drug units (D) per Ligand unit.
  • p represents the average drug loading of the conjugates in the composition, and p ranges from 1 to 20.
  • the p range is selected from 2 to 8, preferably 4 to 8, even more preferably 5 to 7, still more preferably 5.5 to 6.5.
  • an ADC comprising topoisomerase I inhibitor SG3932 was produced with an average DAR of 6 +/- 6%.
  • the disclosure embraces a conjugate comprising an antibody molecule described herein (e.g. the Ligand Unit or CBA) covalently linked to at least one topoisomerase I inhibitor (e.g. Drug unit, such as A* illustrated above).
  • Said inhibitor is preferably linked to the antibody molecule by a linker (e.g. Linker unit), such as a linker described above as R L and/or R LL .
  • linker e.g. Linker unit
  • the disclosure embraces an antibody molecule described herein (e.g. the Ligand Unit or CBA) with one or more topoisomerase I inhibitors attached, preferably via a linker (e.g. Drug-Linker units).
  • the antibody molecule (representing a Ligand unit or CBA), described more fully above, is a targeting agent that binds to a target moiety. More particularly, this antibody molecule can, for example, specifically binds to a EGFR and cMET on a target cell, to which the Drug unit is thus delivered. Accordingly, the present disclosure also provides methods for the treatment of, for example, various cancers and other disorders with an ADC (e.g. cancers/ disorders which are associated with the presence of cells, preferably cancerous cells, which express EGFR and cMET). Such methods are described in more detail below
  • topoisomerase I inhibitors are particularly preferred and may be defined in more detail as set out below.
  • a preferred instance of feature Q x e.g. within the linker of 1a described above will be outlined.
  • the following preferences may apply to all aspects of the disclosure as described above, or may relate to a single aspect.
  • the preferences may be combined together in any combination.
  • Q is an amino acid residue.
  • the amino acid may be a natural amino acid or a nonnatural amino acid.
  • Q may be selected from: Phe, Lys, Vai, Ala, Cit, Leu, He, Arg, and Trp, where Cit is citrulline.
  • Q comprises a dipeptide residue.
  • the amino acids in the dipeptide may be any combination of natural amino acids and non-natural amino acids.
  • the dipeptide comprises natural amino acids.
  • the linker is a cathepsin labile linker
  • the dipeptide is the site of action for cathepsin-mediated cleavage. The dipeptide then is a recognition site for cathepsin.
  • Q is selected from:
  • Q is selected from:
  • dipeptide combinations may be used, including those described by Dubowchik et al., Bioconjugate Chemistry, 2002, 13,855-869, which is incorporated herein by reference.
  • Q is a tripeptide residue.
  • the amino acids in the tripeptide may be any combination of natural amino acids and non-natural amino acids.
  • the tripeptide comprises natural amino acids.
  • the linker is a cathepsin labile linker
  • the tripeptide is the site of action for cathepsin- mediated cleavage. The tripeptide then is a recognition site for cathepsin.
  • Tripeptide linkers of particular interest are:
  • Q is a tetrapeptide residue.
  • the amino acids in the tetrapeptide may be any combination of natural amino acids and non-natural amino acids.
  • the tetrapeptide comprises natural amino acids.
  • the linker is a cathepsin labile linker
  • the tetrapeptide is the site of action for cathepsin-mediated cleavage. The tetrapeptide then is a recognition site for cathepsin.
  • Tetrapeptide linkers of particular interest are:
  • the tetrapeptide is:
  • NH -Gly-Gly-Phe-Gly c o .
  • NH - represents the N-terminus
  • - c- ° represents the C-terminus of the residue.
  • the C-terminus binds to the NH of A*.
  • Glu represents the residue of glutamic acid, i.e.: aGlu represents the residue of glutamic acid when bound via the a-chain, i.e.:
  • the amino acid side chain is chemically protected, where appropriate.
  • the side chain protecting group may be a group as discussed above.
  • Protected amino acid sequences are cleavable by enzymes. For example, a dipeptide sequence comprising a Boc side chain-protected Lys residue is cleavable by cathepsin.
  • G L may be selected from: where Ar represents a C5-6 arylene group, e.g. phenylene, and X’ represents C1-4 alkyl.
  • G L is selected from G L1-1 and G L1-2 . In some of these instances, G L is G L1-1 .
  • G LL may be selected from: where Ar represents a C5-6 arylene group, e.g. phenylene and X’ represents C1-4 alkyl.
  • CBA represents the Cell Binding Agent or Ligand Unit.
  • G LL is selected from G LL1-1 and G LL1-2 . In some of these instances, G LL is G LL1-1 .
  • a may be 0, 1 , 2, 3, 4 or 5.
  • a is 0 to 3.
  • a is 0 or 1.
  • b1 may be 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16.
  • b1 is 0 to 12.
  • b1 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8.
  • b2 may be 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16. In some instances, b2 is 0 to 12. In some of these instances, b2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8. Preferably, only one of b1 and b2 may not be 0. c1 may be 0 or 1 . c2 may be 0 or 1 . Preferably, only one of c1 and c2 may not be 0. d may be 0, 1 , 2, 3, 4 or 5. In some instances, d is 0 to 3. In some of these instances, d is 1 or 2. In further instances, d is 2. In further instances, d is 5.
  • a is 0, b1 is 0, c1 is 1 , c2 is 0 and d is 2, and b2 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8. In some instances of X, a is 1 , b2 is 0, c1 is 0, c2 is 0 and d is 0, and b1 may be from 0 to 8. In some of these instances, b1 is 0, 2, 3, 4, 5 or 8. In some instances of X, a is 0, b1 is 0, c1 is 0, c2 is 0 and d is 1 , and b2 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8.
  • b1 is 0, b2 is 0, c1 is 0, c2 is 0 and one of a and d is 0.
  • the other of a and d is from 1 to 5. In some of these instances, the other of a and d is 1. In other of these instances, the other of a and d is 5.
  • a is 1
  • b2 is 0, c1 is 0, c2 is 1
  • d is 2, and b1 may be from 0 to 8. In some of these instances, b2 is 0, 2, 3, 4, 5 or 8.
  • R L is of formula lb. In some instances, R LL is is formula lb’.
  • R L1 and R L2 may be independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group.
  • both R L1 and R L2 are H. In some instances, R L1 is H and R L2 is methyl. In some instances, both R L1 and R L2 are methyl.
  • R L1 and R L2 together with the carbon atom to which they are bound form a cyclopropylene group. In some instances, R L1 and R L2 together with the carbon atom to which they are bound form a cyclobutylene group.
  • e is 0. In other instances, e is 1 and the nitro group may be in any available position of the ring. In some of these instances, it is in the ortho position. In others of these instances, it is in the para position.
  • the enantiomerically enriched form has an enantiomeric ratio greater than 60:40, 70:30; 80:20 or 90:10. In further instances, the enantiomeric ratio is greater than 95:5, 97:3 or 99:1.
  • R LL is a group derived from the R L groups above.
  • topoisomerase l-linker e.g. Drug Linker unit
  • the compound of formula I is of the formula l p : and salts and solvates thereof, wherein R LP is a linker for connection to an antibody or antigen binding fragment thereof described herein, wherein said linker is selected from:
  • Q xp is such that Q p is an amino-acid residue, a dipeptide residue or a tripeptide residue
  • G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit);
  • R L1 and R L2 are independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group; and e is 0 or 1 .
  • aP may be 0, 1 , 2, 3, 4 or 5. In some instances, aP is 0 to 3. In some of these instances, aP is 0 or 1 . In further instances, aP is 0.
  • bP may be 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16. In some instances, b is 0 to 12. In some of these instances, bP is 0 to 8, and may be 0, 2, 4 or 8.
  • cP may be 0 or 1 .
  • dP may be 0, 1 , 2, 3, 4 or 5. In some instances, dP is 0 to 3. In some of these instances, dP is 1 or 2. In further instances, dP is 2.
  • aP is 0, cP is 1 and dP is 2, and bP may be from 0 to 8. In some of these instances, bP is 0, 4 or 8.
  • the conjugate of formula IV is of the formula IV P : L - (D LP ) P (IV P ) or a pharmaceutically acceptable salt or solvate thereof, wherein L is an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit), D LP is a topoisomerase I inhibitor (e.g. Drug Linker unit) that is of formula lll p :
  • R LLP is a linker connected to the antibody or antigen binding fragment thereof (e.g. Ligand unit), wherein said linker is selected from where Q p and X p are as defined above and G LL is a linker connected to an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit); and
  • the compound of formula I is of the formula l P2 : and salts and solvates thereof, wherein R LP2 is a linker for connection to an antibody or antigen binding fragment thereof described herein, wherein said linker is selected from:
  • Q x is such that Q is an amino-acid residue, a dipeptide residue, a tripeptide residue or a tetrapeptide residue;
  • G L is a linker for connecting to an antibody or antigen binding fragment thereof described herein (e.g. Ligand Unit);
  • R L1 and R L2 are independently selected from H and methyl, or together with the carbon atom to which they are bound form a cyclopropylene or cyclobutylene group; and e is 0 or 1 .
  • aP2 may be 0, 1 , 2, 3, 4 or 5. In some instances, aP2 is 0 to 3. In some of these instances, aP2 is 0 or 1 . In further instances, aP2 is 0.
  • b1 P2 may be 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16. In some instances, b1 P2 is 0 to 12. In some of these instances, b1 P2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8.
  • b2P2 may be 0, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15 or 16. In some instances, b2P2 is 0 to 12. In some of these instances, b2P2 is 0 to 8, and may be 0, 2, 3, 4, 5 or 8.
  • cP2 may be 0 or 1 .
  • dP2 may be 0, 1 , 2, 3, 4 or 5. In some instances, dP2 is 0 to 3. In some of these instances, dP2 is 1 or 2. In further instances, dP2 is 2. In further instances, dP2 is 5.
  • aP2 is 0, b1 P2 is 0, cP2 is 1 and dP2 is 2, and b2P2 may be from 0 to 8. In some of these instances, b2P2 is 0, 2, 3, 4, 5 or 8. In some instances of X P2 , aP2 is 1 , b2P2 is 0, cP2 is 0 and dP2 is 0, and b1 P2 may be from 0 to 8. In some of these instances, b1 P2 is 0, 2, 3, 4, 5 or 8. In some instances of X P2 , aP2 is 0, b1 P2 is 0, cP2 is 0 and dP2 is 1 , and b2P2 may be from 0 to 8.
  • b2P2 is 0, 2, 3, 4, 5 or 8.
  • b1 P2 is 0, b2P2 is 0, cP2 is 0 and one of aP2 and dP2 is 0.
  • the other of aP2 and d is from 1 to 5. In some of these instances, the other of aP2 and d is 1 . In other of these instances, the other of aP2 and dP2 is 5.
  • the conjugate of formula IV is of the formula IV P2 :
  • R LLP2 is a linker connected to the antibody or antigen binding fragment thereof (e.g. Ligand unit), wherein said linker is selected from
  • topoisomerase I inhibitors include those having the following formulas:
  • SG3932 is particularly preferred.
  • an antibody molecule described herein is conjugated to a topoisomerase I inhibitor having the following formula (e.g. SG3932):
  • Any antibody or antigen binding fragment thereof described herein may be conjugated to one or more of said topoisomerase I inhibitor(s).
  • preferred topoisomerase I inhibitor(s) For completion, certain general synthetic routes for the preparation of preferred topoisomerase I inhibitor(s) will now be described.
  • Such a reaction may be carried out under amide coupling conditions.
  • Compounds of Formula 2 may be synthesised by the deprotection of a compound of Formula 4: where R L *P rot is -Q-Prot N , where Prot N is an amine protecting group.
  • Compounds of Formula 4 may be synthesised by the coupling of a compound of Formula 5: with the compound A3 using the Friedlander reaction.
  • Compounds of Formula 5 may be synthesised from compounds of Formula 6: by removal of the trifluoroacetamide protecting group.
  • Compounds of Formula 6 may be synthesised by coupling: R L * prot -OH to the compound I7.
  • Amine protecting groups are well-known to those skilled in the art. Particular reference is made to the disclosure of suitable protecting groups in Greene’s Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 696-871.
  • the drug loading (p) is the average number of drugs (e.g. tubulysin or topoisomerase inhibitor) per antibody molecule.
  • drug loading ranges from 1 to 20 drugs (D) per antibody molecule.
  • drug loading may range from 1 to 10 drugs (D) per antibody molecule, i.e. where 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 drugs are covalently attached to the antibody molecule.
  • compositions of conjugates include collections of antibody molecules, conjugated with a range of drugs, from 1 to 10. Where the compounds of the disclosure are bound to lysines, drug loading may range from 1 to 80 drugs (D) per antibody molecule, although an upper limit of 40, 20, 10 or 8 may be preferred. Compositions of conjugates include collections of antibody molecules, conjugated with a range of drugs, from 1 to 80, 1 to 40, 1 to 20, 1 to 10 or 1 to 8.
  • the average number of drugs per antibody in preparations of conjugates from conjugation reactions may be characterized by conventional means such as UV, reverse phase HPLC, HIC, mass spectroscopy, ELISA assay, and electrophoresis.
  • the quantitative distribution of conjugates in terms of p may also be determined.
  • ELISA the averaged value of p in a particular preparation of conjuages may be determined (Hamblett, 2004; Sanderson, 2005).
  • the distribution of p (drug) values is not discernible by the antibody-antigen binding and detection limitation of ELISA.
  • ELISA assay for detection of conjugates does not determine where the drug moieties are attached to the antibody molecule, such as the heavy chain or light chain fragments, or the particular amino acid residues.
  • separation, purification, and characterization of homogeneous conjuatges where p is a certain value from conjugates with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis. Such techniques are also applicable to other types of conjugates.
  • p may be limited by the number of attachment sites on the antibody molecule.
  • an antibody molecule may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached.
  • an antibody molecule may contain, for example, many lysine residues that do not react with the linker (L). Only the most reactive lysine groups may react with an amine-reactive linker reagent. Also, only the most reactive cysteine thiol groups may react with a thiol-reactive linker reagent. Generally, antibody molecules do not contain many, if any, free and reactive cysteine thiol groups which may be linked to a drug moiety.
  • cysteine thiol residues in the antibody molecules of the conjugates exist as disulfide bridges and must be reduced with a reducing agent such as dithiothreitol (DTT) or TCEP, under partial or total reducing conditions.
  • DTT dithiothreitol
  • TCEP TCEP
  • the loading (drug/antibody ratio) of a conjugate may be controlled in several different manners, including: (i) limiting the molar excess of Drug Linker relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive conditions for cysteine thiol modification.
  • Certain antibody molecules have reducible interchain disulfides, i.e. cysteine bridges.
  • Antibody molecules may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol).
  • DTT dithiothreitol
  • Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles.
  • This process is also referred to as “classical conjugation” and is distinguished from methods such as where conjugation takes place at a cysteine that has been engineered into a specific site in the antibody molecule.
  • Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut’s reagent) resulting in conversion of an amine into a thiol.
  • ADCs with drugs randomly conjugated to native cysteine residues are prepared by classical conjugation by partial reduction of the antibody followed by reaction with desired linker-drug.
  • the antibody at a concentration of 5 mg/mL may be partially reduced by addition of about 3 molar equivalents of DTT at pH 8.0, followed by incubation at about 37 °C for about 2 hours.
  • the reduction reaction may then be chilled in ice and the excess DTT removed, for example, via diafiltration.
  • the linker-drug can then be added at a linker-drug/thiol molar ratio of about 1 :10.
  • the conjugation reaction may be carried out in the presence of ⁇ 10% v/v of DMSO.
  • excess free cysteine (about 2 fold molar ratio over linker-drug) can be added to quench unreacted linker-drug to produce the cysteine-linker-drug adduct.
  • the reaction mixture can then purified (e.g., by hydrophobic interaction chromatography), and subjected to buffer-exchange into PBS.
  • Drug load distribution can be determined using standard methods, such as hydrophobic interaction chromatography and reduced reverse phase chromatography, as described elsewhere.
