WO2023053282A1 - がんの治療に用いるための細胞傷害誘導治療剤 - Google Patents
がんの治療に用いるための細胞傷害誘導治療剤 Download PDFInfo
- Publication number
- WO2023053282A1 WO2023053282A1 PCT/JP2021/035917 JP2021035917W WO2023053282A1 WO 2023053282 A1 WO2023053282 A1 WO 2023053282A1 JP 2021035917 W JP2021035917 W JP 2021035917W WO 2023053282 A1 WO2023053282 A1 WO 2023053282A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- cdr
- variable region
- antigen
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/495—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
- A61K31/50—Pyridazines; Hydrogenated pyridazines
- A61K31/502—Pyridazines; Hydrogenated pyridazines ortho- or peri-condensed with carbocyclic ring systems, e.g. cinnoline, phthalazine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/555—Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2299/00—Coordinates from 3D structures of peptides, e.g. proteins or enzymes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/54—F(ab')2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure relates to anticancer agents comprising multispecific antigen-binding molecules that target claudin 6, and combination therapy with at least one other anticancer agent.
- the claudin family is a family of cell membrane proteins with a molecular weight of approximately 23 kD that have four transmembrane domains and constitute tight junctions.
- the claudin family includes 24 members in humans and mice, and each member of the claudin family is known to exhibit a very unique expression pattern depending on each epithelial cell type (Non-Patent Documents 1- Non-Patent Document 4).
- a mechanism acts to prevent the leakage (diffusion) of substances into the intercellular spaces, and intercellular adhesion systems called tight junctions are central as "barriers" in this mechanism of preventing leakage. It has been shown to actually do the job.
- Non-Patent Documents 7 to 9 The tight-junction molecule claudin-6 (CLDN6), a member of the claudin family of proteins, is not transcriptionally expressed in normal biological tissues [5 and 6], but it is found in ovarian cancer, NSCLC. , and multiple types of cancer such as gastric cancer show increased expression (Non-Patent Documents 7 to 9).
- anti-CLDN6 antibodies monospecific antibodies against CLDN6 have been reported to have ADCC activity or internalization activity against CLDN6-positive cancer cell lines (Patent Documents 1 to 5). So far, a CLDN6-targeting T cell-redirecting bispecific antibody, named 6PHU3, was generated using a bispecific sc(Fv) 2 format with anti-CD3/anti-CLDN6 specificity. (Patent Documents 6 to 7). In preclinical evaluations, 6PHU3 has been reported to exhibit potent killing of cancer cells in vitro and in vivo (Non-Patent Document 10).
- the purpose of the present disclosure is to provide a method for efficiently and specifically recruiting T cells to target cancer cells, particularly CLDN6-expressing cells such as cancer cells, and to provide T cells to target cancer tissues containing CLDN6-expressing cells.
- An object of the present invention is to provide an anticancer agent containing a multispecific antigen-binding molecule as an active ingredient, which can treat cancer through cell cytotoxic activity.
- Another object of the present invention is to provide combination therapy using the multispecific antigen-binding molecule and other drugs.
- CD3 and CD137 (4-1BB) and that it binds either CD3 or CD137 (i.e. dual binding to CD3 and CD137 but simultaneously binding multispecific, comprising a first antigen-binding portion and a second antigen-binding portion capable of binding to a molecule specifically expressed in cancer tissue, particularly Claudin 6 (CLDN6)
- CLDN6 Claudin 6
- the present invention provides an anticancer agent comprising the multispecific antigen-binding molecule as an active ingredient, a combination therapy using the multispecific antigen-binding molecule and at least one other anticancer agent, and a multispecific antigen
- an anticancer agent comprising the multispecific antigen-binding molecule as an active ingredient, a combination therapy using the multispecific antigen-binding molecule and at least one other anticancer agent, and a multispecific antigen
- a pharmaceutical composition is provided that combines a binding molecule and an anti-cancer agent.
- an anticancer agent comprising the following multispecific antigen-binding molecule as an active ingredient: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- An anticancer agent comprising, as an active ingredient, the multispecific antigen-binding molecule according to any one of (1) to (6) below: (1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 11, CDR 2 of SEQ ID NO: 17, and CDR 3 of SEQ ID NO: 23; CDR 1 of SEQ ID NO: 32; , CDR 2 of SEQ ID NO: 36, and CDR 3 of SEQ ID NO: 40; complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and a third antibody variable region comprising CDR 3 of SEQ ID NO: 19; and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 29, CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37 a multispecific antigen binding molecule comprising a region; (2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 9, C
- a multispecific antigen binding molecule comprising a region; (3) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 10, CDR 2 of SEQ ID NO: 16, and CDR 3 of SEQ ID NO: 22; CDR 1 of SEQ ID NO: 31; , CDR 2 of SEQ ID NO: 35, and CDR 3 of SEQ ID NO: 39; complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and a third antibody variable region comprising CDR 3 of SEQ ID NO: 20; and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 30, CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38.
- CDR complementarity determining region
- a multispecific antigen binding molecule comprising a region; (4) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 12, CDR 2 of SEQ ID NO: 18, and CDR 3 of SEQ ID NO: 24; CDR 1 of SEQ ID NO: 32; , CDR 2 of SEQ ID NO: 36, and CDR 3 of SEQ ID NO: 40; complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and a third antibody variable region comprising CDR 3 of SEQ ID NO: 19; and a fourth antibody variable region comprising CDR 1 of SEQ ID NO: 29, CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37 a multispecific antigen binding molecule comprising a region; (5) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 11, CDR 2 of SEQ ID NO: 17, and CDR 3 of SEQ ID NO: 23
- (A-3) at least one selected from the group consisting of the first antibody variable region, the second antibody variable region, the third antibody variable region, and the fourth antibody variable region is a human antibody frame;
- An anticancer agent comprising, as an active ingredient, the multispecific antigen-binding molecule according to any one of (I) to (VI) below: (I) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:5; a second antibody variable region comprising the amino acid sequence of SEQ ID NO:28; a third antibody variable region comprising the amino acid sequence of SEQ ID NO:1 and a multispecific antigen binding molecule comprising a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:25; (II) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:3; a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; a third antibody variable region comprising the amino acid sequence of SEQ ID NO:2 and a multispecific antigen binding molecule comprising a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:26; (III) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:4; a
- the first antibody variable region and the second antibody variable region are capable of binding to CD3 and CD137 and constitute a first antigen-binding portion that binds to either CD3 or CD137 any of (A-2) to (A-4), wherein the third antibody variable region and the fourth antibody variable region constitute a second antigen-binding portion capable of binding to CLDN6 or one anticancer drug.
- the first antibody variable region and the second antibody variable region constitute a first antigen-binding portion that binds to CD3, and the third antibody variable region and the fourth antibody; The anticancer agent of any one of (A-2) to (A-4), wherein the variable region constitutes a second antigen-binding portion capable of binding to CLDN6.
- the first antibody variable region and the second antibody variable region constitute a first antigen-binding portion that binds to CD137, and the third antibody variable region and the fourth antibody;
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD3; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The first antigen-binding portion is (a1)-(a4): (a1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 9, CDR 2 of SEQ ID NO: 15, and CDR 3 of SEQ ID NO: 21, and CDR of SEQ ID NO: 31 1, a second antibody variable region comprising CDR 2 of SEQ ID NO: 35, and CDR 3 of SEQ ID NO: 39; (a2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 10, CDR 2 of SEQ ID NO: 16, and CDR 3 of SEQ ID NO: 22, and CDR of SEQ ID NO: 31 1, a second antibody variable region comprising CDR
- the second antigen-binding portion comprises the following (b1) to (b3): (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20, and CDR of SEQ ID NO: 30 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and CDR 3 of SEQ ID NO: 19, and CDR of SEQ ID NO: 29 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37; (b3) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 29, CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD3; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The second antigen-binding portion is (b1)-(b3): (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20, and CDR of SEQ ID NO: 30 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO:
- (A-11) at least one selected from the group consisting of the first antibody variable region, the second antibody variable region, the third antibody variable region, and the fourth antibody variable region is a human antibody frame;
- the anticancer agent of any one of (A-8) to (A-10) comprising a work or humanized antibody framework.
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD3; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The first antigen-binding portion comprises (c1)-(c4): (c1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:3 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; (c2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:4 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; (c3) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:5 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:28; (c4) an anticancer agent comprising any one of a first antibody variable region comprising the amino acid sequence of SEQ ID NO:6 and
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD3; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The second antigen-binding portion is (d1)-(d3): (d1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:2 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:26; (d2) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:1 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:25; (d3) an anticancer agent comprising any one of a third antibody variable region comprising the amino acid sequence of SEQ ID NO:25 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:1.
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD137; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The first antigen-binding portion is (a1)-(a4): (a1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 9, CDR 2 of SEQ ID NO: 15, and CDR 3 of SEQ ID NO: 21, and CDR of SEQ ID NO: 31 1, a second antibody variable region comprising CDR 2 of SEQ ID NO: 35, and CDR 3 of SEQ ID NO: 39; (a2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 10, CDR 2 of SEQ ID NO: 16, and CDR 3 of SEQ ID NO: 22, and CDR of SEQ ID NO: 31 1, a second antibody variable region comprising CDR
- the second antigen-binding portion comprises (b1) to (b3) as follows: (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20, and CDR of SEQ ID NO: 30 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and CDR 3 of SEQ ID NO: 19, and CDR of SEQ ID NO: 29 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37; (b3) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 29, CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD137; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The second antigen-binding portion is (b1)-(b3): (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20, and CDR of SEQ ID NO: 30 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and CDR 3 of SEQ ID NO: 19, and CDR of SEQ ID NO: 29 1, a fourth antibody variable region comprising CDR
- (A-18) at least one selected from the group consisting of the first antibody variable region, the second antibody variable region, the third antibody variable region, and the fourth antibody variable region is a human antibody frame;
- the anti-cancer agent of (A-15) to (A-17) comprising a work or humanized antibody framework.
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD137; and (ii) a second antigen-binding portion that binds to Claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The first antigen-binding portion comprises (c1)-(c4): (c1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:3 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; (c2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:4 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; (c3) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:5 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:28; (c4) an anticancer agent comprising any one of a first antibody variable region comprising the amino acid sequence of SEQ ID NO:6 and
- a multispecific antigen-binding molecule comprising (i) a first antigen-binding portion that binds to CD137; and (ii) a second antigen-binding portion that binds to claudin 6 (CLDN6) as an active ingredient
- An anticancer agent comprising as The second antigen-binding portion is (d1)-(d3): (d1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:2 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:26; (d2) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:1 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:25; (d3) an anticancer agent comprising any one of a third antibody variable region comprising the amino acid sequence of SEQ ID NO:25 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:1.
- the multispecific antigen-binding molecule further comprises (iii) an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to the native human IgG1 Fc domain, (A-1 ) to (A-27) any one anticancer agent.
- A-29 The anticancer agent of (A-28), wherein the Fc domain is composed of a first Fc region subunit and a second Fc region subunit.
- the Fc domain is the following (e1) or (e2): (e1) a first Fc region subunit containing Cys at position 349, Ser at position 366, Ala at position 368 and Val at position 407 and a second Fc containing Cys at position 354 and Trp at position 366 domain subunits; (e2) comprising a first Fc region subunit containing Glu at position 439 and a second Fc region subunit containing Lys at position 356, the amino acid positions being numbered by the EU index (A-29 ) anticancer agents.
- the first and/or second Fc region subunit is (f1) or (f2): (f1) Ala at position 234 and Ala at position 235; (f2) Ala at 234th, Ala at 235th and Ala at 297th wherein said amino acid positions are numbered according to the EU index. (A-32) any one of (A-29) to (A-31), wherein the Fc domain further exhibits stronger FcRn binding affinity for human FcRn as compared to native human IgG1 Fc domain; two anticancer agents.
- the first and/or second Fc region subunit comprises Leu at position 428, Ala at position 434, Arg at position 438, and Glu at position 440, wherein the amino acid positions are The anticancer agent of (A-32), numbered by.