  • site-specific conjugation a method in which drug load and site of conjugation is controlled. This can be achieved by, for example, engineering cysteines at specific residues, replacement of residues with unnatural amino acids with bio-orthogonal reactivity or enzyme ligation approaches.
  • sitespecific conjugation is described in Dimasi, 2017, which is herein incorporated by reference in its entirety and involves inserting cysteines into antibody molecules at particular positions.
  • Cysteine amino acids may be engineered at reactive sites in an antibody molecule and which do not form intrachain or intermolecular disulfide linkages (Junutula, 2008; Dornan, 2009; US 7521541 ; US 7723485; W02009/052249).
  • the engineered cysteine thiols may react with linkers or the drug-linker described herein which have thiol-reactive, electrophilic groups such as maleimide or alpha-halo amides to form conjugates with cysteine engineered antibody molecules and the drug.
  • the location of the drug can thus be designed, controlled, and known.
  • the drug loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or drug-linker reagents in high yield.
  • Engineering an IgG antibody to introduce a cysteine amino acid by substitution at a single site on the heavy or light chain gives two new cysteines on the symmetrical antibody. If required, a drug loading near 2 can be achieved with near homogeneity of the conjugation product.
  • the antibody molecule of the conjugate of the disclosure comprises a CH region and the drug is chemically conjugated at a cysteine amino acid inserted between positions 239 and 240 of the CH region, wherein the numbering of the constant region is as per the EU index.
  • the connection between the antibody molecule and the drug may therefore be through this inserted cysteine amino acid and a terminal maleimide group on the linker.
  • CH regions that comprise a cysteine amino acid inserted between positions 239 and 240 of the CH region are SEQ ID NO: 43 and SEQ ID NO: 45.
  • Examples of heavy chains comprising a CH region that comprises a cysteine amino acid inserted between positions 239 and 240 of the CH region are SEQ ID NOs: 50, 53 and 56.
  • the antibody molecule of the conjugate does not comprise any amino acid residues inserted into the CH region.
  • the antibody molecule of the conjugate does not comprise a cysteine amino acid inserted into the CH region (e.g. between positions 239 and 240, wherein the numbering of the constant region is as per the EU index).
  • the inserted cysteine is not necessary.
  • CH regions that do not comprise any amino acid residues inserted into the CH region are SEQ ID NO: 44, 46, 63 and 64.
  • Examples of heavy chains comprising a CH region that do not comprise any amino acid residues inserted into the CH region are SEQ ID NOs: 51 , 54, 57, 59 and 60.
  • the resulting product is a mixture of conjugate compounds with a distribution of drug attached to an antibody, e.g. 1 , 2, 3, etc.
  • Liquid chromatography methods such as polymeric reverse phase (PLRP) and hydrophobic interaction (HIC) may separate compounds in the mixture by drug loading value.
  • Preparations of conjugate with a single drug loading value (p) may be isolated, however, these single loading value conjugates may still be heterogeneous mixtures because the drug may be attached, via the linker, at different sites on the antibody molecule.
  • conjugate compositions of the disclosure include mixtures of antibody-drug conjugate compounds where the antibody has one or more drug moieties (e.g. tubulysin or topoisomerase inhibitor) and where the drug moieties may be attached to the antibody molecule at various amino acid residues.
  • drug moieties e.g. tubulysin or topoisomerase inhibitor
  • the average number of tubulysin drug moieties per antibody molecule is in the range 1 to 8. In some instances the range is selected from 1 to 6, 1 to 4, 1 to 3, preferably 1 to 2, more preferably 1 .5 to 2, even more preferably 1 .8 to 2, still more preferably 1 .9 to 2.
  • the antibody molecule of the ADC may comprise one or more mutations in the CH region(s) of the heavy chain(s) to reduce or abrogate binding of the antibody molecule to one or more Fey receptors.
  • the first and/or second heavy chain of the ADCs described herein may comprise phenylalanine (F) at position 234, glutamic acid (E) at position 235, and serine (S) at position 331 , wherein the numbering is as per the EU index.
  • the antibody molecules and conjugates described herein may be characterised by reference to certain functional properties. Binding affinity
  • the antibody molecules and conjugates described herein may be characterised by the antigen-binding domain that binds EGFR having a particular affinity for EGFR and/or the antigen-binding domain that binds c-Met having a particular affinity for c-Met.
  • the binding affinity of an antibody molecule or conjugate to a cognate antigen, such as human, mouse or cynomolgus EGFR or c-Met can be determined by surface plasmon resonance (SPR), using Biacore, for example.
  • SPR surface plasmon resonance
  • the binding affinity can be determined using an antibody molecule, for example as part of a bispecific antibody molecule that comprises a first antigen-binding domain that binds EGFR and a second antigen-binding domain that binds c-Met.
  • the binding affinity can be determined using an antibody molecule that is monospecific for EGFR or c-Met.
  • the binding affinity is determined using BIACore as described in Example 2.1.
  • Binding affinity is typically measured by Kd (the equilibrium dissociation constant between the antigenbinding domain and its antigen). As is well understood, the lower the Kd value, the higher the binding affinity of the antigen-binding domain. For example, an antigen-binding domain that binds to a target with a Kd of 10 nM would be considered to be binding said target with a higher affinity than an antigen-binding domain that binds to the same target with a Kd of 100 nM.
  • Kd the equilibrium dissociation constant between the antigenbinding domain and its antigen
  • Reference to human EGFR may refer to a polypeptide comprising the extracellular domain of EGFR, such as one having the amino acid sequence set forth in SEQ ID NO: 68.
  • Reference to mouse EGFR may refer to a polypeptide produced from the molecule available from SinoBiological with catalogue # 51091-M08H.
  • Reference to cynomolgus EGFR may refer to the amino acid sequence set forth in SEQ ID NOs: 69.
  • Reference to human c-Met may refer to a polypeptide having the amino acid sequence set forth in SEQ ID NO: 70.
  • mouse c-Met may refer to a polypeptide having the amino acid sequence set forth in SEQ ID NO: 90 or to the polypeptide produced from the molecule available from SinoBiological with catalogue # 50622-M08H.
  • Reference to cynomolgus c-Met may refer to the amino acid sequence set forth in SEQ ID NO: 71 .
  • Antibody molecules and conjugates described herein may comprise an antigen-binding domain that binds to EGFR with a low affinity.
  • EGFR is known to be expressed at low levels in normal tissues, e.g. the skin e.g. the skin.
  • Antibody molecules and conjugates that bind to EGFR with a low-affinity are advantageously expected to display reduced on-target toxicity in normal tissues whilst still being able to target tumors expressing high levels of EGFR, resulting in an improved safety profile.
  • conjugates comprising this low affinity EGFR antigen-binding domain are more efficacious at treating cancer compared to conjugates comprising a higher affinity EGFR antigen-binding domain.
  • the antigen-binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd equal to or higher than 10 nM, 15 nM, 20 nM, 25 nM, 30 nM, 35 nM, or 40 nM.
  • antigenbinding domain that binds to EGFR may bind to human EGFR with a Kd of between 10 and 100 nM, between 20 and 100 nM, between 30 and 100 nM, between 40 and 100 nM, between 10 and 80 nM, between 20 and 80 nM, between 30 and 80 nM, between 40 and 80 nM, between, between 10 and 70 nM, between 20 and 70 nM, between 30 and 70 nM, between 40 and 70 nM, between 10 and 60 nM, between 20 and 60 nM, between 30 and 60 nM, between 40 and 60 nM, between 10 and 50 nM, between 20 and 50 nM, between 30 and 50 nM, or between 40 and 50 nM.
  • the antigen-binding domain that binds to EGFR may bind to human EGFR with an affinity that is lower than the affinity that an antigen-binding domain comprising the heavy chain sequence and light chain sequence of antibody molecule QD6 set forth in SEQ ID NOs: 53 and 55, respectively.
  • the antigen-binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is at least 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, or 7-fold higher than the Kd that an antigenbinding domain comprising the heavy chain sequence and light chain sequence of antibody molecule QD6 set forth in SEQ ID NOs: 53 and 55, respectively, binds human EGFR.
  • the antigenbinding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is between 2- and 10-fold higher, between 3- and 10-fold higher, between 4- and 10-fold higher, between 5- and 10- fold higher, between 6- and 10-fold higher, between 7- and 10-fold higher, between 2- and 9-fold higher, between 3- and 9-fold higher, between 4- and 9-fold higher, between 5- and 9-fold higher, between 6- and 9-fold higher, between 7- and 9-fold higher, between 2- and 8-fold higher, between 3- and 8-fold higher, between 4- and 8-fold higher, between 5- and 8-fold higher, between 6- and 8-fold higher, between 7- and 8-fold higher than the Kd that an antigen-binding domain comprising the heavy chain sequence and light chain sequence of antibody QD6 set forth in SEQ ID NOs: 53 and 55, respectively, binds human EGFR.
  • the antigen-binding domain that binds to EGFR may bind to human EGFR with an affinity that is similar to the affinity that an antigen-binding domain comprising the variable heavy region sequence and variable light region sequence of antibody molecule RAA22 set forth in SEQ ID NOs: 16 and 20, respectively.
  • the antigen-binding domain that binds to EGFR may bind to human EGFR with an affinity having a Kd that is less than 5-fold different, less than 4-fold different, less than 3-fold different, less than 2-fold different, less than 1-fold different or less than 0.5-fold different than an antigen-binding domain comprising the variable heavy region sequence and variable light region sequence of antibody molecule RAA22 set forth in SEQ ID NOs: 16 and 20, respectively, binds human EGFR.
  • the antigen-binding domain that binds to EGFR may also bind to cynomolgus EGFR.
  • the antigen-binding domain that binds to EGFR may bind to cynomolgus EGFR with an affinity having a Kd that is less than 700 nM, less than 600 nM, less than 500 nM, less than 400 nM, less than 300 nM, or less than 250 nM.
  • the antigen-binding domain that binds to EGFR may bind to cynomolgus EGFR with an affinity having a Kd of between 100 and 700 nM, between 100 and 600 nM, between 100 and 500 nM, between 100 and 400 nM, between 100 and 300 nM, between 150 and 250 nM, between 100 and 200 nM.
  • the antigen-binding domain that binds to EGFR may bind to cynomolgus EGFR with a Kd that is less than or equal 10-, 9-, 8-, 7-, 6-, 5-, 4-, 3-fold higher Kd than the antigen-binding domain binds to human EGFR.
  • the antigen-binding domain that binds to EGFR may also bind to mouse EGFR.
  • the antigen-binding domain that binds to EGFR may bind to mouse EGFR with an affinity having a Kd that is less than 1 pM, less than 900 nM, less than 800 nM, less than 700 nM, less than 600 nM or less than 650 nM.
  • the antigen-binding domain that binds to EGFR may bind to mouse EGFR with a Kd of between 100 nM and 1 pM, between 200 and 900 nM, between 300 and 800 nM, between 400 and 700 nM, between 400 and 600 nM, or between 450 and 550 nM.
  • the antigen-binding domain that binds to EGFR is capable of binding human EGFR and cynomolgus EGFR.
  • This cross-reactivity is advantageous, as it allows dosing and safety testing of the antibody molecules and conjugates to be performed in cynomolgus monkeys during preclinical development.
  • the antigen-binding domain that binds to EGFR is capable of binding human EGFR, cynomolgus EGFR and mouse EGFR.
  • the antigen-binding domain that binds EGFR may be capable of binding human EGFR, cynomolgus EGFR and mouse EGFR with the Kd values set out above (e.g.
  • the antigen-binding domain that binds to c-Met may bind to human c-Met with an affinity having a Kd of lower than 20 nM, 15 nM, 12 nM, 11 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM or 2.5 nM.
  • antigen-binding domain that binds to c-Met may bind to human c-Met with an affinity having a Kd of between 1 and 20 nM, between 1 and 15 nM, between 1 and 10 nM, between 1 and 9 nM, between 1 and 8 nM, between 1 and 7 nM, between 1 and 6 nM, between 1 and 5 nM, between 1 and 4 nM, between 1 and 3 nM, between 1 and 2.5 nM, or between 2 and 2.5 nM.
  • the antigen-binding domain that binds to c-Met may bind to cynomolgus c-Met.
  • the antigen-binding domain that binds to c-Met may bind to cynomolgus c-Met with an affinity having a Kd that is lower than 30 nM, 25 nM, 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, or 2.5 nM.
  • antigen-binding domain that binds to c-Met may bind to cynomolgus c-Met with an affinity having a Kd of between 1 and 20 nM, between 1 and 15 nM, between 1 and 10 nM, between 1 and 9 nM, between 1 and 8 nM, between 1 and 7 nM, between 1 and 6 nM, between 1 and 5 nM, between 1 and 4 nM, between 1 and 3 nM, between 1 and 2.5 nM, or between 2 and 2.5 nM.
  • the antigen-binding domain that binds to c-Met may bind to cynomolgus c-Met with an affinity having a Kd that is less than or equal 10-, 9-, 8-, 7-, 6-, 5-, 4-, 3-, 2-, 1 -fold higher Kd than the antigen-binding domain binds to human c-Met.
  • the antigen-binding domain that binds to c-Met is capable of binding human c-Met and cynomolgus c-Met.
  • This cross-reactivity is advantageous, as it allows dosing and safety testing of the antibody molecules to be performed in cynomolgus monkeys during preclinical development.
  • the antigen-binding domain that binds c-Met may be capable of binding human c-Met and cynomolgus c-Met with the Kd values set out above (e.g. human c-Met with a Kd of between 1 and 20 nM and cynomolgus c-Met with a Kd of between 1 and 20 nM).
  • the antibody molecules and conjugates described herein may comprise an antigen-binding domain that binds EGFR that is an antigen-binding domain that specifically binds EGFR.
  • the antibody molecules and conjugates described herein may comprise an antigen-binding domain that binds c-Met that is an antigenbinding domain that specifically binds c-Met.
  • the antibody molecules and conjugates described herein may comprise a first antigen-binding domain that binds EGFR, which is a first antigen-binding domain that specifically binds EGFR, and a second antigen-binding domain that binds c-Met, which is a first antigenbinding domain that specifically binds c-Met.
  • the term “specific” may refer to the situation in which the antigen-binding domain will not show any significant binding to molecules other than its specific binding partner(s), here EGFR or c-Met. Such molecules are referred to as “non-target molecules”.
  • the term “specific” is also applicable where the antibody molecule is specific for particular epitopes, such as epitopes on EGFR or c-Met, that are carried by a number of antigens in which case the antibody molecule will be able to bind to the various antigens carrying the epitope.
  • an antibody molecule or conjugate is considered to not show any significant binding to a non-target molecule if the extent of binding to a non-target molecule is less than about 10% of the binding of the antibody to the target as measured, e.g., by ELISA, SPR, Bio-Layer Interferometry (BLI), MicroScale Thermophoresis (MST), or by a radioimmunoassay (RIA).
  • the binding specificity may be reflected in terms of binding affinity, where the antibody molecule or conjugate described herein binds to EGFR and/or c-Met with an affinity that is at least 0.1 order of magnitude greater than the affinity towards another, non-target molecule.
  • the antibody molecule or conjugate of the present disclosure binds to EGFR and/or c-Met with an affinity that is one of at least 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, or 2.0 orders of magnitude greater than the affinity towards another, non-target molecule.
  • EGFR is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR, HER2, HER3 and HER4.
  • the RAA22 antigen-binding domain showed no binding to HER2, HER3 and HER4, demonstrating that this antigen-binding domain binds EGFR specifically.
  • the antigen-binding domain that binds EGFR does not bind, or does not show any significant binding, to HER2, HER3 or HER4.
  • c-Met is a member of the subfamily of receptor tyrosine kinases that includes Ron and Serna 4a.
  • the B09-GL antigen-binding domain showed no binding to Ron and Serna 4a, demonstrating that this antigenbinding domain binds c-Met specifically.
  • the antigen-binding domain that binds c-Met does not bind, or does not show any significant binding, to Ron, Serna 4a. Concurrent engagement