- the constant region has the following (g1) to (g7): (g1) a first heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 74, a first light chain constant region comprising the amino acid sequence of SEQ ID NO: 87, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 73 a chain constant region and a second light chain constant region comprising the amino acid sequence of SEQ ID NO:88; (g2) a first heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 74, a first light chain constant region comprising the amino acid sequence of SEQ ID NO: 85, a second heavy chain compris
- An anticancer agent comprising, as an active ingredient, a multispecific antigen-binding molecule comprising a combination of four polypeptide chains that is any one of (A-36)
- the antibody variable region comprised in chain 3 and the antibody variable region comprised in chain 4 are capable of binding CD3 and CD137, binding either CD3 or CD137, forming an antigen-binding portion
- the antibody variable region contained in chain 1 and the antibody variable region contained in chain 2 form a second antigen binding portion capable of binding claudin 6 (CLDN6)
- CLDN6 claudin 6
- the antibody Fc region subunits contained in chain 1 and the antibody Fc region subunits contained in chain 3 form an Fc domain, (A-35) anticancer agent.
- (A-37) (i) the antibody variable region contained in chain 3 and the antibody variable region contained in chain 4 form a first antigen-binding portion that binds CD3; (ii) the antibody variable region contained in chain 1 and the antibody variable region contained in chain 2 are forming a second antigen binding moiety that binds claudin 6 (CLDN6); (iii) the antibody Fc region subunits contained in chain 1 and the antibody Fc region subunits contained in chain 3 form an Fc domain, (A-35) anticancer agent.
- CLDN6 claudin 6
- (A-38) (i) the antibody variable region comprised in chain 3 and the antibody variable region comprised in chain 4 form a first antigen-binding portion that binds CD137; (ii) the antibody variable region contained in chain 1 and the antibody variable region contained in chain 2 form a second antigen binding portion that binds claudin 6 (CLDN6); (iii) the antibody Fc region subunits contained in chain 1 and the antibody Fc region subunits contained in chain 3 form an Fc domain, (A-35) anticancer agent.
- A-39 Multiplex binding to an epitope that overlaps and/or competes with the epitope on CLDN6 and CD3/CD137 to which any of the multispecific antigen-binding molecules of (A-5) to (A-7) binds, respectively
- An anticancer agent comprising a specific antigen-binding molecule as an active ingredient.
- A-40 The anticancer agent according to any one of (A-1) to (A-39), wherein the target cancer is CLDN6-positive cancer.
- Target cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical malformation
- A-42) The anticancer agent of any one of (A-1) to (A-41), wherein the target cancer is cancer that has metastasized to the peritoneum.
- A-43 The anticancer agent according to any one of (A-1) to (A-42), wherein the target cancer is peritoneal disseminated cancer.
- (A-44) Any one of (A-1) to (A-43) anticancer agents for treating patients with cancer refractory to treatment with other anticancer agents .
- (A-45) The anticancer agent of any one of (A-40) to (A-44), wherein the CLDN6-positive cancer has been treated with other anticancer agents.
- (A-47) The anticancer agent of any one of (A-1) to (A-46), further comprising a pharmaceutically acceptable carrier.
- A-48 The anticancer agent according to any one of (A-1) to (A-47), wherein the multispecific antigen-binding molecule induces cytotoxicity.
- A-49 The anticancer agent of (A-48), wherein the cytotoxicity is T cell-dependent cytotoxicity.
- (B-1) A pharmaceutical composition for use in combination with at least one other anticancer agent, comprising the following multispecific antigen-binding molecules as active ingredients: (i) a first antigen binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137; and (ii) a second antigen binding capable of binding claudin 6 (CLDN6). Multispecific antigen binding molecules, including moieties.
- (B-2) A pharmaceutical composition comprising the multispecific antigen-binding molecule according to any one of (A-2) to (A-39) as an active ingredient, for use in combination with at least one other anticancer agent thing.
- (B-3) The pharmaceutical composition of (B-1) or (B-2), wherein the target cancer is CLDN6-positive cancer.
- Target cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical malformation
- (B-5) The pharmaceutical composition according to any one of (B-1) to (B-4), wherein the target cancer is cancer that has metastasized to the peritoneum.
- (B-6) The pharmaceutical composition according to any one of (B-1) to (B-5), wherein the target cancer is peritoneal disseminated cancer
- B-7) The pharmaceutical composition of any one of (B-1) to (B-6) for treating patients with cancer refractory to treatment with other anticancer agents.
- B-8) The pharmaceutical composition of any one of (B-1) to (B-7), wherein the target cancer is a cancer that has been treated with other anticancer agents.
- (B-9) Any of (B-1) to (B-8), in which the target cancer is a cancer for which the desired effect has not been obtained in response to treatment by administration of other anticancer drugs alone or one anticancer drug.
- the multispecific antigen-binding molecule is administered before, simultaneously with, and/or after administration of the at least one other anticancer agent, (B-1 ) to (B-10).
- the multispecific antigen-binding molecule is administered to a cancer in which CLDN6 expression is increased by administration of the at least one other anticancer agent (B-1)
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (B-1) to ( The pharmaceutical composition of any one of B-13).
- (B-16) The pharmaceutical composition of (B-14) or (B-15), wherein the at least one other anticancer agent is a platinum agent.
- (B-17) The pharmaceutical composition of (B-16), wherein the platinum drug is carboplatin or cisplatin
- (B-18) The pharmaceutical composition of (B-14), wherein the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- (B-19) The pharmaceutical composition of (B-14), wherein the PARP inhibitor is olaparib.
- a cytotoxicity-inducing agent, a cell growth inhibitor, a cell growth inhibitor, an immune response activator, cancer comprising the pharmaceutical composition of any one of (B-1) to (B-19) A therapeutic agent or a cancer preventive agent.
- the disclosure provides: (C-1) (i) a first antigen-binding portion capable of binding CD3 and CD137 and capable of binding either CD3 or CD137, and (ii) claudin 6 (CLDN6).
- Effective multispecific antigen-binding molecule comprising a second antigen-binding portion and having higher cytotoxic activity than when the first antigen-binding portion is an antigen-binding portion capable of binding only to CD3
- An anticancer agent including as an ingredient.
- (C-2) (i) a first antigen-binding moiety capable of binding CD3 and CD137 and capable of binding either CD3 or CD137, and (ii) claudin 6 (CLDN6).
- a multispecific antigen-binding molecule comprising a second antigen-binding portion and having low toxicity compared to the case where the first antigen-binding portion is an antigen-binding portion capable of binding only to CD3 as an active ingredient including, anticancer agents.
- C-3) Multispecificity comprising (1) a first antigen-binding domain capable of binding to a T-cell receptor complex and (2) a second antigen-binding portion capable of binding to CLDN6
- An antigen-binding portion of an antigen-binding molecule capable of binding to a T-cell receptor complex comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 194 and a light chain comprising the amino acid sequence of SEQ ID NO: 192 and SEQ ID NO: compared to a multispecific antibody (CS3348) comprising an antigen-binding portion capable of binding to CLDN6 comprising a heavy chain containing the amino acid sequence of SEQ ID NO:193 and a light chain containing the amino acid sequence of SEQ ID NO:195.
- An anticancer agent comprising, as an active ingredient, a multispecific antigen-binding molecule with equivalent or higher activity.
- the multispecific antigen-binding molecule further comprises (3) an Fc domain that exhibits reduced binding affinity to human Fc ⁇ receptors compared to the native human IgG1 Fc domain, (C-1 ) to (C-3) any one anticancer agent.
- C-5) (C-1), (C-3) or ( C-4) anticancer agent comprising, as an active ingredient, a multispecific antigen-binding molecule with equivalent or higher activity.
- the first antigen-binding portion comprises a combination of antibody variable regions selected from (a1) or (a2) below, or a combination of functionally equivalent antibody variable regions, (C -1) Any one anticancer drug of ⁇ (C-5): (a1) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 11, CDR 2 of SEQ ID NO: 17, and CDR 3 of SEQ ID NO: 23; and CDR of SEQ ID NO: 32 1, a second antibody variable region comprising CDR 2 of SEQ ID NO: 36, and CDR 3 of SEQ ID NO: 40; (a2) a first antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 10, CDR 2 of SEQ ID NO: 16, and CDR 3 of SEQ ID NO: 22; and CDR of SEQ ID NO: 31 1, a second antibody variable region comprising CDR 2 of SEQ ID NO:35, and CDR 3 of SEQ ID NO:39.
- CDR complementarity determining region
- the second antigen-binding portion comprises a combination of antibody variable regions selected from (b1) or (b2) below, or a combination of functionally equivalent antibody variable regions, (C- 1) Any one anticancer drug of ⁇ (C-6): (b1) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and CDR 3 of SEQ ID NO: 19; and CDR of SEQ ID NO: 29 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37; (b2) a third antibody variable region comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20; and CDR of SEQ ID NO: 30 1, a fourth antibody variable region comprising CDR 2 of SEQ ID NO:34, and CDR 3 of SEQ ID NO:38.
- CDR complementarity determining region
- the first antigen-binding portion comprises a combination of antibody variable regions selected from (c1) or (c2) below, or a combination of functionally equivalent antibody variable regions, (C Any one of -1) to (C-7) anticancer agents: (c1) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:5 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:28; (c2) a first antibody variable region comprising the amino acid sequence of SEQ ID NO:4 and a second antibody variable region comprising the amino acid sequence of SEQ ID NO:27; (C-9)
- the second antigen-binding portion comprises a combination of antibody variable regions selected from (d1) or (d2) below, or a combination of functionally equivalent antibody variable regions, (C -1) Any one anticancer drug of ⁇ (C-8): (d1) a third antibody variable region comprising the amino acid sequence of SEQ ID NO:1 and a fourth antibody variable region comprising the amino acid sequence of SEQ ID NO:25; (d2)
- the Fc domain is the following (e1) or (e2): (e1) a first Fc region subunit containing Cys at position 349, Ser at position 366, Ala at position 368, and Val at position 407, and a second Fc containing Cys at position 354 and Trp at position 366 domain subunits; (e2) comprising a first Fc region subunit containing Glu at position 439 and a second Fc region subunit containing Lys at position 356, the amino acid positions being numbered by the EU index (C-4 ) to (C-10) any one anticancer agent.
- the first and/or second Fc region subunit is (f1) or (f2): (f1) Ala at position 234 and Ala at position 235; (f2) Ala at 234th, Ala at 235th and Ala at 297th and wherein said amino acid positions are numbered according to the EU index.
- C-13 any one of (C-4) to (C-12), wherein the Fc domain further exhibits stronger FcRn binding affinity for human FcRn as compared to native human IgG1 Fc domain; two anticancer agents.
- (D-1) A pharmaceutical composition comprising at least one other anticancer agent as an active ingredient, wherein (i) a first agent capable of binding to CD3 and CD137, and binding to either CD3 or CD137; and (ii) a multispecific antigen-binding molecule comprising a second antigen-binding portion capable of binding claudin 6 (CLDN6).
- (D-2) The pharmaceutical composition of (D-1), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- (D-3) The pharmaceutical composition of any one of (D-1) or (D-2), wherein the target cancer is CLDN6-positive cancer.
- Target cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical malformation
- (D-5) The pharmaceutical composition of any one of (D-1) to (D-4), wherein the target cancer is cancer that has metastasized to the peritoneum.
- D-6) The pharmaceutical composition according to any one of (D-1) to (D-5), wherein the target cancer is peritoneal disseminated cancer.
- (D-7) The pharmaceutical composition of any one of (D-1) to (D-6) for treating patients with cancer refractory to treatment with other anticancer agents.
- (D-8) The pharmaceutical composition of any one of (D-1) to (D-7), wherein the target cancer is a cancer that has been treated with other anticancer agents.
- (D-9) Any of (D-1) to (D-8) where the target cancer is a cancer for which the desired effect has not been obtained in response to treatment with other anticancer drugs alone or one anticancer drug.
- D-10) (D-1) to (D- The pharmaceutical composition of any one of 9).
- the at least one other anticancer agent is administered before, simultaneously with, and/or after the multispecific antigen-binding molecule (D-1)-( D-10) any one pharmaceutical composition.
- D-12 any one pharmaceutical agent of (D-1) to (D-11), wherein administration of the multispecific antigen-binding molecule enhances the antitumor effect of the at least one other anticancer agent; Composition.
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (D-1)-( D-12) Any one pharmaceutical composition.
- (D-14) The pharmaceutical composition of any one of (D-1) to (D-13), wherein the at least one other anticancer agent is an agent that enhances expression of CLDN6 in cancer cells. .
- (D-15) The pharmaceutical composition of (D-13) or (D-14), wherein the at least one other anticancer agent is a platinum agent.
- (D-16) The pharmaceutical composition of (D-15), wherein the platinum agent is carboplatin or cisplatin.