  • the antibody molecules and conjugates comprising a first antigen-binding domain that binds EGFR and a second antigen-binding domain that binds c-Met described herein may be characterised by the ability of both the antigen-binding domains to concurrently engage their respective EGFR and c-Met targets.
  • Antibody molecules and conjugates with the ability to concurrently engage EGFR and c-Met are expected to be advantageous, as numerous tumours are known to co-express both EGFR and c-Met and therefore can be targeted by antibody molecules of the disclosure.
  • the antibody molecule or conjugate is able to concurrently engage EGFR and c-Met.
  • Concurrent engagement can be determined for example by an in vitro cytotoxicity assay using a cell line expresses roughly equal amounts of EGFR and c-Met and a conjugate comprising the antibody molecules with EGFR and c-Met antigen-binding domains. If the individual antigen-binding domains in the conjugate function independently to deliver the drug, blocking either target in this cell line would be expected to only modestly reduce the activity of the conjugate, shifting the IC50 by 2-fold or less, since the targets are present at similar levels.
  • the EGFR and c-Met targets can be blocked in this assay by using, for example, a monospecific antibody molecule that binds the same region on either EGFR or c- Met, but lacks a drug that is able to induce cytotoxicity.
  • the monospecific antibody molecule may contain the same antigen-binding domain that binds EGFR, or the same antigen-binding domain that binds c-Met, as the conjugate being tested. If, on the other hand, the conjugate requires concurrent engagement to effectively deliver the conjugate into cells, blocking either target would be likely to have a greater impact on the activity of the conjugate. That is, the antibody molecule is considered to be able to engage both targets concurrently if there is a shift in IC50 by at least 2-fold, preferably at least 5-fold, even more preferably at least 10-fold after blocking either target when using this assay.
  • An additional method to determine concurrent engagement is to compare the activity of the bispecific EGFR-c-Met conjugate to monovalent, monospecific control conjugates in an in vitro cytotoxicity assay.
  • the control conjugates comprise one antigen-binding domain to either EGFR or c-Met and one nonbinding isotype antibody control antigen-binding domain. If each antigen-binding domain in the bispecific conjugate functions independently, the expected result would be that each monospecific control conjugate would only be modestly less potent than the bispecific conjugate, and the difference would be additive. Alternatively, if the two antigen-binding domains of the bispecific conjugate function synergistically by concurrent binding, one would expect larger differences in activity of the bispecific conjugate compared to the monospecific control antibodies. That is, the antibody molecule is considered to be able to engage both targets concurrently if the bispecific conjugate results in a shift in IC50 that is greater than the sum of the shifts in IC50 observed using the monospecific control conjugates.
  • the antibody molecules and conjugates described herein may be characterised by their ability to mediate efficient internalisation. This is particularly useful for conjugates, as it ensures the conjugate is internalised into the cell and delivered to lysosomes, where the antibody molecule is subsequently degraded and drug released into the cell, where it exerts its cellular effects, e.g. cytotoxicity.
  • Internalisation of an antibody molecule or conjugate by cells can be analysed by contacting live cells with the antibody molecule, and detecting the antibody molecule or conjugate after sufficient period of time for internalisation. Internalisation can be determined by detection of the localisation of the antibody molecule or conjugate. Where the antibody molecule or conjugate remains on the surface of the cell (e.g. is detected on the cell surface, and/or is not detected inside the cell), the antibody molecule or conjugate is determined not to have been internalised. Where the antibody molecule or conjugate is detected inside the cell (e.g. localised to the cytoplasm or a cellular organelle), the antibody molecule or conjugate is determined to have been internalised.
  • An exemplary method for visualising whether the antibody molecule or conjugate is able to mediate efficient internalisation involves labelling the antibody molecule with pH sensitive dyes that exhibit fluorescent at an acidic pH and adding these labelled antibody molecules or conjugates to cells. Internalisation into the cell can be detected by monitoring fluorescence.
  • the antibody molecule or conjugate is considered able to mediate internalisation and delivery to lysosomes if the fluorescence observed is greater than that of a labelled non-binding control antibody molecule or conjugate over a certain time period, for example 48 hours. Further details of this method to visualise antibody internalisation can be found in the examples.
  • the antibody molecules or conjugates comprising a first antigen-binding domain that binds EGFR and a second antigen-binding domain that binds c-Met may be characterised by their ability to mediate more efficient internalisation when compared to the EGFR or c-Met monospecific controls.
  • Antibody molecules and conjugates that exhibit this properties are expected to be advantageous, as they are expected to display greater selectivity to tumour cells co-expressing both targets and could minimise the impact of the antibody molecule in normal tissues that do not display significant levels of co-expression.
  • the antibody molecules or conjugates described herein may be characterised by their cytotoxic activity, i.e. their ability to kill cells. Cytotoxic activity can be measured using an in vitro cell viability assay, such as the CellTiter-Glo ® (Promega) assay, for example. In some instances, the cells are cells that expression both EGFR and c-Met.
  • IC50 is the median inhibitory concentration of an antibody molecule. In functional assays, IC50 is the concentration that reduces a biological response by 50% of its maximum. IC50 can be calculated by any number of means known in the art.
  • the antibody molecules or conjugates described herein having cytotoxic activity have an IC50 of less than less than 4000 pM, less than 3500 pM, less than 3000 pM, less than 2500 pM, less than 2000 pM, less than 1500 pM, less than 1000 pM, less than 500 pM, less than 400 pM, less than 300 pM, less than 250 pM, less than 200 pM, less than 150 pM, or less than 100 pM when measured using an in vitro cell viability assay.
  • the antibody molecules or conjugates described herein may have an IC50 of between 60 and 500 pM.
  • the antibody molecules or conjugates described herein are capable of increased killing of cells, e.g. tumor cells, that express significant amounts of both EGFR and c-Met compared to cells that express low levels of one or the other of EGFR and c-Met.
  • Cells expressing significant amounts of both EGFR and c-Met may be determined by measuring relative receptor density at the cell surface. For example, cells expressing EGFR and c-Met at a relative receptor density at the cell surface of greater than 15,000 may be considered cells that express significant amounts of both EGFR and c-Met and cells that express one of EGFR and c-Met at a low relative receptor density at the cell surface of 15,000 or less.
  • Relative EGFR and c-Met density can be measured, for example, using the Quantum MESF quantitative FACS assay kit as described in the examples.
  • Examples of cells that express significant amounts of both EGFR and c-Met may include NCI H596, HCC 827 GR Pool, A549, NCI H1792, NCI H1975, NCI H292 and NCI H358 cell lines. Examples of cells that express one of EGFR and c-Met at a low relative receptor density may include A427, NCI H23 and NCI H661 (Ag negative) cell lines. These cell lines are available through ATCC.
  • the antibody molecules or conjugates described herein are capable of cytotoxic activity in cells that are resistant to cells that are resistant to tyrosine kinase inhibitors (TKIs).
  • TKI resistant cells may include NCI H1975 (EGFR mutations: T790M, L858R) and HCC827 GR Pool (EGFR A746-750 deletion + MET amplification).
  • the antibody molecules or conjugates described herein are capable of inhibiting the development or progression of a cancer.
  • the cancer may be a cancer that expressed both EGFR and c-Met.
  • Cells of the cancer may express EGFR and c-Met at the cell surface.
  • the cancer may e.g. lung cancer (such as Non-Small Cell Lung Cancer (NSCLC)), pancreatic cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, ovarian cancer or glioblastoma.
  • NSCLC Non-Small Cell Lung Cancer
  • the ability of a given antibody molecule or conjugate to inhibit the development or progression of a cancer can be analysed e.g. using an in vivo model.
  • the in vivo model may involve measuring tumour growth in a patient derived xenograft (PDX) model. Further details of this exemplary method is described in the examples. Inhibition of the development of a cancer may be inferred by observation of slower tumour growth or a decrease in tumour size following administration of the antibody molecule or conjugate, for example by measuring the tumour growth inhibition (%TGI).
  • %TGI can be measured by comparing the size of the tumour measured at day 0 with the size of the tumour measured at the end of the study time for those subjects administered with the antibody molecule or conjugate, and comparing this to the tumour growth over the same time period for subjects administered with a control antibody molecule or conjugate.
  • the antibody molecule or conjugate described herein has a %TGI of at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%.
  • Inhibition of the development of a cancer may be inferred by observation of a delayed or prevented onset of, and/or reduced severity of, symptoms of the cancer in response to treatment with the antibody molecule.
  • Inhibition of the progression of a cancer may be inferred by observation of delayed, prevented and/or reduced invasion and/or metastasis in response to treatment with the antibody molecule.
  • the antibody molecule described herein may be capable of inhibiting the development or progression of a cancer to less than 100%, e.g. one of 99% or less, 95% or less, 90% or less, 85% or less, 75% or less, 70% or less, 65% or less, 60% or less, 55% or less, 50% or less, 45% or less, 40% or less, 35% or less, 30% or less, 25% or less, 20% or less, 15% or less, 10% or less, 5% or less, or 1 % or less of the development/progression of the cancer in the absence of treatment with the antibody molecule (or treatment with an appropriate control).
  • the antibody molecule described herein is capable of inhibiting the development or progression of a cancer to less than 1 times, e.g.
  • the cancer comprise cancer cells that express high levels of EGFR and/or high levels of c-Met at the cell surface.
  • Methods of measuring levels EGFR and c-Met are known in the art and include immunohistochemistry, for example.
  • the antibody molecules or conjugates described herein are capable of increased inhibition of the development or progression of a cancer in cells that display high levels of both EGFR and c-Met compared to cells that express low levels of one or the other of EGFR and c-Met.
  • a nucleic acid molecule comprises a polynucleotide sequence encoding a heavy chain variable region of an antibody molecule disclosed herein, a polynucleotide sequence encoding a light chain variable region of an antibody molecule disclosed herein, or both.
  • nucleic acid molecule or molecules are purified or isolated, e.g. from other nucleic acid, or naturally-occurring biological material.
  • the skilled person would have no difficulty in preparing such nucleic acid molecules using methods well-known in the art.
  • the nucleic acid molecule or molecules may encode the VH domain and/or VL domain, preferably the VH domain and VL domain of: anti-EGFR antibody clone RAA22, anti-EGFR antibody clone QD6, anti-c-Met antibody clone B09-GL, preferably anti-EGFR antibody clone RAA22, or anti-c-Met antibody clone B09- GL.
  • the VH and VL domain sequences of these antibodies are described herein.
  • the nucleic acid encodes the VH and VL domain, or heavy and light chain, of an antibody molecule of the disclosure
  • the two domains or chains may be encoded on two separate nucleic acid molecules.
  • nucleic acid molecule(s) may comprise:
  • the nucleic acid molecule(s) may encode the heavy chain and/or light chain, preferably the heavy chain and light chain of: anti-EGFR antibody clone RAA22, anti-EGFR antibody clone QD6, anti-c-Met antibody clone B09-GL, preferably anti-EGFR antibody clone RAA22, or anti-c-Met antibody clone B09-GL.
  • anti-EGFR antibody clone RAA22 anti-EGFR antibody clone QD6, anti-c-Met antibody clone B09-GL, preferably anti-EGFR antibody clone RAA22, or anti-c-Met antibody clone B09-GL.
  • anti-EGFR antibody clone RAA22 anti-EGFR antibody clone QD6
  • anti-c-Met antibody clone B09-GL preferably anti-EGFR antibody clone RAA22
  • anti-c-Met antibody clone B09-GL anti-c-Met antibody clo
  • the present disclosure also provides a vector comprising nucleic acid molecule encoding an antibody molecule described herein.
  • An isolated nucleic acid molecule may be used to express an antibody molecule of the disclosure.
  • the nucleic acid will generally be provided in the form of a recombinant vector for expression.
  • Another aspect of the disclosure thus provides a vector comprising a nucleic acid as described above.
  • Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
  • the vector contains appropriate regulatory sequences to drive the expression of the nucleic acid in a host cell.
  • Vectors may be plasmids, viral e.g. phage, or phagemid, as appropriate.
  • a nucleic acid molecule or vector as described herein may be introduced into a host cell.
  • Techniques for the introduction of nucleic acid or vectors into host cells are well established in the art and any suitable technique may be employed.
  • a range of host cells suitable for the production of recombinant antibody molecules are known in the art, and include bacterial, yeast, insect or mammalian host cells.
  • a preferred host cell is a mammalian cell, such as a CHO, NSO, or HEK cell, for example a HEK293 cell.
  • Another aspect of the disclosure provides a method of producing an antibody molecule of the disclosure comprising expressing a nucleic acid encoding the antibody molecule in a host cell and optionally isolating and/or purifying the antibody molecule thus produced.
  • Methods for culturing host cells are well- known in the art.
  • the method may further comprise isolating and/or purifying the antibody molecule.
  • Techniques for the purification of recombinant antibody molecules are well-known in the art and include, for example HPLC, FPLC or affinity chromatography, e.g. using Protein A or Protein L. In some instances, purification may be performed using an affinity tag on antibody molecule.
  • the method may also comprise formulating the antibody molecule into a pharmaceutical composition, optionally with a pharmaceutically acceptable excipient or other substance as described below.
  • the antibody molecule or conjugate as described herein may thus be useful for therapeutic applications, in particular in the treatment of cancer.
  • An antibody molecule, conjugate or pharmaceutical composition as described herein may be used in a method of treatment of the human or animal body.
  • Related aspects of the disclosure provide;
  • the individual may be a patient, preferably a human patient.
  • Treatment may be any treatment or therapy in which some desired therapeutic effect is achieved, for example, the inhibition or delay of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, amelioration of the condition, cure or remission (whether partial or total) of the condition, preventing, ameliorating, delaying, abating or arresting one or more symptoms and/or signs of the condition or prolonging survival of an individual or patient beyond that expected in the absence of treatment.
  • a method of treatment as described may be comprise administering at least one further treatment to the individual in addition to the antibody molecule or conjugate.
  • the antibody molecule or conjugate described herein may thus be administered to an individual alone or in combination with one or more other treatments.
  • the additional treatment may be administered to the individual concurrently with, sequentially to, or separately from the administration of the antibody molecule or conjugate.
  • the additional treatment may be administered concurrently with the antibody molecule or conjugate, the antibody molecule and additional treatment may be administered to the individual as a combined preparation.
  • the additional therapy may be a known therapy or therapeutic agent for the disease to be treated.