- (D-17) The pharmaceutical composition of (D-13), wherein the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- (D-18) The pharmaceutical composition of (D-13), wherein the PARP inhibitor is olaparib.
- a cytotoxicity-inducing agent, a cell growth inhibitor, a cell growth inhibitor, an immune response activator, cancer comprising the pharmaceutical composition of any one of (D-1) to (D-18) A therapeutic agent or a cancer preventive agent.
- (E-1) A pharmaceutical composition for treating or preventing cancer, comprising a combination of the following multispecific antigen-binding molecules and at least one other anticancer agent: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) A multispecific antigen binding molecule comprising moieties.
- E-2) The pharmaceutical composition of (E-1), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- (E-3) The pharmaceutical composition of any one of (E-1) or (E-2), wherein the cancer is CLDN6-positive cancer.
- the cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical teratoid
- (E-5) The pharmaceutical composition according to any one of (E-1) to (E-4), wherein the cancer is cancer that has metastasized to the peritoneum.
- E-6) The pharmaceutical composition according to any one of (E-1) to (E-5), wherein the cancer is peritoneal cancer.
- (E-7) The pharmaceutical composition of any one of (E-1) to (E-6) for treating patients with cancer refractory to treatment with other anticancer agents.
- (E-8) The pharmaceutical composition according to any one of (E-1) to (E-7), wherein the cancer has been treated with other anticancer agents.
- (E-9) Any one of (E-1) to (E-8), wherein the cancer is a cancer for which the desired effect has not been obtained in response to treatment by administration of other anticancer drugs alone. two anticancer agents.
- (E-10) any one pharmaceutical agent of (E-1) to (E-9), which enhances the antitumor effect of the multispecific antigen-binding molecule by administration of the at least one other anticancer agent; Composition.
- the multispecific antigen-binding molecule is administered before, simultaneously with, and/or after administration of the at least one other anticancer agent (E-13) pharmaceutical composition of (E-15)
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (E-1)-( E-14) any one pharmaceutical composition.
- E-16 The pharmaceutical composition of any one of (E-1) to (E-15), wherein the at least one other anticancer agent is an agent that enhances expression of CLDN6 in cancer cells. .
- E-17 The pharmaceutical composition of (E-15) or (E-16), wherein the at least one other anticancer agent is a platinum agent.
- E-18 The pharmaceutical composition of (E-17), wherein the platinum agent is carboplatin or cisplatin.
- E-19 The pharmaceutical composition of (E-15), wherein the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- E-20 The pharmaceutical composition of (E-15), wherein the PARP inhibitor is olaparib.
- E-21 A cytotoxicity-inducing agent, a cell growth inhibitor, a cell growth inhibitor, an immune response activator, cancer, comprising the pharmaceutical composition of any one of (E-1) to (E-20) A therapeutic agent or a cancer preventive agent.
- (F-1) Combination of the following multispecific antigen-binding molecules with at least one other anticancer agent: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- (F-2) The combination of (F-1), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- (F-3) A combination of (F-1) or (F-2), wherein the target cancer is CLDN6-positive cancer.
- Target cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical malformation Any one combination of (F-1) to (F-3), which is any cancer selected from the group consisting of tumorous rhabdoid tumor.
- F-5) A combination of any one of (F-1) to (F-4), wherein the target cancer is cancer that has metastasized to the peritoneum.
- F-6) A combination of any one of (F-1) to (F-5) in which the target cancer is peritoneal disseminated cancer.
- (F-7) The pharmaceutical composition of any one of (F-1) to (F-6) for treating patients with cancer refractory to treatment with other anticancer agents.
- (F-8) The pharmaceutical composition of any one of (F-1) to (F-7), wherein the target cancer is a cancer that has been treated with other anticancer agents.
- (F-9) Any of (F-1) to (F-8) where the target cancer is a cancer for which the desired effect has not been obtained in response to treatment with other anticancer drugs alone or one pharmaceutical composition.
- (F-10) the pharmaceutical composition of any one of (F-1) to (F-9), wherein the at least one other anticancer agent enhances the antitumor effect of the multispecific antigen-binding molecule; .
- (F-11) the pharmaceutical composition of any one of (F-1) to (F-9), wherein the multispecific antigen-binding molecule enhances the antitumor effect of the at least one other anticancer agent; .
- (F-12) (F-1) to (F), wherein the multispecific antigen-binding molecule and the at least one other anticancer agent are administered separately or sequentially; -11) any one combination.
- (F-13) (F-1) to (F), wherein the multispecific antigen-binding molecule is administered before, simultaneously with, and/or after the at least one other anticancer agent -12) any one combination.
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (F-1)-( Any one combination of F-13).
- F-15 The combination of any one of (F-1) to (F-14), wherein the at least one other anticancer agent is an agent that enhances CLDN6 expression in cancer cells.
- F-16 The combination of (F-14) or (F-15), wherein said at least one other anticancer agent is a platinum agent.
- F-17 The combination of (F-16), wherein said platinum agent is carboplatin or cisplatin.
- (F-18) The combination of (F-14), wherein said immune checkpoint inhibitor is an anti-PD-L1 antibody.
- (F-19) The combination of (F-14), wherein the PARP inhibitor is olaparib.
- (F-20) Cytotoxicity-inducing agents, cell growth inhibitors, cell growth inhibitors, immune response activators, cancer therapeutic agents containing any one combination of (F-1) to (F-19) , or a cancer preventive.
- (G-1) Inducing cytotoxicity or suppressing cell proliferation in an individual, comprising administering an effective amount of the following multispecific antigen-binding molecules and an effective amount of at least one other anticancer agent to, inhibit cell proliferation, activate an immune response, treat cancer, or prevent cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- a first antigen-binding portion capable of binding CD3 and CD137 which binds either CD3 or CD137
- CLDN6 Claudin 6
- (G-2) A cell that induces cytotoxicity in an individual in combination with the following multispecific antigen-binding molecule, comprising administering an effective amount of at least one other anticancer agent to the individual: Methods of suppressing proliferation, inhibiting cell proliferation, activating an immune response, treating cancer, or preventing cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- Methods of suppressing proliferation, inhibiting cell proliferation, activating an immune response, treating cancer, or preventing cancer (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- (G-3) Induction of cytotoxicity, cell growth suppression, and cell proliferation in an individual by the following multispecific antigen-binding molecules, including administration of an effective amount of at least one other anticancer agent to the individual
- Methods of enhancing the effects of inhibition, immune response activation, cancer treatment, or cancer prevention (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- (G-4) Induction of cytotoxicity, suppression of cell growth, and cell proliferation in an individual by at least one other anticancer agent, including administration of an effective amount of the following multispecific antigen-binding molecules to the individual
- the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39), (G-1) to (G-4) ).
- G-6) The method of any one of (G-1) to (G-5), wherein the cancer is CLDN6-positive cancer.
- G-7) the cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical teratoid
- (G-8) The method according to any one of (G-1) to (G-7), wherein the cancer is cancer that has metastasized to the peritoneum.
- (G-9) The method of any one of (G-1) to (G-8), wherein the cancer is peritoneal cancer.
- the multispecific antigen-binding molecule and the at least one other anticancer agent are administered separately or sequentially (G-1) to (G- 9) any one method.
- (G-11) The multispecific antigen-binding molecule is administered before, simultaneously with, and/or after the administration of the at least one other anticancer agent (G-1 ) to (G-10).
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (G-1) to ( Any one method of G-11).
- G-13 The method according to any one of (G-1) to (G-12), wherein the at least one other anticancer agent is an agent that enhances CLDN6 expression in cancer cells.
- G-14 The method of (G-12) or (G-13), wherein the at least one other anticancer agent is a platinum agent.
- G-15 The method of (G-14), wherein the platinum agent is carboplatin or cisplatin.
- the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- G-17 The method of (G-12), wherein the PARP inhibitor is olaparib.
- (H-1) Contacting cancer cells with the following multispecific antigen-binding molecules and at least one other anticancer agent to cause injury to cancer cells or tumor tissue containing cancer cells
- Methods or methods of inhibiting the growth of cancer cells or tumor tissue containing cancer cells (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- the multispecific antigen-binding molecule and at least one other anticancer agent By contacting cancer cells with the following multispecific antigen-binding molecule and at least one other anticancer agent, the multispecific antigen-binding molecule and at least one other A method for confirming whether an anticancer agent causes damage to cancer cells or tumor tissue containing cancer cells, or suppresses the growth of cancer cells or tumor tissue containing cancer cells: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- a first antigen-binding portion capable of binding CD3 and CD137 which binds either CD3 or CD137
- CLDN6 Claudin 6
- (H-4) The method according to any one of (H-1) to (H-3), wherein the cancer cells are CLDN6-positive cancer cells.
- the cancer cell is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical teratoma
- the cancer cell is at least one cancer selected from the group consisting of rhabdoid-like tumors.
- (H-6) The method according to any one of (H-1) to (H-5), wherein the cancer cells are peritoneally disseminated cancer cells.
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (H-1)-( Any one method of H-6).
- (H-8) The method according to any one of (H-1) to (H-7), wherein the at least one other anticancer agent is an agent that enhances expression of CLDN6 in cancer cells.
- H-9) The method of (H-7) or (H-8), wherein the at least one other anticancer agent is a platinum agent.
- (I-1) A first antigen-binding portion capable of binding to CD3 and CD137, which binds to either CD3 or CD137, and a second antigen having binding activity to Claudin 6 (CLDN6) a pharmaceutical composition comprising a multispecific antigen binding molecule comprising a binding moiety; (B) a container; and (C) instructions or a label indicating that the multispecific antigen binding molecule and at least one other anticancer agent are administered in combination to the individual to treat or prevent cancer in the individual; Kit including.
- Kit including. (I-3) The kit of (I-1) or (I-2), wherein the multispecific antigen-binding molecule or at least one other anticancer agent is filled in the container. .
- (I-4) A first antigen-binding portion capable of binding to CD3 and CD137, which binds to either CD3 or CD137, and a second antigen having binding activity to Claudin 6 (CLDN6) a pharmaceutical composition comprising a multispecific antigen binding molecule comprising a binding moiety; (B) a container; and (C) A kit containing at least one other anti-cancer agent. (I-5) The multispecific antigen-binding molecule and at least one other anticancer agent are packed in one container or in separate containers, I-4) kit.
- kits (I-6) (I-1) to (I-5), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39) ) any one kit.
- Target cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical malformation
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (I-1) to ( I-12) any one kit.
- the kit of (I-15) wherein the platinum agent is carboplatin or cisplatin.
- the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- the kit of (I-18) The kit of (I-17), wherein the PARP inhibitor is olaparib.
- (J-1) Multispecific antigen-binding molecules for use in treating cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) a second antigen-binding portion that has binding activity for Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- (J-2) The multispecific antigen-binding molecule of (J-1), which is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- (J-3) Multispecificity of any one of (J-1) or (J-2), characterized in that it is used for cancer treatment in combination with at least one other anticancer agent antigen binding molecule.
- (J-4) Combinations of the following multispecific antigen-binding molecules with at least one other anticancer agent for use in treating cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) a second antigen-binding portion that has binding activity for Claudin 6 (CLDN6) A multispecific antigen binding molecule comprising moieties. (J-5) The combination of (J-4), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- J-6 J-3) to (J), wherein the multispecific antigen-binding molecule and the at least one other anticancer agent are administered separately or sequentially; -5) any one multispecific antigen-binding molecule or combination.
- J--7 The multiplex of (J-6), wherein the multispecific antigen-binding molecule is administered before, simultaneously with, and/or after the at least one other anticancer agent. Specific antigen binding molecule or combination.
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (J-3)-( J-7) any one multispecific antigen-binding molecule or combination.
- (J-9) The multispecificity of any one of (J-3) to (J-8), wherein the at least one other anticancer agent is an agent that enhances expression of CLDN6 in cancer cells.
- Antigen-binding molecule or combination. (J-10) The multispecific antigen-binding molecule or combination of (J-8) or (J-9), wherein said at least one other anticancer agent is a platinum agent.
- J-11) The multispecific antigen-binding molecule or combination of (J-10), wherein the platinum agent is carboplatin or cisplatin.
- (J-12) The multispecific antigen-binding molecule or combination of (J-8), wherein the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- (J-13) The multispecific antigen-binding molecule or combination of (J-8), wherein the PARP inhibitor is olaparib.