  • antibody molecules or conjugates Whilst an antibody molecule may be administered alone, antibody molecules or conjugates will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the antibody molecule or conjugate.
  • a pharmaceutical composition comprising an antibody molecule or conjugate as described herein.
  • a method comprising formulating an antibody molecule or conjugate into a pharmaceutical composition is also provided.
  • compositions may comprise, in addition to the antibody molecule or conjugate, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art.
  • pharmaceutically acceptable as used herein pertains to compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgement, suitable for use in contact with the tissues of a subject (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • Each carrier, excipient, etc. must also be “acceptable” in the sense of being compatible with the other ingredients of the formulation.
  • the precise nature of the carrier or other material will depend on the route of administration, which may be by infusion, injection or any other suitable route, as discussed below.
  • Administration may be in a "therapeutically effective amount", this being sufficient to show benefit to an individual.
  • the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated, the particular individual being treated, the clinical condition of the individual, the cause of the disorder, the site of delivery of the composition, the type of antibody molecule, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated. Appropriate doses of antibody molecules are well known in the art (Ledermann, 1991 ; and Bagshawe, 1991).
  • a therapeutically effective amount or suitable dose of an antibody molecule can be determined by comparing in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including whether the size and location of the area to be treated, and the precise nature of the antibody molecule.
  • an antibody molecule or conjugate as described herein may be for use in a method of treating cancer.
  • Cancer may be characterised by the abnormal proliferation of malignant cancer cells. Where a particular type of cancer, such as breast cancer, is referred to, this refers to an abnormal proliferation of malignant cells of the relevant tissue, such as breast tissue.
  • the cancer may be a primary or a secondary cancer.
  • an antibody molecule or conjugate as described herein may be for use in a method of treating cancer in an individual, wherein the cancer is a primary tumour and/or a tumour metastasis.
  • a tumour of a cancer to be treated using an antibody molecule or conjugate as described herein may coexpress EGFR and c-Met.
  • the tumour may have been determined to co-expression EGFR and c-Met.
  • Methods for determining the expression of a target are known in the art and include, for example, immunohistochemistry.
  • the cancer to be treated using an antibody molecule or conjugate as described herein may be selected from the group consisting of: lung cancer (such as Non-Small Cell Lung Cancer (NSCLC)), pancreatic cancer, breast cancer, colorectal cancer, kidney cancer, gastric cancer, head and neck cancer, ovarian cancer or glioblastoma.
  • lung cancer such as Non-Small Cell Lung Cancer (NSCLC)
  • pancreatic cancer such as Non-Small Cell Lung Cancer (NSCLC)
  • breast cancer such as Non-Small Cell Lung Cancer (NSCLC)
  • pancreatic cancer breast cancer
  • colorectal cancer ectal cancer
  • kidney cancer ectal cancer
  • gastric cancer ectal cancer
  • head and neck cancer ovarian cancer
  • ovarian cancer glioblastoma
  • the cancer to be treated using an antibody molecule or conjugate as described herein is selected from the group consisting of: lung cancer (such as Non-Small Cell Lung Cancer (NSCLC)), pancreatic cancer, colon cancer, colorectal cancer and squamous cell carcinoma of head and neck (SCCHN or SQHN).
  • lung cancer such as Non-Small Cell Lung Cancer (NSCLC)
  • pancreatic cancer colon cancer
  • colorectal cancer squamous cell carcinoma of head and neck
  • SCCHN or SQHN squamous cell carcinoma of head and neck
  • the cancer is squamous cell carcinoma of head and neck (SCCHN).
  • treatment may include inhibiting cancer growth, including complete cancer remission, and/or inhibiting cancer metastasis, as well as inhibiting cancer recurrence.
  • Cancer growth generally refers to any one of a number of indices that indicate change within the cancer to a more developed form.
  • indices for measuring an inhibition of cancer growth include a decrease in cancer cell survival, a decrease in tumour volume or morphology (for example, as determined using computed tomographic (CT), sonography, or other imaging method), a delayed tumour growth, a destruction of tumour vasculature, improved performance in delayed hypersensitivity skin test, an increase in the activity of anti-cancer immune cells or other anti-cancer immune responses, and a decrease in levels of tumour- specific antigens.
  • Activating or enhancing immune responses to cancerous tumours in an individual may improve the capacity of the individual to resist cancer growth, in particular growth of a cancer already present the subject and/or decrease the propensity for cancer growth in the individual.
  • This examples describes the creation of bispecific antibody molecules that are capable of binding both EGFR and c-Met.
  • Top hits exhibiting strong inhibitory effect were selected and subjected to DNA sequencing. Unique genes were then converted to human immunoglobulin G2 (lgG2) antibodies and produced in mammalian cells essentially as described (Persic; 1997). The purified antibodies were then ranked based on their inhibitory effect in the HGF:cMET HTRF® binding assay. The most potent antibody, 0021U3-B09, was selected for further characterization.
  • variable framework regions of 0021 U3-B09 were targeted specifically and altered to match the closest human germline sequence.
  • VH region seven amino acid residues were mutated to match the reference human germline sequence IGHV1-8*01.
  • VL region three residues were mutated to match the reference human germline sequence IGKV1-5*03. All residues in VH and VL regions were successfully changed to the germline residues without loss of activity.
  • 0021 U3-B09 was affinity optimized using a hybridization-based mutagenesis method essentially as described (Kunkel 1985).
  • a large scFv library derived from 0021 U3-B09 sequence was created by oligonucleotide-directed mutagenesis of the VH complementarity determining regions 3 (CDR3) using standard molecular biology techniques.
  • the library was subjected to affinity-based solution phase selections to select variants with a higher affinity to human and cynomolgus cMET antigens.
  • Crude scFv-containing periplasmic extracts from the CDR- targeted selection outputs were screened for improved inhibitory activity in the HGF:cMET HTRF® binding assay.
  • Variants exhibiting significantly improved inhibitory effect compared to parent 0021 U3- B09, were subjected to DNA sequencing and unique genes were converted to human lgG2.
  • the purified antibodies were then ranked based on their inhibitory effect.
  • the most potent antibody, B09-57 was selected for further characterization.
  • EGFR-specific scFv antibodies were isolated from a large naive human scFv phage display library in a series of repeated panning selection cycles on recombinant mammalian expressed biotinylated monomeric human EGFR (Medlmmune) essentially as described (Vaughan, 1996). ScFv-displaying phage from the round 3 of the selection output were screened for their binding to human and cynomolgus EGFR in ELISA. Top hits showing cross reactivity were selected and subjected to DNA sequencing. Unique genes were then converted to human immunoglobulin G1 (lgG1) antibodies and produced in mammalian cells essentially as described (Persic, 1997). The purified antibodies were then ranked based on their binding to the EGFR-expressing cell line, A431 , by flow cytometry. Antibody Tdev-0004 exhibiting specific cell binding was selected for further characterization.
  • Variant RAA22 and QD6 were derived by optimizing the anti-EGFR Tdev-0004 mAb.
  • VH region was initially fully germlined by mutating all 13 non-germline framework residues. Upon germlining, the binding of the fully germlined variant to cynomolgus EGFR was significantly impaired. To restore the binding to cynomolgus EGFR, four non-germline residues; K68, I73, R76 and T78 were selectively back mutated. Amino acid residues are numbered by Kabat numbering system (Kabat and Wu 1991).
  • H4 The resulting, partially germlined variant, named H4, was used as a template sequence for the affinity optimization.
  • Variant H4 was affinity optimized by parsimonious mutagenesis of all six CDRs using a QuikChange Lightning Multi Site-Directed Mutagenesis Kit (Agilent), according to the manufacturer’s instructions.
  • Single amino acid mutagenized VH and VL libraries were expressed in bacteria as Fab fragments and screened for improved binding to human and cynomolgus EGFR in ELISA.
  • Variants exhibiting improved binding compared to parent H4 were subjected to DNA sequencing and unique genes were converted to human IgG 1 .
  • Variant RAA22 was identified with a single mutation in CDRH3.
  • variants were combined to create a combinatorial library that was screened for variants with enhanced binding to human and cynomolgus EGFR.
  • Variant QD6 was identified with four combined mutations in CDRL2, CDRL3 and CDRH3.
  • variable domains of the anti-cMET mAb B09-57 and anti-EGFR mAbs RAA22 and QD6 were utilized for the construction of monovalent bispecific anti-EGFR/cMET antibodies on the backbone of the DuetMab platform (Mazor, 2015) .
  • the VH gene of the anti-cMET B09-57 was inserted into a human gamma-1 constant heavy chain carrying the “Knob” mutation (T366W) and the alternative interchain cysteine mutations (F126C and C219V).
  • the VL gene of B09-57 was inserted in frame into a human Kappa constant domain carrying the corresponding alternative interchain cysteine mutations (S121C and C214V) designed to pair with the “Knob” heavy chain.
  • the VH genes of the anti- EGFR RAA22 and affinity optimized QD6 were inserted into a human gamma-1 constant heavy chain carrying the “Hole” mutations (T366S, L368A, and Y407V), while the VL genes of RAA22 and B09-57 were inserted in frame into a human Lambda constant domain designed to pair with the “Hole” heavy chain.
  • the assembled monovalent bispecific anti- EGFR/cMET DuetMab antibodies were designated as RAA22/B09-57 and QD6/B09-57 (FIG. 1). DuetMab antibodies were produced from mammalian cells as previously described (Mazor, 2017).
  • amino acid sequences of the heavy and light chains of the DuetMabs produced according to this example are provided in the following table:
  • This example tests various biochemical and biophysical properties of the RAA22, QD6 and B09-57 monoclonal antibodies and RAA22/B09-57 and QD6/B09-57 bispecific antibodies molecules, including their binding affinity to EGFR and c-Met, respectively and their ability to bind both antigens simultaneously.
  • kinetic rate constants (kon and koff), and equilibrium dissociation constants (KD) of EGFR-CMET DuetMAbs for recombinant human, cynomolgus monkey, and murine EGFR and cMET antigens were determined at 25°C by SPR using an antibody capture assay on a BIAcore T200 instrument (GE Healthcare, Pittsburgh, PA).
  • Mouse anti-human IgG was immobilized on a CM4 sensor chip with a final surface density of ⁇ 2000 resonance units (RUs).
  • a reference flow cell surface was also prepared on this sensor chip using identical immobilization protocol.
  • Test and control article antibodies were prepared at 5-20 nM in instrument buffer (HBS-EP buffer; 0.01 M HEPES, pH 7.4, 0.15M NaCI, 3mM EDTA, and 0.005% P-20), along with 3-fold serial dilutions of purified EGFR (0.27 - 200nM human, 0.4 - 900nM cyno, and 4-1 OOOnM murine) or cMET proteins (0.27 to 66 nM human and 0.27 - 22nM cyno) in instrument buffer.
  • a sequential approach was utilized for kinetic measurements. Antibodies were first injected over the capture surface, at a flow rate of 10pL/minute.
  • Mouse cMET ND a ND not determined.
  • Kinetic measurements to soluble monomeric forms of EGFR and cMET were performed using a BIACore instrument. KD were calculated as the ratio of k O ff/k O n from a non-linear fit of the data.
  • bispecific antibody molecule QD6/B09-57 binds human c-Met with a high affinity ( ⁇ 2 nM kD) and human EGFR with a high affinity ( ⁇ 6 nM kD), whilst bispecific antibody molecule RAA22/B09-57 binds human c-Met with a similarly high affinity ( ⁇ 2 nM kD) but binds human EGFR with a reduced affinity ( ⁇ 45 nM kD) in comparison to QD6/B09-57.
  • EGFR and cMET species paralogs and closely related family members were determined by ELISA. Briefly, antigen solutions were prepared in PBS at 1 pg/mL and 50 microliters was coated onto half area ELISA assay plates. Plates were washed and blocked with 1% BSA in PBS containing 0.005% Tween-20 (PBS-T) for one hour at room temperature. The wells were washed 4 times in PBS-T.
  • R374 a non-binding IgG 1 isotype control antibody
  • B09 anti-cMET antibody
  • QD6 anti-EGFR antibody
  • RAA22 anti-EGFR antibody
  • QD6/B09 bispecific EGFR/c-MET DuetMAb
  • RAA22/B09 bispecific EGFR/c-MET DuetMAb
  • PaniX anti-EGFR antibody
  • MetMab anti-cMET antibody
  • Mab11311 anti-HER4 antibody
  • Wells were incubated with 50 microliters of the indicated primary antibodies diluted in PBS-T in a 1 :3 dilution series, starting at 10 pg/mL and ending at 0.002 pg/mL, except for the HER4 binding mAb control, MAB1131 , for which the series started at 1 pg/mL.
  • the wells were washed 4 times in PBS-T, then 50 pl of goat anti-human Fab HRP-labeled secondary antibody, diluted 1 :5000 in PBS-T, was added to each well and incubated for one hour at room temperature. 50 microliters of TMB substrate solution was added to all wells and incubated at room temperature for 5-30 min, until intense signal was observed in the positive control wells.
  • TMB stop solution 50 microliters was added to all wells and the absorbance was read at 450 nm on a SpectraMax M5 microplate reader. Data were analyzed in the SoftMax Pro 5 software and plotted using GraphPad Prism 7 graphing software.
  • ELISA assays were carried out as described above. As shown in FIG 3A, the high affinity EGFR IgG, QD6, as well as the monovalent bispecific EGFR/cMET DuetMAb, QD6/B09, bound to human, cynomolgus monkey, and mouse EGFR and gave robust signals in the ELISA assay. In contrast, the lowered affinity EGFR IgG, RAA22, bound more weakly to human, cynomolgus monkey, and mouse EGFR compared to QD6. Binding to mouse EGFR was weak, but detectable.
  • ADC antibody drug conjugates
  • pHAb pH sensitive dye Promega
  • This dye exhibits very low fluorescence at pH > 7, but becomes strongly fluorescent at acidic pH, reaching a maximum at approximately pH 5.
  • pHAb amine reactive dye The antibodies that were labeled were: R347 lgG1 isotype control, monovalent bispecific control antibodies anti-EGFR antibody RAA22/R347 and anti-cMET B09/R347, as well as EGFR/cMET monovalent bispecific antibody RAA22/B09.
  • NCI- H1975 lung cancer cells which co-express modest levels of EGFR ( ⁇ 33,000 relative receptor density) and cMET ( ⁇ 50,000 relative receptor density), were plated into clear bottomed, black walled 96-well assay plates in 100 microliter volumes at a density of 2x10 5 cells/mL in RPMI growth medium supplemented with 10% fetal bovine serum. The plates were cultured in a humidified incubator overnight at 37°C and 5% CO2. The plates were then chilled on ice for 30 min prior to addition of pHAb labeled bispecific and monovalent control antibodies at various concentrations in pre-chilled growth medium.
  • the cultures were chilled on ice for another 30 minutes, and then the fluorescence was read on an Operetta High Content Imaging system using the Cy3 filter and this initial reading was designated as time zero.
  • the plates were moved back to the 37°C incubator and additional readings were taken at 3, 6, 24, 30 and 48 hours.
  • FIG 4. A representative internalization experiment using pHAb labeled mAbs at 1.25 pg/mL to treat NCI H1975 cells is shown in FIG 4.
  • the non-binding lgG1 isotype control antibody, R347 showed no detectable fluorescence at any time point.
  • the EGFR/cMET bispecific antibody, RAA22/B09 exhibited intracellular fluorescence by 3 hours and fluorescence intensity continued to increase out to 48 hours post treatment.
  • the monovalent EGFR binding control antibody, RAA22/R347 showed very weak fluorescence starting at 24 hours, which did not increase dramatically by 48 hours.
  • the monovalent monospecific cMET binding control antibody, B09/R347 showed modest fluorescence at 24 hours, increasing further by 48 hours.
  • the intensity of the fluorescent signal of the monospecific cMET antibody was modest compared to the bispecific RAA22/B09, suggesting that the bispecific antibody has greater internalization efficiency than the monospecific parental antibody in the dual target expressing cell line tested here.