- (J-14) The multispecific antigen-binding molecule or combination of any one of (J-1) to (J-13), wherein the cancer is CLDN6-positive cancer.
- the cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical teratoid Any one multispecific antigen-binding molecule or combination of (J-1) to (J-14), which is any cancer selected from the group consisting of rhabdoid tumors.
- (J-16) The multispecific antigen-binding molecule or combination of any one of (J-1) to (J-15), wherein the cancer is cancer that has metastasized to the peritoneum.
- (J-17) The multispecific antigen-binding molecule or combination of any one of (J-1) to (J-16), wherein the cancer is peritoneal disseminated cancer.
- (J-18) Multispecific antigen binding of any one of (J-1) to (J-17) for treating patients with cancer refractory to treatment with immune checkpoint inhibitors molecule or combination.
- J-19) The multispecific antigen-binding molecule or combination of any one of (J-1) to (J-18), wherein the cancer has been treated with other anticancer agents.
- (J-20) Any one of (J-1) to (J-19), wherein the cancer is a cancer for which the desired effect has not been obtained in response to treatment with other anticancer drugs alone. one multispecific antigen binding molecule or combination.
- (K-1) Use of the following multispecific antigen binding in the manufacture of a medicament for treating cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) a second antigen-binding portion that has binding activity for Claudin 6 (CLDN6) Multispecific antigen binding molecules, including moieties.
- (K-2) The use of (K-1), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- (K-4) Use of a combination of the following multispecific antigen-binding molecules and at least one other anticancer agent in the manufacture of a medicament for treating cancer: (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) a second antigen-binding portion that has binding activity for Claudin 6 (CLDN6) A multispecific antigen binding molecule comprising moieties. (K-5) Use of (K-4), wherein the multispecific antigen-binding molecule is the multispecific antigen-binding molecule according to any one of (A-2) to (A-39).
- K-6 The use of (K-4) or (K-5), wherein the medicament is a combination drug of a multispecific antigen-binding molecule and at least one other anticancer drug.
- K-7) K-3) to (K- Use of any one of 5).
- K-8) The use of (K-7), wherein the multispecific antigen-binding molecule is administered before, simultaneously with, and/or after the at least one other anticancer agent. .
- the at least one other anticancer agent is at least one selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, and PARP inhibitors, (K-3)-( K-8).
- (K-10) The use of any one of (K-3) to (K-9), wherein the at least one other anticancer agent is an agent that enhances CLDN6 expression in cancer cells.
- (K-11) The use of (K-9) or (K-10), wherein said at least one other anticancer agent is a platinum agent.
- (K-12) The use of (K-11), wherein the platinum agent is carboplatin or cisplatin.
- (K-13) The use of (K-9), wherein the immune checkpoint inhibitor is an anti-PD-L1 antibody.
- K-14 The use of any one of (K-1) to (K-13), wherein the cancer is CLDN6-positive cancer.
- the cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, or atypical teratoid Use of any one of (K-1) to (K-14), which is any cancer selected from the group consisting of rhabdoid tumors.
- K-16 Use of any one of (K-1) to (K-15), wherein the cancer is cancer that has metastasized to the peritoneum.
- K-17 The use of any one of (K-1) to (K-16), wherein the cancer is peritoneal cancer.
- (K-18) Use of any one of (K-1) through (K-17) to treat a patient with a cancer that is refractory to treatment with an immune checkpoint inhibitor.
- (K-19) The use of any one of (K-1) to (K-18), wherein the cancer has been treated with other anticancer agents.
- (K-20) Any one of (K-1) to (K-19), wherein the cancer is a cancer for which the desired effect has not been obtained in response to treatment by single administration of other anticancer drugs one use.
- FIG. 1 is a graph comparing the expression of CLDN6 in various cancer tissues based on TCGA (The Cancer Genome Atlas) data. Epitopes of the H0868L0581 Fab contact region on CD137 are shown. Epitope mapping in the CD137 amino acid sequence (black: closer than 3.0 angstroms from H0868L0581, striped: closer than 4.5 angstroms). Epitopes of the H0868L0581 Fab contact region on CD137 are shown. Epitope mapping in the crystal structure (dark spheres: closer than 3.0 Angstroms from H0868L0581, light gray bars: closer than 4.5 Angstroms). Various antibody formats are illustrated. Annotations for each Fv region in Table 4 and naming conventions for Tables 4, 5 and 6.
- FIG. 1 Diagram illustrating (a) 1+1 bispecific antibody by utilizing FAST-Ig; (b) 1+1 bispecific antibody by utilizing CrossMab technology.
- Figure 2 shows the binding activity of anti-CLDN6/CD3 bispecific antibodies (CS2961 and 6PHU3/TR01) to human CLDN family proteins (CLDN3, CLDN4, CLDN6 and CLDN9).
- the binding activity of anti-CLDN6/CD3 bispecific antibodies to BaF3 transfectants hCLDN6/BaF, hCLDN3/BaF, hCLDN4/BaF, and hCLDN9/BaF was examined by flow cytometry at a concentration of 15 ⁇ g/ml and histograms were shown.
- Antibody (PPU4135) T cells against various cancer cell lines (NUGC-3, PA-1, SNG-M, NEC8, NEC14, CHLA-02-ATRT, HT-1197, and OUMS-23) by LDH assay
- Figure 2 shows the evaluation results of dependent cytotoxicity. Shown are the results of real-time cell growth inhibition assays of antibodies (CS3348, PPU4135, and PPU4136) against various cancer cell lines by xCELLigence assay.
- KLH/TR01 was used as a negative control.
- NF ⁇ B through CD137 binding by antibodies (CS3348, PPU4134, PPU4135, PPU4136, PPU4137, and PPU4138) in co-culture with CLDN6-expressing human cell lines (OVCAR3 and NCI-H1435) and CLDN6-negative cell line (5637) Indicates activation.
- KLH/TR01 was used as a negative control.
- FIG. 10 shows the survival rate after anti-CLDN6/Dual-Fab antibody administration in a mouse peritoneal dissemination model.
- Various cancer cells human ovarian cancer cell line (NIH-OVCAR3), human lung cancer cell line (NCI-H1435), and human endometrial cancer cell line (SNG-M)
- a chemotherapeutic agent cisplatin (CDDP)
- CDDP chemotherapeutic agent
- CBDCA carboplatin
- FIG. 10 shows the relative expression level of CLDN6 after carboplatin administration in SNG-M tumor-implanted mice, examined by real-time PCR using GAPDH as an internal control.
- FIG. 10 is a diagram showing changes in tumor volume due to .
- FIG. 4 is a diagram showing changes in tumor volume.
- FIG. 10 shows changes in tumor volume due to single-agent CS4135 antibody administration in hCD137 KI/hCD3Tg mice transplanted with lung cancer cell line LLC1 forcibly expressing claudin 6 (CLDN6).
- CS4135 antibody was administered to hCD137 KI/hCD3Tg mice transplanted with lung cancer cell line LLC1 forcibly expressing claudin 6 (CLDN6), and the number of CD8-positive T cells in the tumor tissue was analyzed by flow cytometry (FCM). It is a figure which shows. CS4135 antibody single-agent administration, anti-mouse PD-L1 antibody single-agent administration, and CS4135 antibody and anti-mouse PD-L1 in hCD137 KI/hCD3Tg mice transplanted with lung cancer cell line LLC1 overexpressing claudin 6 (CLDN6) FIG. 10 shows changes in tumor volume due to combined administration of antibodies.
- FIG. 10 is a diagram evaluated by a lactate dehydrogenase (LDH) release assay using PBMCs as effector cells.
- LDH lactate dehydrogenase
- FIG. 10 is a diagram showing analysis of the cytotoxic activity of the CS4135 antibody in the presence or absence of the KLH/CD137 bispecific antibody using a real-time cell growth inhibition assay (xCELLigence assay).
- Mouse colon cancer cell line MC38/CLDN6 expressing human CLDN6 was used as target cells, and T cells derived from hCD3 transgenic mice or hCD3/hCD137 knock-in mice were used as effector cells.
- amino acids are in the one-letter code or the three-letter code or both, e.g. Phe/F, Cys/C, Pro/P, Gln/Q, Ser/S, Glu/E, Thr/T, Gly/G, Trp/W, His/H, Tyr/Y, Ile/I, or Val Listed by /V.
- amino acid alterations also referred to herein as "amino acid substitutions” or “amino acid mutations"
- site-directed mutagenesis methods Kunkel et al. (Proc. Natl. Acad. USA (1985) 82, 488-492)
- known methods such as overlap extension PCR
- amino acid modification methods for substituting unnatural amino acids (Annu. Rev. Biophys. Biomol. Struct. (2006) 35, 225-249; and Proc. Natl. Acad. Sci. U.S.A. (2003) 100(11), 6353-6357).
- the meaning of the term “and/or” when describing sites of amino acid modification includes all combinations in which "and” and “or” are appropriately combined.
- “the amino acids at positions 33, 55, and/or 96 are substituted” includes the following variations of amino acid modifications: (a) position 33, (b) position 55, ( (d) positions 33 and 55; (e) positions 33 and 96; (f) positions 55 and 96; and (g) amino acids at positions 33, 55 and 96.
- an expression indicating modification of an amino acid an expression indicating a one-letter code or a three-letter code of an amino acid before and after modification, respectively, before and after a number representing a specific position is appropriately used.
- the modification N100bL or Asn100bLeu used in substituting amino acids contained in antibody variable regions represents a substitution of Leu for Asn at position 100b (according to Kabat numbering). That is, the number indicates the position of the amino acid according to Kabat numbering, the one-letter or three-letter amino acid code before the number indicates the amino acid before substitution, and the one-letter or three-letter amino acid code after the number. indicates the amino acid after substitution.
- the P238D or Pro238Asp modification used in substituting amino acids in the Fc region contained in the antibody constant region represents the substitution of Pro at position 238 (according to EU numbering) with Asp. That is, the number indicates the position of the amino acid according to EU numbering, the 1-letter or 3-letter amino acid code before the number indicates the amino acid before substitution, and the 1-letter or 3-letter amino acid code after the number. indicates the amino acid after substitution.
- polypeptide refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
- polypeptide refers to any chain of two or more amino acids, and does not refer to a specific length of the product.
- peptides, dipeptides, tripeptides, oligopeptides, "proteins,""amino acid chains,” or any other term used to refer to chains of two or more amino acids are included within the definition of "polypeptides.”
- the term “polypeptide” may be used instead of or interchangeably with any of these terms.
- polypeptide also includes, but is not limited to, glycosylation, acetylation, phosphorylation, amidation, derivatization with known protecting/blocking groups, proteolytic cleavage, or modification with unnatural amino acids. It is also intended to refer to products of post-expression modification.
- a polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid. It may be produced by any method, including chemical synthesis.
- Polypeptides described herein are about 3 amino acids or more, 5 amino acids or more, 10 amino acids or more, 20 amino acids or more, 25 amino acids or more, 50 amino acids or more, 75 amino acids or more, 100 amino acids or more, 200 amino acids or more, 500 amino acids
- the size may be 1,000 amino acids or more, or 2,000 amino acids or more.
- Percent (%) amino acid sequence identity to a reference polypeptide sequence is obtained after aligning the sequences to obtain the maximum percent sequence identity and introducing gaps if necessary. and is defined as the percentage of amino acid residues in a candidate sequence that are identical to amino acid residues in the reference polypeptide sequence, given that any conservative substitutions are not considered part of the sequence identity. Alignments for purposes of determining % amino acid sequence identity can be performed using a variety of methods within the skill in the art, such as BLAST, BLAST-2, ALIGN, or Megalign (DNASTAR) software, which are publicly available. It can be accomplished by using computer software.
- ALIGN-2 sequence comparison computer program
- the ALIGN-2 sequence comparison computer program is the work of Genentech, Inc. and its source code has been filed with the US Copyright Office, Washington DC, 20559 with user documentation, under US Copyright Registration No. TXU510087. Registered.
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from source code. ALIGN-2 programs are compiled for use on UNIX operating systems, including Digital UNIX V4.0D.
- % amino acid sequence identity of a given amino acid sequence A to, with, or to a given amino acid sequence B is calculated as follows: Hundredfold. where X is the number of amino acid residues scored as identical matches in the alignment of A and B by the sequence alignment program ALIGN-2, and Y is the total number of amino acid residues in B. .