  • the difference between bispecific antibody and monospecific controls was even more striking (FIG 5).
  • the monospecific antibodies showed very little fluorescence, even at 48 hours, while the bispecific RAA22/B09 antibody again showed intracellular fluorescence by 3 hours and fluorescence intensity continued to increase out to 48 hours post treatment.
  • the monospecific parental antibodies show a reduced uptake and fluorescence intensity compared to the bispecific antibody.
  • a logical extension of these conclusions is to suggest that the bispecific antibody might behave more like the monospecific antibodies in tissues that express only one but not both targets, which is generally true for EGFR and cMET.
  • the pHAb labeled lowered affinity EGFR control mAb, RAA22/R347 exhibited negligible uptake and fluorescence. This reduced binding to EGFR could minimize the impact of the ADC in normal tissues, such as the skin, which express significant levels of EGFR but little or no cMET.
  • H1975 and HCC827 cells were from ATCC.
  • RAA22/B09, QD6/B09, and single-arm derivatives were from Medlmmune.
  • QD6/B09 and single arm specific controls QD6/lgG and B09/lgG, with IgG Fab arms were derived from the non-specific human lgG1 NMGC were from Medlmmune.
  • RAA22/B09 and single-arm specific controls RAA22/lgG and B09/lgG derived from the non-specific human IgG 1 R347, were from Medlmmune.
  • RPMI 11875-093
  • HEPES 15630106
  • sodium pyruvate 11360070
  • AlexaFluor® 647 A-20186
  • Monoclonal Antibody Labeling Kits ZebaTM Spin Desalting Columns (87767), and CellTrackerTM Blue CMAC (C2110) were from Life Technologies (Carlsbad, CA).
  • Accutase Cell Detachment Solution (423201) was from BioLegend (San Diego, CA).
  • HyClone heat-inactivated fetal bovine serum SH30071 .03HI
  • PBS (21-040) was from Corning Incorporated (Corning, NY).
  • FcR Blocking Reagent 130-059-901 was from Miltenyi Biotec Inc. (Auburn, CA). Polypropylene round-bottomed tubes (352063) were from BD Biosciences (San Jose, CA). CellCarrier 384-well microplates were from PerkinElmer Inc. (Cat# 6007550, Waltham, MA).
  • Monoclonal antibodies were conjugated with AlexaFluor-647 dyes using the antibody labeling kits according to manufacturer instructions.
  • Adherent H1975 or HCC827 cells were cultured in T-75 flasks in the CO2 incubators using media RPMI- 1640 containing 10% fetal bovine serum (FBS) to 80-90% confluency after initial seeding.
  • FBS fetal bovine serum
  • adherent monolayers grown in T-75 flasks were dissociated into cell suspension using Accutase. Detached cells were washed twice with 1x PBS using centrifugation at 300xg for 5 min. Cells were then resuspended into phenol-free RPMI at concentration of 2x106 cells/mL and used for staining.
  • Cell suspension at 2x106 cells/mL were incubated for 30 min with 1 pM CellTrackerTM Blue CMAC prepared in phenol-free RPMI at 37°C in the CO2 incubator. Unincorporated CellTrackerTM Blue CMAC dye was removed by two washes with phenol-free RPMI using centrifugation at 300xg for 5 min at 4°C. Cells were then chilled on ice and blocked with the 10 ul FcR Blocking Reagent per 1 x106 cells for 15 minutes. 2x10 5 cells were aliquoted into 5 mL round-bottomed tubes and incubated with fluorescent antibodies at a final concentration of 2.5 pg/mL.
  • cells After removal of unbound fluorescent reagents by centrifugation at 4°C, cells were resuspended in phenol-free RPMI containing 100 mM HEPES, 1 mM sodium pyruvate, and 1% FBS. Cells were transferred into multiple wells of a 384-well imaging plate at a density of 50,00 cells per well, and briefly centrifuged at 2,200 rpm for 2 min at 4°C prior to image acquisition.
  • Stained cells in imaging plates were either imaged on an Opera confocal fluorescence imaging system as previous described previously (Vainshtein, 2015) or transferred onto a Zeiss Axio Observer.ZI inverted microscope with 40X/1.2NA LCIPIan Apo objective (Carl Zeiss Microscopy, Thornwood, NY).
  • the imaging environment was kept at 37°C at 5% CO2 and 70%humidity using an Incubator XLmulti S DARK (PeCon Gmbh, Erbach, Germany). Samples were illuminated by 405, 488, 561 , and 63 nm solid-state lasers (Carl Zeiss Microscopy, Thornwood, NY).
  • a series of images was acquired at indicated times using a Yokogawa CSU-X1 Spinning Disk Unit (Yokogawa Electric Corporation, Tokyo, Japan) with Evolve 512 EMCCD (Photometries, Tuscon, AZ). Prior to image acquisition, exposure parameters, such as laser power, exposure times, camera gain, etc., were determined using an aliquot of the stained cells. Images were processed using ZEN 2.3 (Carl Zeiss Microscopy, Thornwood, NY) and analyzed using Columbus software (PerkinElmer, Waltham, MA).
  • the algorithm used for quantification of antibody internalization was described previously (Vainsthein, 2015), with the following updates and modifications.
  • the reference channel used for iterative image processing originated from the CellTrackerTM Blue CMAC (CTB) staining of cells. Signal channel still derived from the antibody-AlexaFluor-647 channels of the imagers. Images were processed by the algorithm using algorithm-defined parameters, which were initially set as default values and then optimized for each cell type and experiment. CTB staining of the image was used to identify cells using thresholding to detect a region on the image having a higher intensity than its surrounding based excluding areas with fluorescence intensity signals below the threshold. The remaining identified cell objects were designated “Total Cell”.
  • Cells were further selected filtering on morphology properties area (objects between 120-600 pm2) and roundness (>0.5). “Membrane Region” and “Cytoplasm Region” in the accepted cells were then constructed around the object boundaries using algorithm-defined parameters. Fluorescence intensity in each region was used to monitor antibody-associated AlexaFluor- 647 signals. The fluorescence intensities of each region were reported as the mean of the sum of all pixels in accepted cells.
  • Kinetic images were taken every 5 min over the time course of internalization and were processed using quantitative algorithm (see above) to determine internalization kinetic constants and half-times.
  • FIG 6b shows very comparable internalization kinetic for QD6/B09 and RAA22/B09 with the half-times of 37.5 ⁇ 10.6 min and 43.2 ⁇ 15.5, respectively.
  • the B09/lgG construct showed very small level of internalization (FIG 7B, right).
  • the rapid and extensive decrease of the membrane signal corresponded to a very moderate increase of the cytoplasm signal, likely due to extensive dissociation of pre-bound B09/lgG from c-MET receptor on the cell surface.
  • the dissociation of the antibody subsequently resulted in modest internalization of B09/lgG.
  • RAA22/B09 DuetMab showed internalization profiles very different when compared to its single-arm control antibodies. As seen in FIG 7B, cytoplasmic intensity values were 10.98- and 4.70-fold higher for RAA22/B09 DuetMab than RAA22-lgG and B09-lgG, respectively. While inefficient internalization of B09/lgG maybe attributed to its pronounced dissociation (discussed above), RAA22/lgG did undergo rapid internalization. However, due to the lower affinity of the EGFR-arm, the number of RAA22/lgG molecules were 10.98-fold less (based on fluorescent intensity) than for the RAA22-B09 DuetMab.
  • the amino acid sequence of RAA22-B09 was evaluated for the presence of known liabilities, including deamidation sites, oxidation sites and introduced glycosylation sites in the CDR region. The analysis did not reveal any sequence liabilities that were deemed high risk.
  • Samples were analyzed after 1 month; for materials stored at 5°C and at 25°C also after 2 months.
  • the ADC retained cytotoxic activity after incubation at the indicated temperatures for 4 weeks. It was concluded that the ADC exhibits good thermal stability.
  • the thermal melting temperature of mAb intermediate and ADC were determined by differential scanning calorimetry (DSC). It was found that conjugation does not decrease the melting temperature significantly. A homogenous population is observed post conjugation.
  • RAA22/B09-AZ1508 was diluted in 0.2 pM filtered rat, mouse and cynomolgus serum to a final concentration of 200 pg/mL and incubated at 37C for zero, one, three, and seven days.
  • NHS- activated sepharose beads (GE Healthcare) were washed three times with 1X phosphate-buffered saline (PBS; pH 7.4), via centrifugation at 1 x 1000g for one minute, to remove the isopropanol storage solution.
  • RAA22/B09-AZ1508 was recovered from the serum by incubating 100 pL of the RAA22/B09-AZ1508-serum incubated mixture with 50 pL EGFR beads for 30 minutes at room temperature; followed by three sequential washes with 1X PBS buffer and elution with 100 pL antibody elution buffer (IgG elution buffer; Thermoscientific). The eluent was analyzed by rLCMS to calculate the amount of intact ADC remaining.
  • FACS was carried out in order to quantify the relative EGFR and c-Met density in the cell lines tested.
  • PanIX, anti-EGFR-cMet and R347 purified antibodies were labeled using Alexa Fluor 647 Monoclonal Antibody Labeling Kit as per manufacturer instructions (Invitrogen Catalog no. A20186).
  • Antibody concentration and fluorochrome to protein (F:P) ratio was calculated using a NanoDrop ND -1000 Spectrophotomer.
  • Cells were harvested and washed to a single cell suspension. Cell number and viability (>90%) was determined by Vi-Cell XLR Analyzer (Beckman Coulter). Cell concentration was adjusted to 5 x 106 cells/ml in ice cold FACS Buffer (Phosphate Buffered Saline pH 7.4, 5% FBS, 0.1% Sodium Azide) and plated into a 96 well u-bottom polystyrene plate, at 250, 000 cells/well. Alexa 647 conjugated antibodies were serial diluted in cold FACS buffer at various concentrations (0.15 -40 pg/mL) in duplicates to provide a binding curve. Cells and primary antibodies were incubated on wet ice for 20 minutes in dark.
  • FACS Buffer Phosphate Buffered Saline pH 7.4, 5% FBS, 0.1% Sodium Azide
  • the amount of EGFR, EGFR-cMet on the cells was assessed by employing Quantum Alexa Fluor 647 MESF beads (Catalog no. 647C, Bangs Laboratories) 10,000 events were acquired per sample (LSRII), utilizing the same flow cytometry settings as samples listed above.
  • QuickCal program www.bangslabs.com
  • Mean Fluorescence intensity MFI is directly proportional to the amount of fluorochrome present to calculate the number of molecules per cell.
  • MESF calculated from the Quickcal program is divided by the antibody F:P ratio to give corrected ABC (Antibody Binding Capacity).
  • the ADC cytotoxic activity was tested in multiple cell lines as follows. Cells were plated at a density of 10,000 cells per well of 96-well plates in a volume of 100 pL in their recommended culture media supplemented with 10% fetal bovine serum. A 3X concentration of each dose of antibody to be tested was prepared by serial dilution of the antibody stock in culture medium. Fifty microliters of each test article was added to cells in triplicate such that the final antibody concentration ranged from 60 nM to 0.0009 nM. The treated cells were cultured for 72 hours at 37 degrees C in a humidified incubator. The metabolic activity was determined using CellTiter-Glo Luminescent Viability Assay from Promega according to manufacturer’s instructions. Data were plotted as percent metabolic activity relative to untreated control. IC50 values were determined using logistic non-linear regression analysis between the maximal viability (untreated cells) and the maximal response (peak inhibition) with GraphPad Prism software.
  • both ADC showed reduced potency when one or the other target had a low relative receptor density at the cell surface of about 15,000 or less. This effect was more pronounced with the lowered affinity variant, which appeared more sensitive to lower levels of cMET.
  • each arm functions independently, the expected result would be that each monospecific control ADC would only be modestly less potent than the bispecific ADC, and the difference would be additive.
  • the two arms of the bispecific function synergistically, one would expect larger differences in activity of the bispecific ADC compared to the monospecific control antibodies.
  • the cytotoxic activity of ADC’s were tested in the NCI-H1975 cell line as follows. Cells were plated at a density of 10,000 cells per well of 96-well plates in a volume of 50 pL for the blocking experiment and 100 pL for the monovalent ADC experiment in their recommended culture media supplemented with 10% fetal bovine serum. For the unarmed mAb blocking experiments, 50 pL of a 300 pg/mL solution of either EGFR IgG (RAA22) or cMET IgG (B09) was added to the wells and pre-incubated for one hour at 37 degrees C in a humidified incubator. A 3X concentration of each dose of antibody to be tested was prepared by 4X serial dilution of the antibody stock in culture medium.
  • the IC50 was about 20,500 pM compared to 316 pM for the bispecific EGFR- cMET ADC, a difference of about 65 fold (FIG 11).
  • the IC50 of the monovalent monospecific anti-cMET ADC was 2,772 pM, a difference of about 13 fold compared to the bispecific antibody.
  • EXAMPLE 8 ADC in vivo pharmacology in Patient Derived Xenograft (PDX) models
  • PDX Patient derived xenograft
  • PDX models of human cancer have become a well-established alternative to tumor cell line based tumor xenografts.
  • PDX models are established from a patient’s primary tumor tissue implanted directly into immunodeficient mice to yield in vivo propagated tumors in the mouse.
  • the tumors thus derived are subsequently propagated in additional mice, without culturing in vitro, to establish a bank of low passage PDX tumor tissue which can be used to implant study mice.
  • One key feature of PDX models is that they largely maintain the histological and genomic heterogeneity and preserve the gene expression profile of the corresponding original patient tumor.
  • PDX models Compared to tumor cell line based xenograft models, which use clonal populations of tumor cells that have been adapted to growth in vitro, the characteristics of PDX models are intended to more accurately replicate the features of real human tumors, thus improving the predictive value of pre-clinical mouse models. Indeed, numerous studies have shown that the response and resistance profiles of PDX models to standard of care treatments closely correlate with clinical data in human subjects with a given tumor profile.
  • mice are typically treated at a single dose level established from prior dose range finding studies, with an optional treatment control group for each model.
  • mice were implanted unilaterally on the flank with tumor fragments harvested from host animals, each implanted from a specific passage lot. Pre-study tumor volumes were recorded beginning approximately one week prior to its estimated start date. When tumors reached the appropriate Tumor Volume Initiation (TVI) range (125-250 mm 3 ), animals were randomized into treatment and control groups and intravenous (IV) dosing was initiated (Day 0); animals were followed individually throughout the study. Initial dosing began on Day 0; animals in all groups were dosed I.V.
  • TVI Tumor Volume Initiation
  • tumor growth observations continued for one week after the final dose. Each animal was sacrificed upon reaching the Tumor Volume (TV) endpoint (tumor volume >1cm 3 ) or the study time endpoint of 28 days, whichever came first. The observation period was extended for some PDX models with slow growing tumors.
  • TV Tumor Volume
  • %TGI Tumor growth inhibition
  • the lowered affinity ADC showed an overall trend of increased number and depth of responses observed, compared to the higher affinity ADC. This activity trend was slightly reversed for the PDX models that were least responsive to the lowered affinity ADC, which correlated somewhat to lower cMET expression.
  • the EGFR binding arm of both bispecific antibodies was derived from the same mouse EGFR cross reactive antibody (see Example 1).
  • the intrinsic binding affinity of the QD6/B09 antibody toward mouse EGFR was approximately 6 nM, whereas the affinity of the RAA22/B09 bispecific antibody was approximately 575 nM.
  • the unexpected improvement in the activity of the lowered EGFR affinity could be attributed to a reduced impact from the EGFR sink in normal tissues, such as the skin, resulting in higher overall circulating exposure of the ADC. Regardless, these data demonstrate that reducing the affinity toward EGFR of the EGFR-cMET bispecific antibody did not compromise the in vivo efficacy of the resulting ADC, but unexpectedly improved the activity compared to the higher affinity ADC.
  • the lowered affinity ADC was generally more efficacious than the high affinity ADC.
  • the lowered affinity ADC induced regressions at 2 or 3 mg/kg dose levels, demonstrating that the lowered affinity ADC is efficacious at modest doses.
  • Subcutaneous in vivo tumor models are the mainstay for examining the efficacy of anti-cancer agents.