- % amino acid sequence identity of A to B is not equal to the % amino acid sequence identity of B to A if the length of amino acid sequence A is not equal to the length of amino acid sequence B. deaf. Unless otherwise specified, all % amino acid sequence identity values used herein are obtained using the ALIGN-2 computer program as described in the immediately preceding paragraph.
- Antibodies and antigen-binding molecules can be produced using recombinant methods and constructs, for example, as described in US Pat. No. 4,816,567.
- isolated nucleic acids are provided that encode the antibodies described herein. Such nucleic acids may encode VL-comprising amino acid sequences and/or VH-comprising amino acid sequences of an antibody (eg, antibody light and/or heavy chains).
- one or more vectors eg, expression vectors
- host cells containing such nucleic acids are provided.
- the host cell comprises (1) a vector comprising a nucleic acid encoding an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody; or (2) an amino acid sequence comprising the VL of the antibody.
- a first vector containing nucleic acid encoding the sequence and a second vector containing nucleic acid encoding the amino acid sequence comprising the VH of the antibody are included (eg, transformed).
- the host cells are eukaryotic (eg, Chinese Hamster Ovary (CHO) cells) or lymphoid (eg, Y0, NS0, Sp2/0 cells).
- culturing a host cell containing nucleic acid encoding the antibody as described above under conditions suitable for expression of the antibody, and optionally removing the antibody from the host cell (or host cell culture medium) A method of making a multispecific antigen binding molecule of the present disclosure is provided, comprising recovering.
- nucleic acids encoding the antibodies are isolated and used for further cloning and/or expression in a host cell. Insert into one or more vectors.
- nucleic acids may be readily isolated and sequenced using conventional procedures (e.g., oligonucleotide probes capable of specifically binding to the genes encoding the heavy and light chains of the antibody). by using).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, particularly if glycosylation and Fc effector functions are not required. See, eg, US Pat. Nos. 5,648,237, 5,789,199, and 5,840,523 regarding expression of antibody fragments and polypeptides in bacteria. (In addition, Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, describing the expression of antibody fragments in E. coli See also.) After expression, the antibody may be isolated from the bacterial cell paste in the soluble fraction and may be further purified.
- fungi or yeast In addition to prokaryotes, fungi or yeast, including strains of fungi and yeast in which the glycosylation pathway has been "humanized", resulting in the production of antibodies with a partial or complete human glycosylation pattern.
- Nuclear microbes are preferred cloning or expression hosts for antibody-encoding vectors. See Gerngross, Nat. Biotech. 22:1409-1414 (2004) and Li et al., Nat. Biotech. 24:210-215 (2006).
- invertebrates and vertebrates are also suitable host cells for the expression of glycosylated antibodies.
- invertebrate cells include plant and insect cells.
- a number of baculovirus strains have been identified for use in conjugation with insect cells, particularly for transformation of Spodoptera frugiperda cells.
- Plant cell cultures can also be used as hosts. See, for example, US Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
- Vertebrate cells can also be used as hosts.
- mammalian cell lines adapted to grow in suspension would be useful.
- Other examples of useful mammalian host cell lines are the SV40 transformed monkey kidney CV1 strain (COS-7); a human embryonic kidney strain (Graham et al., J. Gen Virol. 36:59 (1977 293 or 293 cells described in ), etc.); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells described in Mather, Biol. Reprod.
- monkey kidney cells (CV1 ); African green monkey kidney cells (VERO-76); human cervical cancer cells (HELA); canine kidney cells (MDCK); Buffalo strain rat hepatocytes (BRL 3A); (Hep G2); mouse breast cancer (MMT 060562); TRI cells (described, for example, in Mather et al., Annals NY Acad. Sci. 383:44-68 (1982)); MRC5 cells; .
- Other useful mammalian host cell lines are Chinese Hamster Ovary (CHO) cells, including DHFR - CHO cells (Urlaub et al., Proc. Natl. Acad. Sci.
- Recombinant production of the antigen-binding molecules described herein includes one or more vectors comprising nucleic acids encoding amino acid sequences that comprise an entire antigen-binding molecule or a portion of an antigen-binding molecule (e.g., by It can be performed in a manner similar to that described above by using host cells that have been transformed.
- the term “antigen-binding molecule” refers to any molecule that contains an antigen-binding site or has binding activity to an antigen and has about 5 amino acids or more. It can further refer to molecules such as peptides or proteins having a length of . Peptides and proteins are not limited to those of biological origin, for example, they may be polypeptides produced from artificially designed sequences. They may be either naturally occurring polypeptides, synthetic polypeptides, recombinant polypeptides, and the like. A scaffold molecule containing a known stable conformation such as an ⁇ / ⁇ barrel as a scaffold and a portion of the molecule serving as an antigen-binding site is also one aspect of the antigen-binding molecule described herein. .
- Multispecific antigen-binding molecule refers to an antigen-binding molecule that specifically binds to two or more antigens.
- Multispecific antigen-binding molecules include antibodies and antibody fragments that specifically bind to more than one antigen.
- bispecific means that an antigen-binding molecule can specifically bind to at least two different antigenic determinants.
- trimspecific means that an antigen-binding molecule can specifically bind to at least three different antigenic determinants.
- the multispecific antigen binding molecules of the present disclosure are trispecific antigen binding molecules, i.e., capable of specifically binding three different antigens, i.e., binding CD3 and CD137. It is a trispecific antigen-binding molecule that can specifically bind to CLDN6, but not to both antigens simultaneously.
- the disclosure provides: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137; and (ii) claudin 6 (CLDN6), preferably human CLDN6.
- a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137
- claudin 6 preferably human CLDN6.
- an anti-cancer agent comprising, as an active ingredient, a multispecific antigen-binding molecule comprising a second antigen-binding portion that can be used.
- the disclosure provides: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137; and (ii) claudin 6 (CLDN6), preferably human CLDN6.
- a pharmaceutical composition for use in combination with at least one other anti-cancer agent comprising as an active ingredient a multispecific antigen-binding molecule comprising a second antigen-binding portion that can be used.
- the disclosure provides (i) a first antigen binding moiety capable of binding CD3 and CD137, wherein the antigen binding moiety binds either CD3 or CD137, and (ii) binds Claudin 6 (CLDN6).
- a multispecific antigen comprising a second antigen-binding portion capable of binding only to CD3, and having higher cytotoxic activity than when said first antigen-binding portion is an antigen-binding portion capable of binding only to CD3
- an anticancer agent comprising a binding molecule as an active ingredient.
- the present disclosure provides (i) a first antigen binding moiety capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) Claudin 6 (CLDN6) multispecific antigen comprising a second antigen-binding portion capable of binding to and having reduced toxicity compared to when said first antigen-binding portion is an antigen-binding portion capable of binding only to CD3
- a first antigen binding moiety capable of binding CD3 and CD137, which binds either CD3 or CD137
- Claudin 6 (CLDN6) multispecific antigen comprising a second antigen-binding portion capable of binding to and having reduced toxicity compared to when said first antigen-binding portion is an antigen-binding portion capable of binding only to CD3
- an anticancer agent comprising a binding molecule as an active ingredient.
- the present disclosure provides: A multispecific antigen-binding molecule comprising (1) a first antigen-binding domain capable of binding to a T-cell receptor complex, and (2) a second antigen-binding portion capable of binding to CLDN6, wherein , an antigen binding portion capable of binding to a T-cell receptor complex comprising a heavy chain comprising the amino acid sequence of SEQ ID NO:194 and a light chain comprising the amino acid sequence of SEQ ID NO:192 and an amino acid sequence of SEQ ID NO:193 Similar or greater T-cytotoxic activity compared to a multispecific antibody (CS3348) comprising an antigen-binding portion capable of binding to CLDN6 comprising a heavy chain and a light chain comprising the amino acid sequence of SEQ ID NO: 195
- an anticancer agent comprising a multispecific antigen-binding molecule as an active ingredient.
- the present disclosure provides a pharmaceutical composition comprising at least one other anti-cancer agent as an active ingredient, wherein (i) it is capable of binding to CD3 and CD137;
- a pharmaceutical composition for use in combination with a multispecific antigen binding molecule comprising a first antigen binding portion that binds and (ii) a second antigen binding portion capable of binding claudin 6 (CLDN6) is provided. .
- the disclosure provides: A pharmaceutical composition for treating or preventing cancer, comprising a combination of the following multispecific antigen-binding molecules and at least one other anticancer agent: (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and (ii) a second antigen-binding portion capable of binding Claudin 6 (CLDN6) A multispecific antigen binding molecule comprising the portion is provided.
- the disclosure provides (i) a first antigen binding moiety capable of binding CD3 and CD137, wherein the antigen binding moiety binds either CD3 or CD137, and (ii) binds Claudin 6 (CLDN6). and at least one other anti-cancer agent in combination.
- a first antigen binding moiety capable of binding CD3 and CD137, wherein the antigen binding moiety binds either CD3 or CD137, and (ii) binds Claudin 6 (CLDN6). and at least one other anti-cancer agent in combination.
- the present disclosure provides an effective amount of (i) a first antigen-binding moiety that is capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) claudin-6 ( Inducing cytotoxicity in an individual comprising administering a multispecific antigen binding molecule comprising a second antigen binding portion capable of binding to CLDN6) and an effective amount of at least one other anticancer agent
- a first antigen-binding moiety that is capable of binding CD3 and CD137 and that binds either CD3 or CD137
- claudin-6 Inducing cytotoxicity in an individual comprising administering a multispecific antigen binding molecule comprising a second antigen binding portion capable of binding to CLDN6
- an effective amount of at least one other anticancer agent Provided are methods of treating, treating, or preventing cancer.
- the present disclosure comprises administering to the individual an effective amount of at least one other anti-cancer agent that (i) is capable of binding CD3 and CD137 and is capable of binding CD
- the present disclosure comprises administering to the individual an effective amount of at least one other anti-cancer agent that (i) is capable of binding CD3 and CD137 and is capable of binding CD3 or CD137.
- a multispecific antigen-binding molecule comprising a first antigen-binding portion that binds either and (ii) a second antigen-binding portion capable of binding claudin 6 (CLDN6) , cell growth inhibition, cell growth inhibition, immune response activation, cancer treatment, or cancer prevention.
- CLDN6 claudin 6
- the present disclosure provides an individual with an effective amount of (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) ) cytotoxicity in an individual by at least one other anticancer agent comprising administering a multispecific antigen-binding molecule comprising a second antigen-binding portion capable of binding to Claudin 6 (CLDN6)
- a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137
- cytotoxicity in an individual by at least one other anticancer agent comprising administering a multispecific antigen-binding molecule comprising a second antigen-binding portion capable of binding to Claudin 6 (CLDN6)
- CLDN6 Claudin 6
- the present disclosure provides cancer cells with (i) a first antigen binding moiety that is capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) claudin-6. cancer cells or tumors comprising cancer cells by contact with a multispecific antigen-binding molecule comprising a second antigen-binding portion capable of binding to (CLDN6) and at least one other anti-cancer agent Methods of inducing tissue injury or inhibiting growth of cancer cells or tumor tissue containing cancer cells are provided. In one aspect, the present disclosure provides cancer cells with (i) a first antigen-binding moiety that is capable of binding CD3 and CD137 and (ii) claudin-6 that binds either CD3 or CD137.
- a multispecific antigen-binding molecule comprising a second antigen-binding portion capable of binding to (CLDN6), and at least one other anticancer agent, by contacting said multispecific antigen-binding molecule and at least one provide a method for confirming whether two other anticancer agents cause damage to cancer cells or tumor tissue containing cancer cells, or inhibit the growth of cancer cells or tumor tissue containing cancer cells do.
- the disclosure provides: (A) comprising a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and a second antigen-binding portion having binding activity for Claudin 6 (CLDN6) a pharmaceutical composition comprising a multispecific antigen-binding molecule; (B) a container; and (C) instructions or a label indicating that the multispecific antigen binding molecule and at least one other anticancer agent are administered in combination to the individual to treat or prevent cancer in the individual; Provide a kit containing In one aspect, the disclosure provides: (A) at least one other anticancer agent; (B) a container; and (C) the at least one other anticancer agent and a first anticancer agent capable of binding to CD3 and CD137, and binding either CD3 or CD137, to treat or prevent cancer in the individual; An instruction or label indicating that the antigen-binding portion and a pharmaceutical composition comprising a multispecific antigen-binding molecule comprising a second antigen
- kits containing In one aspect, the disclosure provides: (A) comprising a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, and a second antigen-binding portion having binding activity for Claudin 6 (CLDN6) a pharmaceutical composition comprising a multispecific antigen-binding molecule; (B) a container; and (C) providing a kit containing at least one other anti-cancer agent;
- the present disclosure provides for use in treating cancer, (i) a first antigen-binding portion capable of binding CD3 and CD137 and that binds either CD3 or CD137, and (ii) a second antigen-binding portion that has binding activity for Claudin 6 (CLDN6)
- a multispecific antigen binding molecule comprising the portion is provided.
- the present disclosure provides (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, for use in treating cancer and (ii) a second antigen-binding portion having binding activity to Claudin 6 (CLDN6), with at least one other anticancer agent.
- the present disclosure provides (i) a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, in the manufacture of a medicament for treating cancer and (ii) a multispecific antigen-binding molecule comprising a second antigen-binding portion having binding activity for Claudin 6 (CLDN6).
- a first antigen-binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137, in the manufacture of a medicament for treating cancer
- a multispecific antigen-binding molecule comprising a second antigen-binding portion having binding activity for Claudin 6 (CLDN6).
- the present disclosure provides (i) a first antigen capable of binding to CD3 and CD137, which binds to either CD3 or CD137, in the manufacture of a medicament for treating cancer
- a first antigen capable of binding to CD3 and CD137 which binds to either CD3 or CD137
- a second antigen binding portion having binding activity to Claudin 6 (CLDN6) and at least one other anticancer agent is provided.
- a multispecific antigen binding molecule comprised in an anti-cancer agent, pharmaceutical composition, combination, kit of the disclosure or used in a method or use of the disclosure comprises (iii) may further comprise an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to the native human IgG1 Fc domain;
- the components of the multispecific antigen binding molecules contained in the anti-cancer agents, pharmaceutical compositions, combinations, kits of the disclosure or used in the methods or uses of the disclosure can be fused together in a variety of configurations. can.
- An exemplary configuration is illustrated in FIG.
- the multispecific antigen binding molecule comprises an Fc domain composed of a first Fc region subunit and a second Fc region subunit that can stably associate.
- the components of the multispecific antigen binding molecule are directly or via various linkers, particularly those described herein or
- the fusion may be via a peptide linker containing one or more amino acids, typically about 2-20 amino acids, known in the art.
- Suitable non-immunogenic peptide linkers include, for example, (G4S)n, (SG4)n, (G4S)n, or G4(SG4)n peptide linkers, where n is generally 1-10, Typically a number of 2-4.
- a multispecific antigen binding molecule comprised in an anti-cancer agent, pharmaceutical composition, combination, kit of the disclosure or used in a method or use of the disclosure comprises (i) a first antigen binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137; and (ii) a second antigen capable of binding claudin 6 (CLDN6).
- a multispecific antigen-binding molecule comprising a binding moiety, the first antibody variable region of the first antigen binding portion is fused to the first heavy chain constant region and the second antibody variable region of the first antigen binding portion is fused to the first light chain constant region wherein the third antibody variable region of the second antigen binding portion is fused to the second heavy chain constant region and the fourth antibody variable region of the second antigen binding portion is fused to the second light chain constant region It can be a multispecific antigen binding molecule fused to a constant region.
- a multispecific antigen binding molecule comprised in an anti-cancer agent, pharmaceutical composition, combination, kit of the disclosure, or used in a method or use of the disclosure comprises (i) a first antigen binding portion capable of binding CD3 and CD137, which binds either CD3 or CD137; and (ii) a second antigen capable of binding claudin 6 (CLDN6).
- a multispecific antigen binding molecule comprising a binding portion, wherein a first antibody variable region of the first antigen binding portion is fused to a first heavy chain constant region; two antibody variable regions fused to a first light chain constant region, a third antibody variable region of a second antigen binding portion fused to a second heavy chain constant region, and a second antigen
- a fourth antibody variable region of the binding moiety is fused to a second light chain constant region, said constant region comprising (g1)-(g7): (g1) a first heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 74, a first light chain constant region comprising the amino acid sequence of SEQ ID NO: 87, a second heavy chain comprising the amino acid sequence of SEQ ID NO: 73 a chain constant region and a second light chain constant region comprising the amino acid sequence of SEQ ID NO:88; (g2) a first heavy chain constant region comprising the amino acid sequence of SEQ ID NO: 74, a first light chain constant region comprising the amino
- the anti-cancer agents, pharmaceutical compositions, combinations, kits of the disclosure or used in the methods or uses of the disclosure comprise four polypeptide chains.
- a multispecific antigen-binding molecule wherein the four polypeptide chains comprise (h01) to (h18): (h01) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO: 42 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO: 51 and a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO: 56 ) and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:69; (h02) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO: 41 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO: 50, and a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO: 54 ) and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:68; (h01)
- pyroglutamylated antibodies are post-translationally modified when expressed in cells.
- post-translational modifications include cleavage of lysines at the C-terminus of heavy chains by carboxypeptidases; modification of glutamine or glutamic acid at the N-terminus of heavy and light chains to pyroglutamate by pyroglutamylation; glycosylation. deamidation; and glycosylation, and such post-translational modifications are known to occur in a variety of antibodies (Journal of Pharmaceutical Sciences, 2008, Vol. 97, p. 2426-2447).
- Multispecific antigen-binding molecules included in anticancer agents, pharmaceutical compositions, combinations, kits, or used in the methods or uses of the disclosure also include post-translationally modified multispecific antibodies. included. Examples of such multispecific antigen binding molecules of the present disclosure that undergo post-translational modifications include pyroglutamylation at the N-terminus of the heavy chain variable region and/or deletion of lysine at the C-terminus of the heavy chain. Multispecific antibodies are included. It is known in the art that such post-translational modifications by pyroglutamylation at the N-terminus and deletion of lysine at the C-terminus have no effect on antibody activity (Analytical Biochemistry, 2006, Vol. 348, p. 24-39).
- the term "antigen-binding portion” refers to a polypeptide molecule that specifically binds to an antigen.
- the antigen-binding portion directs the entity to which it is bound (e.g., the second antigen-binding portion) to a target site, e.g., a specific type of tumor cell that expresses a cancer antigen (CLDN6). can be oriented.
- the antigen-binding portion is capable of activating signaling through its target antigen, eg, T-cell receptor complex antigen (CD3) or co-stimulatory molecule CD137.
- Antigen-binding portions include antibodies and fragments thereof as further defined herein.
- antigen binding portions include antibody antigen binding domains or antibody variable regions, including antibody heavy chain variable regions and antibody light chain variable regions.
- the antigen binding portion may comprise an antibody constant region as further defined herein and known in the art.
- Useful heavy chain constant regions include any of the five isotypes: ⁇ , ⁇ , ⁇ , ⁇ , or ⁇ .
- Useful light chain constant regions include either of two isotypes: kappa and lambda.
- the terms "first”, “second”, “third” and “fourth” used herein mean that there are two or more types of portions etc. It is used for the convenience of distinguishing when The use of these terms is not intended to imply any particular order or orientation of the multispecific antigen binding molecules unless otherwise specified.
- the multispecific antigen-binding molecules described herein comprise at least one antigen-binding moiety capable of binding CD3 and CD137 (referred to herein as “dual antigen binding portion” or “first antigen binding portion” or “Dual-Ig” or “Dual-Fab”).
- the first antigen binding portion described herein can bind CD3 and CD137 and binds either CD3 or CD137. That is, the first antigen binding portion described herein binds to CD3. Alternatively, the first antigen binding portion described herein binds to CD137.
- the multispecific antigen binding molecule can specifically bind CD3 and CD137, but comprises no more than two antigen binding moieties that bind either CD3 or CD137. In one embodiment, the multispecific antigen binding molecule is capable of binding CD3 and CD137, resulting in monovalent binding to either CD3 or CD137. In one embodiment, the first antigen-binding portion has binding activity to CD3 and has binding activity to CD137, but binds to either CD3 or CD137 when it binds to the antigen. In one embodiment, the first antigen-binding portion is an antigen-binding portion that is capable of binding CD3 and CD137, but does not bind CD3 and CD137 simultaneously.
- the multispecific antigen- binding molecules described herein comprise at least one antigen-binding portion capable of binding to a T-cell receptor complex-binding activity (also referred to herein as a "first antigen-binding portion").
- the first antigen binding portion described herein can bind to the T cell receptor complex.
- An antigen-binding portion capable of binding to a T-cell receptor complex is an anti-T-cell receptor comprising a region that specifically binds to and is complementary to part or all of the T-cell receptor complex. Refers to a portion of a conjugated antibody.
- the T-cell receptor complex may be the T-cell receptor itself, or an adapter molecule that constitutes the T-cell receptor complex together with the T-cell receptor.
- a preferred adapter is CD3.
- the dual antigen-binding portion (“first antigen-binding portion”) is generally a Fab molecule, particularly a conventional Fab molecule.
- the dual antigen-binding portion (“first antigen-binding portion”) is a domain comprising antibody light and heavy chain variable regions (VL and VH). Suitable examples of such domains comprising antibody light and heavy chain variable regions include "single-chain Fv (scFv)", “single-chain antibody”, “Fv”, “single-chain Fv2 (scFv2)", “ Fab”, "F(ab')2” and the like.
- the dual antigen-binding portion specifically binds to all or part of the CD3 partial peptide.
- the CD3 is human CD3 or cynomolgus monkey CD3, particularly human CD3.
- the first antigen-binding portion is cross-reactive with (ie, specifically binds to) human CD3 and cynomolgus monkey CD3.
- the first antigen-binding portion is the epsilon subunit of CD3, particularly the human CD3 epsilon subunit of CD3 set forth in SEQ ID NO: 170 (NP_000724.1) (RefSeq accession number in parentheses) can specifically bind to In some embodiments, the first antigen-binding portion can specifically bind to a CD3 epsilon chain expressed on the surface of a eukaryotic cell. In some embodiments, the first antigen binding portion binds to the CD3 epsilon chain expressed on the surface of the T cell.
- CD137 is human CD137.
- suitable examples of antigen-binding molecules of the present disclosure include antigen-binding molecules that bind to the same epitope as the human CD137 epitope bound by an antibody selected from the group consisting of: an antibody that recognizes a region containing the SPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGC sequence (SEQ ID NO: 182); an antibody that recognizes a region containing the sequence DCTPGFHCLGAGCSMCEQDCKQGQELTKKGC (SEQ ID NO: 181); An antibody that recognizes a region containing the LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAEC sequence (SEQ ID NO: 183) and an antibody that recognizes a region containing the LQDPCSNCPAGTFCDNNRNQIC sequence (SEQ ID NO: 180) in
- the dual antigen-binding portion (“first antigen-binding portion”) comprises the following antibody variable regions (a1)-(a4): (a1) a heavy chain variable region (first antibody variable region) comprising complementarity determining region (CDR) 1 of SEQ ID NO: 9, CDR 2 of SEQ ID NO: 15, and CDR 3 of SEQ ID NO: 21, and a sequence a light chain variable region (second antibody variable region) comprising CDR 1 of NO: 31, CDR 2 of SEQ ID NO: 35, and CDR 3 of SEQ ID NO: 39; (a2) a heavy chain variable region (first antibody variable region) comprising complementarity determining region (CDR) 1 of SEQ ID NO: 10, CDR 2 of SEQ ID NO: 16, and CDR 3 of SEQ ID NO: 22, and sequences a light chain variable region (second antibody variable region) comprising CDR 1 of NO: 31, CDR 2 of SEQ ID NO: 35, and CDR 3 of SEQ ID NO: 39; (a3) a heavy chain variable region (first antibody variable region) compris
- the dual antigen-binding portion (“first antigen-binding portion") comprises an antibody variable region comprising a human antibody framework or a humanized antibody framework.
- the dual antigen-binding portion (“first antigen-binding portion”) comprises (c1)-(c4): (c1) a heavy chain variable region (first antibody variable region) comprising the amino acid sequence of SEQ ID NO:3 and a light chain variable region (second antibody variable region) comprising the amino acid sequence of SEQ ID NO:27; (c2) a heavy chain variable region (first antibody variable region) comprising the amino acid sequence of SEQ ID NO: 4, and a light chain variable region (second antibody variable region) comprising the amino acid sequence of SEQ ID NO: 27; (c3) a heavy chain variable region (first antibody variable region) comprising the amino acid sequence of SEQ ID NO: 5, and a light chain variable region (second antibody variable region) comprising the amino acid sequence of SEQ ID NO: 28; (c4) a heavy chain variable region (first antibody variable region) comprising the amino acid sequence of SEQ ID NO: 6, and a light chain variable region (second antibody variable region) comprising the amino acid sequence of SEQ ID NO: 28 including any one of
- the dual antigen binding portion (“first antigen binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:3.