  • this tumor implantation site is accompanied by a number of limitations that need to be considered when interpreting in vivo results. These deficiencies include, tumor vascularization and the lack of tissue-specific stroma in the growth and response of the tumor.
  • MEDI- PANC-08 LUC a Luciferase expressing PDX variant whose growth could be tracked using Imaging.
  • the MEDI-PANC-08 pancreatic PDX model used in this study came from the Internal Medlmmune PDX library.
  • the PDX tumor was initially propagated in seed NSG (NOD.Cg-Prkdc scid H2rg tm1Wjl /SzJ) mice, to generate sufficient tumor material to seed the efficacy study. Once tumors reached 800-1200mm 3 the mice were humanely euthanized by CO2 asphyxiation. Tumors were isolated under sterile conditions, cut into ⁇ 2mm 3 pieces and implanted subcutaneously into the right flank of individual NSG mice using an 11 - guage trocar needle.
  • mice Upon reaching ⁇ 150-250mm3 in size, mice were randomized (based on tumor volume) into treatment groups and treated with the ADCs (Q1 Wx4). Two EGFR-cMET bispecific ADCs were examined at 1 , 2 and 3 mg/kg the QD6/B09 (high affinity) and RAA2/B09 (low affinity). An Isotype control ADC (R347-AZ1508) was also tested at 3 mg/kg. All Antibody-Drug Conjugates were diluted in buffer (25mM Histidine, 7% Sucrose, 0.02% PS80, pH 6.0), immediately prior to use and administered i.v. via the tail vein. Tumor and body weight measurements were collected twice weekly and tumor volume calculated using the equation (LxW2)/2, where L and W refer to the length and width dimensions, respectively.
  • the luciferase expressing PDX model (MEDI-PANC-08 LUC ) was grown subcutaneously in NSG seed mice and at a volume of 800-1200mm 3 the tumors were harvested and cut into fragments of approximately 2mm 3 . The tumor fragments were subsequently sutured to the pancreas of NSG mice (Day Zero). Luciferase signal was determined weekly using the MS Spectrum In vivo Imaging system. Briefly, 10 minutes prior to imaging, 200ul of luciferin dissolved in DPBS (15 mg/ml) was injected intra-peritoneally (i.p.). The mice were anesthetized under 3% isoflurane, laid on their right side and luminescence measured.
  • mice Fourteen days after tumor implant, when luminescent signal was clearly detectable, the mice were randomized into their respective groups based on the luminescence. The mice were treated with Isotype control (R347-AZ1508, 3 mg/kg - Q1Wx4), Gemcitabine (75 mg/kg, Q2Dx5) and RAA2/B09 ADC (2 and 3 mg/kg - Q1 Wx4). Luminescence was measured weekly. Study endpoints included body weight loss, deterioration of body condition and lethargy. Data were analyzed using the Living Image software (Perkin Elmer) and plotted as Average Radiance [p/s/cm2/sr] against time.
  • high and low affinity EGFR-cMET bispecific ADCs were compared in an in vivo efficacy study using the MEDI-PANC-08 pancreatic PDX model. As shown in Panels A and B of FIG 14, a disparate difference was observed between the 2 molecules.
  • the high affinity QD6/B09 ADC did not show efficacy at any of the 3 dose levels tested.
  • the low Affinity RAA2/B09 ADC produced complete tumor regression by day 65 followed by tumor re-growth at the 3 mg/kg dose level and tumor growth inhibition at 2 mg/kg.
  • pancreatic cancer Whilst subcutaneous tumor models have become the work-horse for in vivo efficacy studies, a major deficiency is that tumors are not grown at the site of origin and hence any drug response might not truly reflect of how patients will respond.
  • an orthotopic model of pancreatic cancer was developed using the MEDI-PANC-08 tumor that had been transgenically modified to stably express luciferase. Following surgical implantation on the pancreas, tumors were allowed to establish and subsequently randomized based on luminescent signal. The mice were then treated with either the Low affinity RAA2/B09 EGFR-cMET ADC, isotype control or gemcitabine (a chemotherapy drug). Following treatment, the luminescence was measured weekly.
  • the low Affinity EGFR-cMET RAA2/B09 ADC demonstrated improved efficacy compared to the high affinity QD6/B09 ADC in a subcutaneous PDX Pancreatic PDX model, with tumor regressions seen at 3mg/kg.
  • This efficacy was also observed in an orthotopic model using the same PDX tumor (MEDI-PANC-08) engineered to stably express luciferase.
  • RAA2/B09 ADC showed improved efficacy over the subcutaneous model producing tumor regressions at both 2 and 3 mg/kg.
  • PK analyses were carried out to compare the plasma PK parameters of the low and high affinity EGFR-cMET ADCs, including peak and total exposure, clearance, and half-life in mice and cynomolgus monkeys.
  • a key aim was to determine whether reducing the affinity for EGFR would impact the circulating exposure of the EGFR-cMET bispecific ADC.
  • PK samples were collected in mice and cynomolgus monkeys for both QD6/B09-57-AZ1508 and RAA/B09-57-AZ1508 across various dose levels.
  • Non-compartmental analysis was performed to estimate PK parameters for QD6/B09-57-AZ1508 and RAA22/B09-57-AZ1508 based on total ADC concentrations across species and dose levels.
  • RAA22/B09-57-AZ1508 shows higher exposure and prolonged t% compared to QD6/B09-57- AZ1508 in both mice and cynomolgus monkeys, suggesting improved PK in the lower affinity RAA22/B09-57-AZ1508.
  • the target compounds (QD6/B09-57-AZ1508 and RAA22/B09-57-AZ1508) concentration and the total antibody concentration was measured with one immuno capture LC-MS/MS assay. Briefly, a polyclonal anti-human antibody was conjugated to magnetic beads. Then 25 pL of plasma sample was diluted in PBS and incubated together with the magnetic beads. After capturing, the magnetic beads were washed multiple times before digested with trypsin under the presence of internal standards. The digestion was quenched with the addition of acid. The liquid content was then transferred to the injection plate.
  • the signature tryptic peptide on the human antibody Fc region and the cleaved warhead was separated using reversed phase chromatography (RPLC) followed with detection using multiple reaction monitoring (MRM).
  • RPLC reversed phase chromatography
  • MRM multiple reaction monitoring
  • a signature peptide on the Fc region was used to calculate total Ab, while the digestion released warhead was used to calculate the ADCs.
  • the internal standard used in this experiment are isotopically labeled peptide or protein (SiluMAb, Sigma-Aldrich) or isotopically labeled warhead.
  • the peak area ratio of the analyte against the internal standards was used to calculate against the standard curve.
  • the standard curves and QCs are prepared by spiking the target compounds at different levels into the same matrix as the samples.
  • the quantification range covers 100 ng/mL-15,000 ng/mL, with the dilution QC covering up to 525,000 ng/mL.
  • the standard curve was fitted with the simplest possible model.
  • the accuracy and precision of the assay is within 20% for all levels except the lower limit of quantification (LLOQ), which is at 25%.
  • Both RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 exhibited linear PK in mice at the dose levels tested, with dose-proportional exposure (Cmax and AUC), comparable CL and ti/2 observed at 0.5 mg/kg to 10 mg/kg for RAA22/B09-57-AZ1508 and at 1 mg/kg to 10 mg/kg for QD6/B09-57-AZ1508, respectively.
  • PK comparison between RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 is assessed at 1 , 3, 5, 10 mg/kg dose levels that were tested for both compounds and the mean PK parameters based on NCA is summarized in Table 5.
  • RAA22/B09-57-AZ1508 exhibited linear PK in cynomolgus monkeys at 2 mg/kg to 5 mg/kg, with doseproportional exposure (Cmax and AUC), comparable CL and ti/2 observed.
  • QD6/B09-57-AZ1508 exhibited non-linear PK in cynomolgus monkeys at 0.67 mg/kg to 3 mg/kg, with more than dose-proportional exposure (Cmax and AUC) shown, and faster CL and shorter ti/2 observed at lower dose levels.
  • PK comparison between RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 in cynomolgus monkeys is assessed at 2 and 3 mg/kg dose levels that were tested for both compounds and the mean PK parameters based on NCA is summarized in Table 7.
  • Table 7 Mean NCA PK parameters by Dose levels between RAA22/B09-57-AZ1508 and QD6/B09-57-AZ1508 in Monkeys
  • the DuetMab RAA22/B09 (with the “Maia” cysteine insertion after serine 239) bispecific antibody produced according to Example 1 was conjugated to the topoisomerase inhibitor SG3932 via “classical” conjugation to native cysteines in the bispecific antibody.
  • the efficacy of the EGFR/cMET topoisomerase I inhibitor ADC was investigated using a PDX trial.
  • the PDX trial was carried out essentially as described above for Example 8 using a variety of different PDX models obtained from pancreatic, colon, NSCLC and squamous head and neck carcinoma (SQHN) tumors. Animals were injected with a single dose of the EGFR-cMET Maia Topo ADC at 10 mg/kg. The results of the PDX trial using the EGFR-cMET Maia Topo ADC are reported in FIG 17.
  • the ADC with the topoisomerase I inhibitor produced and tested in Example 11 used the RAA22/B09 bispecific antibody containing the “Maia” cysteine insertion after serine 239. However, given that SG3932 conjugates to native cysteines, the Maia cysteine insertion is not necessary. We therefore sought to modify the RAA22/B09 Maia Topo ADC produced in Example 11 to remove this cysteine insertion.
  • the newly generated “EGFR-cMET TM” molecule comprising variable regions from RAA22 and B09, with the 239i mutation removed and the TM introduced has the amino acid sequences set forth in the following table:
  • TCEP Tris(2-carboxyethyl)phosphine
  • PBS phosphate- buffered saline pH 7.4
  • EDTA ethylenediaminetetraacetic acid
  • SG3932 was then added as a DMSO solution (12.5 molar equivalent/antibody) for a 10% (v/v) final DMSO concentration. The solution was incubated for 2 hours at room temperature and then quenched by the addition of A/-acetyl cysteine (5 micromoles/SG3932) and incubated at room temperature for 15 min. The reaction mixture filtered using 0.2 uM sterile filter and then stored at 2-8°C overnight. Excess free drug was removed via Tangential Flow Filtration unit (TFF) using mPES, MidiKros® 30 kDa fiber filter with 375 cm 2 surface area, into buffer containing 30 mm Histidine, 30 mM Arginine, pH 6.8.
  • TMF Tangential Flow Filtration unit
  • the efficacy of the EGFR-cMET TM ADC was investigated using a PDX trial.
  • the PDX trial was carried out essentially as described above for Example 8 using a range of different PDX models obtained from pancreatic, colon, NSCLC and SQHN tumours. Animals were injected with a single dose of the EGFR- cMET TM ADC at 5 mg/kg. The results of the PDX trial using the EGFR-cMET TM ADC are reported in FIG 18. Results from this experiment demonstrate that the EGFR-cMET TM ADC was able to induce tumour growth inhibition or regression in numerous PDX models tested
  • TM ADC EGFR-cMET Maia Topo ADC
  • Maina ADC EGFR-cMET Maia Topo ADC
  • the animals were doses with 2.5 mg/kg, 5 mg/kg or 10 mg/kg of each ADC and tumour growth monitored. Also included in this experiment was an untreated control (“untreated) and animal dosed with unconjugated EGFR-cMET TM (TM mAb). The results are shown in FIG 19.
  • the EGFR-cMET TM ADC was also shown to be effective at reducing tumour growth in NSCLC tumours that express either wild type or mutant EGFR. Results demonstrate that the EGFR-cMET TM ADC is active in both wild type and mutant EGFR PDX models are shown in FIG 20. This is advantageous, as it indicates that the ADCs will be able to provide a benefit in multiple therapeutic settings and across a range of different EGFR genotypes.
  • PK pharmacokinetic
  • Antibody mediated receptor degradation was performed by Western blot analysis as follows: HCC827 GR pool cells were plated in 12 well culture plates (Corning /Costar) at 6X10 5 cells/well in 2 ml of RPMI (Gibco) media containing 10% heat inactivated fetal bovine serum (HI FBS, Gibco). The cells were allowed to adhere and grow overnight at 37 °C with 5% CO2 incubator. Next day morning, The growth media was carefully aspirated away, and the cells were treated with 1 mL of fresh growth media containing the test mAbs identified in Table 9, each at a final concentration of 10 micrograms per mL. The cells were incubated at 37 °C in a humidified growth chamber at 5% CO2 for 24 hours.
  • the resulting lysates were transferred to microcentrifuge tubes and cellular debris was removed by centrifugation for 10 minutes at maximum speed (14,000 RPM) at 4oC microcentrifuge, transferred supernatant to clean microcentrifuge tubes and stored at -80 °C prior to analysis. Protein concentration were measured by using Pierce BCA Protein Assay Kit ( Thermo Scientific).
  • the blots were blocked with Pierce protein free T20 (PBS) blocking buffer (Thermo Scientific) for one hour at room temperature. Then Incubated with primary specific antibody for overnight at 4oC [ (1 :4,500 dilutions of total cMET; 1 :2,500 dilution of Total EGFR and 1 :15,000 beta-actin] (Cell Signaling Technologies) in blocking buffer. The specifically bound antibodies were detected with horseradish peroxidase (HRP) labeled secondary antibodies (Jackson Immunoresearch) using SuperSignal West Dura ECL reagent (Pierce/Thermo Scientific). Images were captured with GE Image Quant LAS 4000.
  • HRP horseradish peroxidase
  • HFR3 - RVKITADISTRTTYMELSSLRSEDTAVYYCAR (SEQ ID NO: 10)
  • VH variable heavy region of anti-EGFR antibody clone RAA22
  • Amino acid sequence of the VH region of anti-EGFR antibody clone QD6 (SEQ ID NO: 18):
  • ADISTRTTYMELSSLRSEDTAVYYCARRLMSAISGPGAPLLMWGQGTLVTVSS Nucleic acid sequence of the VH region of anti-EGFR antibody clone QD6 (SEQ ID NO: 19):
  • VL variable light region of anti-EGFR antibody clone RAA22
  • Amino acid sequence of the VL region of anti-EGFR antibody clone QD6 (SEQ ID NO: 22):
  • LFR2 - WYQQKPGKAPKLLIY (SEQ ID NO: 35)
  • LFR3 - GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC (SEQ ID NO: 36)
  • VH variable heavy region ofanti-c-Met antibody clone B09-GL
  • VL variable light
  • Amino acid seguence of a human immunoglobulin G1 CH region modified to include “Knob” mutation, interchain cysteine mutations, a cysteine to form a stabilizing disulfide bridge and with a cysteine insertion (SEQ ID NO: 43):
  • “Knob” mutation T366W
  • interchain cysteine mutations F126C and C219V
  • stabilizing cysteine mutation S354C
  • cysteine insertion C239i
  • “Knob” mutation T366W
  • interchain cysteine mutations F126C and C219V
  • stabilizing cysteine mutation S354C
  • “Hole” mutations T366S, L368A, and Y407V); stabilizing cysteine mutation (Y349C); and cysteine insertion (C239i), where numbering of residues is according to EU index.
  • Amino acid seguence of a human immunoglobulin G1 CH region modified to include “Hole” mutations, a cysteine to form a stabilizing disulfide bridge and without a cysteine insertion (SEQ ID NO: 46):
  • “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
  • “Knob” mutation T366W
  • interchain cysteine mutations F126C and C219V
  • stabilizing cysteine mutation S354C
  • cysteine insertion C239i
  • “Knob” mutation T366W
  • interchain cysteine mutations F126C and C219V
  • stabilizing cysteine mutation S354C
  • “Hole” mutations T366S, L368A, and Y407V); stabilizing cysteine mutation (Y349C); and cysteine insertion (C239i), where numbering of residues is according to EU index.
  • “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
  • Amino acid sequence of the light chain of anti-EGFR antibody clone QD6 (SEQ ID NO: 55):
  • Amino acid sequence of the heavy chain of anti-EGFR antibody clone RAA22 with cysteine insertion SEQ ID NO: 56:
  • “Hole” mutations T366S, L368A, and Y407V); stabilizing cysteine mutation (Y349C); and cysteine insertion (C239i), where numbering of residues is according to EU index.
  • “Hole” mutations T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
  • Amino acid sequence of the light chain of anti-EGFR antibody clone RAA22 (SEQ ID NO: 58):
  • Amino acid sequence of the heavy chain of anti-EGFR in “EGFR-cMET TM” antibody (SEQ ID NO: 59):
  • T366W Triple mutation (TM; L234F, L235E and P331 S); “Knob” mutation (T366W); interchain cysteine mutations (F126C and C219V); stabilizing cysteine mutation (S354C), where numbering of residues is according to EU index.
  • Amino acid sequence of the heavy chain of anti-c-Met in “EGFR-cMET TM” antibody (SEQ ID NO: 60):
  • Triple mutation (TM; L234F, L235E and P331 S); “Hole” mutations (T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
  • Amino acid sequence of the light chain of anti-EGFR in “EGFR-cMET TM” antibody (SEQ ID NO: 61):
  • T366W Triple mutation (TM; L234F, L235E and P331 S); “Knob” mutation (T366W); interchain cysteine mutations (F126C and C219V); stabilizing cysteine mutation (S354C), where numbering of residues is according to EU index.
  • Triple mutation (TM; L234F, L235E and P331 S); “Hole” mutations (T366S, L368A, and Y407V); and stabilizing cysteine mutation (Y349C), where numbering of residues is according to EU index.
  • Amino acid sequence of the human EGFR extracellular domain (SEQ ID NO: 68):