- a heavy chain variable region (first antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:27 (Second antibody variable region) sequence.
- the dual antigen binding portion (“first antigen binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:4.
- a heavy chain variable region (first antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:27 (Second antibody variable region) sequence.
- the dual antigen binding portion (“first antigen binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:5.
- a heavy chain variable region (first antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:28 (Second antibody variable region) sequence.
- the dual antigen binding portion (“first antigen binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:6.
- a heavy chain variable region (first antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:28 (Second antibody variable region) sequence.
- the dual antigen-binding portion (“first antigen-binding portion”) comprises (j01)-(j18): (j01) a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO:54 and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:68; (j02) a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO:55 and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:68; (j03) a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO:56 and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:69; (j04) a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO:57 and a light chain (chain 4) comprising the amino acid sequence of SEQ ID NO:69; (j05) a heavy chain (chain 3) comprising the amino acid sequence of SEQ ID NO:60 and a light chain
- the dual antigen-binding portion (“first antigen-binding portion”) comprises an antibody variable region. In certain embodiments, the dual antigen-binding portion (“first antigen-binding portion”) comprises a first antibody variable region and a second antibody variable region as described above.
- the multispecific antigen-binding molecules of the present disclosure also include post-translationally modified multispecific antibodies.
- Examples of such multispecific antigen binding molecules of the present disclosure that undergo post-translational modifications include pyroglutamylation at the N-terminus of the heavy chain variable region and/or deletion of lysine at the C-terminus of the heavy chain.
- Multispecific antigen binding molecules are included. It is known in the art that such post-translational modifications by pyroglutamylation at the N-terminus and deletion of lysine at the C-terminus have no effect on antibody activity (Analytical Biochemistry, 2006, Vol. 348, p. 24-39).
- the antigen-binding portion capable of binding to CLDN6 The multispecific antigen-binding molecules described herein comprise at least one antigen-binding portion capable of binding to CLDN6 (referred to herein as "CLDN6 antigen-binding portion or "second antigen-binding portion"). In certain embodiments, the multispecific antigen binding molecule comprises one antigen binding portion capable of binding CLDN6.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is generally a Fab molecule, particularly a conventional Fab molecule.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is a domain comprising antibody light and heavy chain variable regions (VL and VH). Suitable examples of such domains comprising antibody light and heavy chain variable regions include "single-chain Fv (scFv)", “single-chain antibody”, “Fv”, “single-chain Fv2 (scFv2)", “ Fab", "F(ab')2” and the like.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) specifically binds to all or part of a partial peptide of CLDN6.
- the CLDN6 is human CLDN6 or cynomolgus monkey CLDN6 or mouse CLDN6, particularly human CLDN6.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is cross-reactive with (ie, specifically binds to) human CLDN6 and cynomolgus monkey CLDN6.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is the first extracellular domain of CLDN6 (amino acids 29-81 of SEQ ID NO: 196 or 197) or the second extracellular domain of CLDN6 Binds specifically to a domain (amino acids 138-159 of SEQ ID NO: 196 or 197).
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) specifically binds to human CLDN6 expressed on the surface of eukaryotic cells.
- the binding activity to CLDN6 is binding activity to CLDN6 protein expressed on the surface of cancer cells.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) does not substantially bind to human CLDN9.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) does not substantially bind to human CLDN4.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) does not substantially bind to human CLDN3.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) does not substantially bind to the CLDN6 variant defined in SEQ ID NO:205.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is a crossover Fab molecule, i.e., a Fab in which either the variable or constant regions of the Fab heavy and Fab light chains are exchanged is a molecule.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises the following antibody variable regions (b1) or (b2): (b1) a heavy chain variable region (third antibody variable region) comprising complementarity determining region (CDR) 1 of SEQ ID NO: 8, CDR 2 of SEQ ID NO: 14, and CDR 3 of SEQ ID NO: 20, and a sequence a light chain variable region (fourth antibody variable region) comprising CDR 1 of NO: 30, CDR 2 of SEQ ID NO: 34, and CDR 3 of SEQ ID NO: 38; (b2) a heavy chain variable region (third antibody variable region) comprising complementarity determining region (CDR) 1 of SEQ ID NO: 7, CDR 2 of SEQ ID NO: 13, and CDR 3 of SEQ ID NO: 19, and a sequence A light chain variable region (fourth antibody variable region) comprising CDR 1 of NO: 29, CDR 2 of SEQ ID NO: 33, and CDR 3 of SEQ ID NO: 37 (b3) a heavy chain variable region
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises an antibody variable region comprising a human antibody framework or a humanized antibody framework.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises (d1) or (d2): (d1) a heavy chain variable region (third antibody variable region) comprising the amino acid sequence of SEQ ID NO:2, and a light chain variable region (fourth antibody variable region) comprising the amino acid sequence of SEQ ID NO:26; (d2) a heavy chain variable region (third antibody variable region) comprising the amino acid sequence of SEQ ID NO: 1 and a light chain variable region (fourth antibody variable region) comprising the amino acid sequence of SEQ ID NO: 25 (d3) a heavy chain variable region (third antibody variable region) comprising the amino acid sequence of SEQ ID NO: 25, and a light chain variable region (fourth antibody variable region) comprising the amino acid sequence of SEQ ID NO: 1 including.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:2.
- a heavy chain variable region (third antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:26 (fourth antibody variable region) sequence.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:1.
- a heavy chain variable region (third antibody variable region) sequence and a light chain variable region that is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:25 (fourth antibody variable region) sequence.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) is at least about 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO:25.
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises (k01)-(k09): (k01) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO:41 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO:50; (k02) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO:42 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO:51; (k03) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO:44 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO:52; (k04) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO:45 and a light chain (chain 2) comprising the amino acid sequence of SEQ ID NO:50; (k05) a heavy chain (chain 1) comprising the amino acid sequence of SEQ ID NO:46 and a light chain (chain 2) comprising the amino acid sequence of S
- the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises an antibody variable region. In certain embodiments, the CLDN6 antigen-binding portion (“second antigen-binding portion”) comprises the third antibody variable region and the fourth antibody variable region described above.
- the amino acid sequences of the heavy and light chain CDR1, CDR2, CDR3, heavy chain variable region, light chain variable region, full length heavy chain, and full length light chain are CD3, CD137, T
- One or more amino acids may be substituted, deleted, added and/or inserted into the amino acid sequence as long as it has binding activity to the cell receptor complex or CLDN6.
- Methods well known to those skilled in the art for preparing an amino acid sequence in which one or more amino acids have been substituted, deleted, added and/or inserted include a method of introducing mutation into a protein It has been known.
- variable regions of the original multispecific antigen-binding molecule and Variant multispecific antigen-binding molecules can be prepared that contain combinations of functionally equivalent antibody variable regions.
- functionally equivalent in the present invention means that the binding affinity for an antigen is equivalent, or when used as a multispecific antigen-binding molecule, cells expressing Claudin 6 or It means that the cytotoxic activity against tissues containing the cells is equivalent. Binding affinity and cytotoxic activity can be measured based on the descriptions herein, and will be described in detail later.
- the number of amino acids to be modified is not limited, for example, 40 or less, 30 or less, 20 or less, preferably 18 or less, 16 or less, 15 or less, 12 or less, 10 or less, 9 or less , 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- properties of amino acid side chains include hydrophobic amino acids (A, I, L, M, F, P, W, Y, V), hydrophilic amino acids (R, D, N, C, E, Q, G, H, K, S, T), amino acids with aliphatic side chains (G, A, V, L, I, P), amino acids with hydroxyl group-containing side chains (S, T, Y), sulfur atom-containing side chains (C, M), amino acids with carboxylic acid- and amide-containing side chains (D, N, E, Q), amino acids with base-containing side chains (R, K, H), and aromatic-containing side chains Chained amino acids (H, F, Y, W) can be mentioned (everything in brackets represents the single letter code for the amino acid).
- Antigen refers to a site (e.g., a contiguous stretch of amino acids, or a conformation composed of discrete regions of noncontiguous amino acids) on a polypeptide macromolecule to which an antigen-binding moiety binds. ) to form an antigen-binding moiety-antigen complex.
- Useful antigenic determinants are, for example, on the surface of tumor cells, on the surface of virus-infected cells, on the surface of other diseased cells, on the surface of immune cells, free in serum, and/or or can be found in the extracellular matrix (ECM).
- ECM extracellular matrix
- proteins referred to herein as antigens include mammals such as primates (e.g., humans) and rodents (e.g., mice and rats). , may be any native form of the protein from any vertebrate source.
- the antigen is human CD3, human CD137, or human CLDN6.
- the term includes "full-length,” unprocessed protein as well as any form of the protein that results from processing in the cell.
- the term also includes naturally occurring variants of proteins, such as splice or allelic variants.
- the multispecific antigen binding molecules described herein bind to epitopes of CD3, CD137, or CLDN6 that are conserved among CD3, CD137, or CLDN6 of different species.
- the multispecific antigen binding molecules of the present application are trispecific antigen binding molecules, i.e., capable of specifically binding three different antigens, i.e., binding CD3 and CD137. It is a trispecific antigen-binding molecule that can specifically bind to CLDN6, but not to both antigens simultaneously.
- Claudin 6 and other claudin family proteins
- CLDN6 refers to proteins such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. Refers to any native claudin-6 from any vertebrate source, including mammals.
- the amino acid sequence of human CLDN6 (hCLDN6) is shown in SEQ ID NO: 196 or 197, and the amino acid sequence of mouse CLDN6 (mCLDN6) is shown in SEQ ID NO:201.
- CLDN3, CLDN4, and CLDN9 There are many other proteins in the claudin family besides CLDN6, such as CLDN3, CLDN4, and CLDN9.
- the amino acid sequences of human CLDN3 (hCLDN3), human CLDN4 (hCLDN4), and human CLDN9 (hCLDN9) are shown in SEQ ID NOS: 199, 200, and 198, respectively.
- the amino acid sequences of mouse CLDN3 (mCLDN3), mouse CLDN4 (mCLDN4), and mouse CLDN9 (mCLDN9) are shown in SEQ ID NOs: 203, 204, and 202, respectively.
- the multispecific antigen-binding molecule specifically binds to all or part of a partial peptide of CD3.
- the CD3 is human CD3 or cynomolgus monkey CD3, particularly human CD3.
- the multispecific antigen binding molecule is cross-reactive with (ie, specifically binds to) human CD3 and cynomolgus monkey CD3.
- the multispecific antigen-binding molecule is the epsilon subunit of CD3, particularly the human CD3 epsilon subunit of CD3 set forth in SEQ ID NO: 170 (NP_000724.1) (RefSeq accession number in parenthesis) can specifically bind to
- the multispecific antigen binding molecules are capable of specifically binding CD3 epsilon chains expressed on the surface of eukaryotic cells.
- the multispecific antigen binding molecule binds to the CD3 epsilon chain expressed on the surface of T cells.
- CD137 is human CD137.
- preferred examples of antigen-binding molecules of the present disclosure include antigen-binding molecules that bind to the same epitope as the human CD137 epitope bound by an antibody selected from the group consisting of: an antibody that recognizes a region containing the SPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGC sequence (SEQ ID NO: 182); an antibody that recognizes a region containing the sequence DCTPGFHCLGAGCSMCEQDCKQGQELTKKGC (SEQ ID NO: 181); An antibody that recognizes a region containing the LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAEC sequence (SEQ ID NO: 183) and an antibody that recognizes a region containing the LQDPCSNCPAGTFCDNNRNQIC sequence (SEQ ID NO: 180
- Antigen-binding domain refers to a portion of an antibody that contains regions that specifically bind to and are complementary to part or all of an antigen.
- An antigen-binding domain may, for example, be provided by one or more antibody variable domains (also called antibody variable regions).
- the antigen binding domain comprises both an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- VL antibody light chain variable region
- VH antibody heavy chain variable region
- Such preferred antigen-binding domains include, for example, "single-chain Fv (scFv),""single-chainantibody,””Fv,””single-chain Fv2 (scFv2),””Fab,” and "F(ab' )2” is included.