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2022/081225 2021-11-10 2022-11-09 Antibody molecules and conjugates Ceased WO2023083846A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2022384597A AU2022384597B2 (en) 2021-11-10 2022-11-09 Antibody molecules and conjugates
KR1020247018705A KR20240099430A (ko) 2021-11-10 2022-11-09 항체 분자 및 접합체
IL312566A IL312566A (en) 2021-11-10 2022-11-09 molecules and antibodies
EP22817545.1A EP4429765A1 (en) 2021-11-10 2022-11-09 Antibody molecules and conjugates
CA3237211A CA3237211A1 (en) 2021-11-10 2022-11-09 Antibody molecules and conjugates
CN202280086269.9A CN118556084A (zh) 2021-11-10 2022-11-09 抗体分子和缀合物
MX2024005712A MX2024005712A (es) 2021-11-10 2022-11-09 Moleculas de anticuerpo y conjugados.
JP2024527384A JP2024544520A (ja) 2021-11-10 2022-11-09 抗体分子及び複合体
CONC2024/0007192A CO2024007192A2 (es) 2021-11-10 2024-06-07 Moléculas de anticuerpo y conjugados

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163263835P 2021-11-10 2021-11-10
US63/263,835 2021-11-10

Publications (1)

Publication Number Publication Date
WO2023083846A1 true WO2023083846A1 (en) 2023-05-19

Family

ID=84387847

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/081225 Ceased WO2023083846A1 (en) 2021-11-10 2022-11-09 Antibody molecules and conjugates

Country Status (14)

Country Link
US (2) US12065496B2 (https=)
EP (1) EP4429765A1 (https=)
JP (1) JP2024544520A (https=)
KR (1) KR20240099430A (https=)
CN (1) CN118556084A (https=)
AR (1) AR127629A1 (https=)
CA (1) CA3237211A1 (https=)
CL (1) CL2024001384A1 (https=)
CO (1) CO2024007192A2 (https=)
EC (1) ECSP24044371A (https=)
IL (1) IL312566A (https=)
MX (1) MX2024005712A (https=)
TW (1) TW202336037A (https=)
WO (1) WO2023083846A1 (https=)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024002938A1 (en) * 2022-06-27 2024-01-04 Astrazeneca Ab Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer
WO2025106278A1 (en) 2023-11-17 2025-05-22 Mersana Therapeutics, Inc. Treatment of cancer using b7-h4-targeted antibody-drug conjugates
WO2025108427A1 (zh) * 2023-11-23 2025-05-30 橙帆生物医药公司 结合分子及抗体药物偶联物和用途
WO2025230410A1 (en) * 2024-04-30 2025-11-06 Merus N.V. Multispecific antibody-drug conjugates
WO2025230409A1 (en) * 2024-04-30 2025-11-06 Merus N.V. Multispecific antibody-drug conjugates

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TW202527997A (zh) * 2023-11-15 2025-07-16 大陸商四川科倫博泰生物醫藥股份有限公司 靶向egfr/c—met之抗體—藥物結合物以及其製備方法及用途
CN117659203B (zh) * 2023-12-06 2024-08-13 科弈(浙江)药业科技有限公司 一种抗met/egfr双特异性抗体及其药物偶联物
WO2026021476A1 (en) 2024-07-24 2026-01-29 Beone Guangzhou Biologics Manufacturing Co., Ltd. Anti-cmet and anti-egfr multispecific antibody drug conjugates

Citations (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
US7723485B2 (en) 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
US7776814B2 (en) 2002-07-09 2010-08-17 R&D-Biopharmaceuticals Gmbh Tubulysin conjugates
WO2012019123A1 (en) 2010-08-06 2012-02-09 Endocyte, Inc. Processes for preparing tubulysins
WO2015016559A1 (en) * 2013-07-29 2015-02-05 Samsung Electronics Co., Ltd. Anti-egfr antibody and anti-c-met/anti-egfr bispecific antibodies comprising the same
WO2015157594A1 (en) 2014-04-11 2015-10-15 Medimmune Llc Tubulysin derivatives
US9527927B2 (en) 2011-12-20 2016-12-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
WO2017076492A1 (en) * 2015-11-03 2017-05-11 Merck Patent Gmbh Bi-specific antibodies for enhanced tumor selectivity and inhibition and uses thereof
US20200231681A1 (en) * 2017-05-30 2020-07-23 Chong Kun Dang Pharmaceutical Corp. A novel anti-c-met antibody and use thereof

Patent Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
US7776814B2 (en) 2002-07-09 2010-08-17 R&D-Biopharmaceuticals Gmbh Tubulysin conjugates
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7723485B2 (en) 2007-05-08 2010-05-25 Genentech, Inc. Cysteine engineered anti-MUC16 antibodies and antibody drug conjugates
WO2009052249A1 (en) 2007-10-19 2009-04-23 Genentech, Inc. Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates
WO2012019123A1 (en) 2010-08-06 2012-02-09 Endocyte, Inc. Processes for preparing tubulysins
US9527927B2 (en) 2011-12-20 2016-12-27 Medimmune, Llc Modified polypeptides for bispecific antibody scaffolds
WO2015016559A1 (en) * 2013-07-29 2015-02-05 Samsung Electronics Co., Ltd. Anti-egfr antibody and anti-c-met/anti-egfr bispecific antibodies comprising the same
WO2015157594A1 (en) 2014-04-11 2015-10-15 Medimmune Llc Tubulysin derivatives
US20150291657A1 (en) 2014-04-11 2015-10-15 Medimmune Llc Tubulysin derivatives
WO2017076492A1 (en) * 2015-11-03 2017-05-11 Merck Patent Gmbh Bi-specific antibodies for enhanced tumor selectivity and inhibition and uses thereof
US20200231681A1 (en) * 2017-05-30 2020-07-23 Chong Kun Dang Pharmaceutical Corp. A novel anti-c-met antibody and use thereof

Non-Patent Citations (18)

* Cited by examiner, † Cited by third party
Title
"Greene's Protecting Groups in Organic Synthesis", 2007, JOHN WILEY & SONS, pages: 696 - 871
"UniProt", Database accession no. P08581-3
BRINKMANNKONTERMANN, MABS, vol. 9, no. 2, 2017, pages 182 - 212
CHALOUNIDOLL, J EXP CLIN CANCER RES., vol. 37, no. 1, 2018, pages 20
DUBOWCHIK ET AL., BIOCONJUGATE CHEMISTRY, vol. 13, 2002, pages 855 - 869
FERGUSON, ANNU REV BIOPHYS, vol. 37, 2008, pages 353 - 373
GEBLEUXCASI, PHARMACOL THER, vol. 167, 2016, pages 48 - 59
GRAZIANOGUPTILL, METHODS MOL BIOL, vol. 283, 2004, pages 71 - 85
H ZOLA: "Monoclonal Antibodies: A manual of techniques", 1988, CRC PRESS
HOLLIGERHUDSON, NATURE BIOTECHNOLOGY, vol. 23, no. 9, 2005, pages 1126 - 1136
J G R HURRELL: "Monoclonal Hybridoma Antibodies: Techniques and Applications", 1982, CRC PRESS
J M LEE ET AL: "Novel strategy for a bispecific antibody: induction of dual target internalization and degradation", ONCOGENE, vol. 35, no. 34, 8 February 2016 (2016-02-08), London, pages 4437 - 4446, XP055393414, ISSN: 0950-9232, DOI: 10.1038/onc.2015.514 *
KONTERMANN, MABS, vol. 4, no. 2, 2012, pages 182 - 197
MARCEL RIEKER: "Targeted Combination Therapy: Discovery and Evaluation of Synergistic Anticancer Effects of Anti-HER2- Duocarmycin Antibody-Drug Conjugates Combined with", 1 January 2018 (2018-01-01), XP055661439, Retrieved from the Internet <URL:https://tuprints.ulb.tu-darmstadt.de/8615/7/2019-06-13_PhD_thesis_Rieker.pdf> [retrieved on 20200123] *
R CASTOLDI ET AL: "A novel bispecific EGFR/Met antibody blocks tumor-promoting phenotypic effects induced by resistance to EGFR inhibition and has potent antitumor activity", ONCOGENE, vol. 32, no. 50, 1 July 2013 (2013-07-01), pages 5593 - 5601, XP055129019, ISSN: 0950-9232, DOI: 10.1038/onc.2013.245 *
SAMBROOK, J.RUSSEL, D.W.: "Molecular Cloning, A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS
SELLMANN CAROLIN ET AL: "Balancing Selectivity and Efficacy of Bispecific Epidermal Growth Factor Receptor (EGFR) × c-MET Antibodies and Antibody-Drug Conjugates", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 291, no. 48, 1 November 2016 (2016-11-01), US, pages 25106 - 25119, XP055837565, ISSN: 0021-9258, Retrieved from the Internet <URL:https://www.sciencedirect.com/science/article/pii/S0021925820345920/pdfft?md5=3de7ac44dea149cac9d31234a072b347&pid=1-s2.0-S0021925820345920-main.pdf> DOI: 10.1074/jbc.M116.753491 *
STEPHEN W. JARANTOW ET AL: "Impact of Cell-surface Antigen Expression on Target Engagement and Function of an Epidermal Growth Factor Receptor x c-MET Bispecific Antibody", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 290, no. 41, 10 August 2015 (2015-08-10), US, pages 24689 - 24704, XP055273157, ISSN: 0021-9258, DOI: 10.1074/jbc.M115.651653 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024002938A1 (en) * 2022-06-27 2024-01-04 Astrazeneca Ab Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer
WO2025106278A1 (en) 2023-11-17 2025-05-22 Mersana Therapeutics, Inc. Treatment of cancer using b7-h4-targeted antibody-drug conjugates
WO2025108427A1 (zh) * 2023-11-23 2025-05-30 橙帆生物医药公司 结合分子及抗体药物偶联物和用途
WO2025230410A1 (en) * 2024-04-30 2025-11-06 Merus N.V. Multispecific antibody-drug conjugates
WO2025230409A1 (en) * 2024-04-30 2025-11-06 Merus N.V. Multispecific antibody-drug conjugates

Also Published As

Publication number Publication date
US20240360226A1 (en) 2024-10-31
AU2022384597A1 (en) 2024-06-13
CA3237211A1 (en) 2023-05-19
EP4429765A1 (en) 2024-09-18
AR127629A1 (es) 2024-02-14
CN118556084A (zh) 2024-08-27
US12065496B2 (en) 2024-08-20
KR20240099430A (ko) 2024-06-28
JP2024544520A (ja) 2024-12-03
ECSP24044371A (es) 2024-07-31
MX2024005712A (es) 2024-05-24
CO2024007192A2 (es) 2024-07-18
US20230183358A1 (en) 2023-06-15
IL312566A (en) 2024-07-01
TW202336037A (zh) 2023-09-16
CL2024001384A1 (es) 2024-08-23

Similar Documents

Publication Publication Date Title
US12065496B2 (en) Antibody molecules and conjugates
JP7118117B2 (ja) 抗体-薬物コンジュゲートの選択的製造方法
ES2889398T3 (es) Anticuerpos anti-5T4 y conjugados de anticuerpo-fármaco
JP7854431B2 (ja) 抗体薬物複合体を含む医薬組成物及びその使用
JPWO2015098099A1 (ja) 抗trop2抗体−薬物コンジュゲート
AU2016363373A1 (en) Site specific HER2 antibody drug conjugates
CN109496149B (zh) 抗体及其药物缀合物的制剂
EP4594345A1 (en) Protease-activated polypeptides
JP2021521872A (ja) C−metに特異的に結合する抗体及びその用途
AU2023278315A1 (en) Pharmaceutical composition of recombinant anti-human cldn18.2 monoclonal antibody-mmae conjugate
AU2022384597B2 (en) Antibody molecules and conjugates
EP4543920A1 (en) Combinations involving epidermal growth factor receptor tyrosine kinase inhibitors for the treatment of cancer
WO2025242845A1 (en) Colorectal cancer treatment
HK40086745A (en) Method for selectively manufacturing antibody-drug conjugate

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22817545

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 12024551011

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 3237211

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2024527384

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2401003010

Country of ref document: TH

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112024009109

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2022384597

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 11202402884R

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 1020247018705

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: NC2024/0007192

Country of ref document: CO

WWE Wipo information: entry into national phase

Ref document number: 202417044643

Country of ref document: IN

Ref document number: 2022817545

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022384597

Country of ref document: AU

Date of ref document: 20221109

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022817545

Country of ref document: EP

Effective date: 20240610

WWE Wipo information: entry into national phase

Ref document number: 202280086269.9

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: NC2024/0007192

Country of ref document: CO

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112024009109

Country of ref document: BR

Free format text: EXPLIQUE A DIVERGENCIA, COM DOCUMENTOS COMPROBATORIOS SE NECESSARIO, NO INVENTOR CONSTANTE NO PEDIDO INTERNACIONAL COMO ANDREW GRIER BUCHANAN E O CONSTANTE NO FORMULARIO DA PETICAO INICIAL COMO ANDREW BUCHANAN. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207.

ENP Entry into the national phase

Ref document number: 112024009109

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20240508