- Antigen binding domains may also be provided by single domain antibodies.
- Single Domain Antibody As used herein, the term "single domain antibody” is not limited by its structure as long as the domain can exert antigen-binding activity by itself. Common antibodies, such as IgG antibodies, exhibit antigen-binding activity with the variable region formed by the pairing of VH and VL, whereas the domain structure of a single-domain antibody itself can be different. It is known that it can exert antigen-binding activity by itself without pairing with a domain. Generally, single domain antibodies have a relatively low molecular weight and exist in monomeric form.
- single domain antibodies include, but are not limited to, antigen binding molecules such as camelid VHH and shark VNAR, which naturally lack light chains, and all or part of an antibody VH domain or an antibody VL domain. Antibody fragments containing all or part are included.
- single domain antibodies which are antibody fragments containing all or part of an antibody VH domain or an antibody VL domain, include, but are not limited to, human antibody VH, such as those described in US Pat. No. 6,248,516 B1. Alternatively, an artificially prepared single domain antibody originating from the human antibody VL can be mentioned.
- a single domain antibody has three CDRs (CDR1, CDR2 and CDR3).
- Single domain antibodies can be obtained from animals capable of producing single domain antibodies or by immunization of animals capable of producing single domain antibodies.
- animals capable of producing single domain antibodies include, but are not limited to, camelids and transgenic animals carrying genes capable of producing single domain antibodies.
- Camelids include camels, llamas, alpacas, dromedaries, guanacos, and the like.
- transgenic animals carrying genes capable of producing single domain antibodies include, but are not limited to, transgenic animals described in International Publication No. WO2015/143414 and US Patent Publication No. US2011/0123527 A1. mentioned.
- the framework sequences of single domain antibodies obtained from the animal may be converted to human germline sequences or sequences similar thereto to obtain humanized single domain antibodies.
- Humanized single domain antibodies eg, humanized VHHs are also an aspect of the single domain antibodies of the invention.
- single domain antibodies can be obtained by ELISA, panning, or the like from a polypeptide library containing single domain antibodies.
- polypeptide libraries containing single domain antibodies include, but are not limited to, naive antibody libraries obtained from various animals or humans (e.g., Methods in Molecular Biology 2012 911 (65-78); and Biochimica et al. Biophysica Acta - Proteins and Proteomics 2006 1764: 8 (1307-1319)), antibody libraries obtained by immunization of different animals (e.g.
- variable region refers to the domains of the heavy or light chains of an antibody that are responsible for binding the antibody to the antigen.
- the heavy and light chain variable domains (VH and VL, respectively) of native antibodies are usually similar, with each domain containing four conserved framework regions (FR) and three hypervariable regions (HVR). have a structure. (See, eg, Kindt et al. Kuby Immunology, 6th ed., WH Freeman and Co., page 91 (2007).) A single VH or VL domain may be sufficient to confer antigen-binding specificity.
- antibodies that bind a particular antigen may be isolated using the VH or VL domains from the antibody that binds the antigen to screen a complementary library of VL or VH domains, respectively. See, eg, Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
- HVR hypervariable in sequence
- CDR complementarity determining region
- HVRs hypervariable regions
- CDRs complementarity determining regions
- Exemplary HVRs herein include: (a) at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3); resulting hypervariable loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); (b) at amino acid residues 24-34 (L1), 50-56 (L2), 89-97 (L3), 31-35b (H1), 50-65 (H2), and 95-102 (H3); the resulting CDRs (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed.
- HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
- HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2, and HVR-L3 are "H-CDR1,” "H-CDR2,” “H-CDR3,” and “L-CDR1,” respectively. ”, “L-CDR2”, and “L-CDR3”.
- an antibody variable region of the disclosure capable of binding CD3 and CD137 is "capable of binding CD3 and CD137" can be determined by methods known in the art.
- ECL method electrochemiluminescence method
- a region of a biotin-labeled test antigen-binding molecule capable of binding to CD3 and CD137 for example, a low-molecular-weight antibody composed of the Fab region, or a monovalent antibody thereof (a normal antibody is Antibodies lacking one of the two Fab regions with) are mixed with CD3 or CD137 labeled with a sulfo-tag (a Ru complex) and the mixture is added onto a streptavidin-immobilized plate.
- biotin-labeled test antigen-binding molecules bind to streptavidin on the plate.
- the assay may be performed by ELISA, FACS (Fluorescence Activated Cell Sorting), ALPHAScreen (Amplified Luminescent Proximity Homogeneous Assay Screen), the BIACORE method based on the surface plasmon resonance (SPR) phenomenon, etc. (Proc. Natl. Acad. Sci. USA (2006) 103 (11), 4005-4010).
- the assay can be performed using, for example, Biacore (GE Healthcare Japan Corp.), an interaction analysis instrument based on the surface plasmon resonance (SPR) phenomenon.
- Biacore analysis instruments include any model such as the Biacore T100, T200, X100, A100, 4000, 3000, 2000, 1000, or C.
- Any Biacore sensor chip can be used as the sensor chip, such as CM7, CM5, CM4, CM3, C1, SA, NTA, L1, HPA, or Au chips.
- antigen-binding molecules of the present disclosure such as protein A, protein G, protein L, anti-human IgG antibody, anti-human IgG-Fab, anti-human L chain antibody, anti-human Fc antibody, antigen protein, or antigen peptide proteins are immobilized on the sensor chip by coupling methods such as amine coupling, disulfide coupling, or aldehyde coupling.
- CD3 or CD137 is injected onto it as an analyte, and the interaction is measured to obtain a sensorgram. In this procedure, the concentration of CD3 or CD137 can be selected within a few ⁇ M to a few pM according to the interaction strength (eg KD) of the assay sample.
- CD3 or CD137 may be immobilized on a sensor chip instead of an antigen-binding molecule and then allowed to interact with the antibody sample to be evaluated. Whether the antibody variable region of the antigen-binding molecule of the present disclosure has binding activity to CD3 or CD137 is determined based on the dissociation constant (KD) value calculated from the interaction sensorgram, or before the action of the antigen-binding molecule sample. This can be confirmed based on the degree of increase in the post-action sensorgram above the level of .
- KD dissociation constant
- the binding activity or affinity of an antibody variable region of the disclosure for an antigen of interest is assayed using, for example, a Biacore T200 instrument (GE Healthcare) or a Biacore 8K instrument (GE Healthcare). at 37°C (for CD137) or 25°C (for CD3).
- Anti-human Fc eg GE Healthcare
- Antigen-binding molecules or antibody variable regions are captured on an anti-Fc sensor surface, then antigen (CD3 or CD137) is injected onto the flow cell. Capture levels for antigen binding molecules or antibody variable regions may be aimed at 200 resonance units (RU).
- Recombinant human CD3 or CD137 may be injected at 400-25 nM prepared by two-fold serial dilutions and then dissociated. All antigen binding molecules or antibody variable regions and analytes are prepared in ACES pH 7.4 containing 20 mM ACES, 150 mM NaCl, 0.05% Tween 20, 0.005% NaN3. The sensor surface is regenerated with 3M MgCl2 every cycle. Binding affinities are determined by processing the data and fitting a 1:1 binding model using, for example, Biacore T200 Evaluation software, version 2.0 (GE Healthcare) or Biacore 8K Evaluation software (GE Healthcare). To assess the specific binding activity or affinity of the antigen binding domains of this disclosure, KD values are calculated.
- ALPHAScreen is performed by ALPHA technology using two types of beads (donor and acceptor) and is based on the following principle: biological interactions between molecules bound to donor beads and molecules bound to acceptor beads.
- a luminescence signal is detected only when the action brings these two beads into close proximity.
- a photosensitizer in a donor bead excited by a laser converts ambient oxygen to excited state singlet oxygen.
- the singlet oxygen diffuses around the donor bead and reaches the acceptor bead, which is located in close proximity to it, thereby causing a chemiluminescent reaction in the bead, which ultimately emits light.
- the singlet oxygen produced by the donor bead will not reach the acceptor bead. Therefore, no chemiluminescent reaction occurs.
- One of the substances (ligand) that observes the interaction between them is immobilized on the gold thin film of the sensor chip. Light is applied from the back side of the sensor chip so that it is totally reflected at the interface between the gold thin film and the glass. As a result, a part of the reflected light forms a portion (SPR signal) where the reflection intensity is reduced.
- the other of the substances (analyte) to observe the interaction between them is injected onto the surface of the sensor chip. When the analyte binds to the ligand, the mass of the immobilized ligand molecule increases, changing the refractive index of the solvent on the sensor chip surface.
- This refractive index change shifts the position of the SPR signal (conversely, when the bound molecule dissociates, the signal returns to its original position).
- the Biacore system plots the amount of shift, ie mass change on the sensor chip surface, on the ordinate and displays the time-dependent change in mass as assay data (sensorgram).
- the amount of analyte bound to the ligand captured on the sensor chip surface can be determined from the sensorgram. However, since the amount of binding also depends on the amount of ligand, comparisons must be made under conditions using substantially the same amount of ligand.
- the kinetics namely the association rate constant (ka) and the dissociation rate constant (kd), can be determined from the curve of the sensorgram, while the affinity (KD) can be determined from the ratio of these constants.
- Inhibition assays are also suitably used in the BIACORE method. Examples of inhibition assays are described in Proc. Natl. Acad. Sci. USA (2006) 103 (11), 4005-4010.
- binding to either CD3 or CD137 implies not binding CD3 and CD137 (4-1BB) simultaneously.
- the term “does not bind CD3 and CD137 (4-1BB) at the same time” or “does not bind CD3 and CD137 (4-1BB) simultaneously” refers to antigen binding of the present disclosure. It means that the portion or antibody variable region cannot bind CD137 when bound to CD3 and conversely the antigen binding portion or antibody variable region cannot bind CD3 when bound to CD137.
- the phrase “not binding CD3 and CD137 simultaneously” includes not bridging cells expressing CD3 and cells expressing CD137, or binding CD3 and CD137, each expressed on different cells.
- antibody variable regions are not particularly limited as long as they have these functions. Examples thereof may include variable regions derived from IgG-type antibody variable regions in which some of the amino acids have been altered to bind to the desired antigen. Amino acids to be modified are selected, for example, from those amino acids in antibody variable regions that bind CD3 or CD137, the modification of which does not result in loss of antigen binding.
- the phrase "expressed on different cells” simply means that the antigen is expressed on separate cells.
- Such a combination of cells may be of the same type, such as a T cell and another T cell, or different types of cells, such as a T cell and an NK cell.
- a multispecific antigen-binding molecule contained in an anti-cancer agent, pharmaceutical composition, combination, kit of the present disclosure, or used in a method or use of the present disclosure upon antigen binding, "binds either CD3 or CD137 to confirm whether the antigen-binding molecule has binding activity to both CD3 and CD137; then, either CD3 or CD137 is bound in advance to the antigen-binding molecule comprising a variable region having this binding activity. and then determining the presence or absence of its binding activity for the other by the methods described above. Alternatively, it also determines whether the binding of an antigen binding molecule to either CD3 or CD137 immobilized on an ELISA plate or on a sensor chip is inhibited by the addition of the other to the solution.
- binding of an antigen-binding molecule of the present disclosure to either CD3 or CD137 is at least 50%, preferably 60% or more, more preferably 70% or more, by binding of the antigen-binding molecule to the other , more preferably 80% or more, even more preferably 90% or more, or even more preferably 95% or more.
- inhibition of binding of an antigen-binding molecule to CD3 is detected by methods known in the art (i.e., ELISA, BIACORE, etc.). It can be determined in the presence of antigen (eg CD137). In another aspect, inhibition of antigen-binding molecule binding to CD137 can also be determined in the presence of CD3 while CD137 is immobilized.
- binding is at least 50%, preferably 60% or more, preferably 70% or more, more preferably 80% or more, more preferably 90% or more when any one of the above two aspects is performed; Or even more preferably, if it is inhibited by 95% or more, it is determined that the antigen-binding molecule of the present disclosure does not bind to CD3 and CD137 at the same time.
- the concentration of antigen injected as an analyte is at least 1-fold, 2-fold, 5-fold, 10-fold, 30-fold, 50-fold, or 100-fold higher than the concentration of other antigens to be immobilized. twice as expensive.
- the concentration of antigen injected as analyte is 100-fold higher than the concentration of other immobilized antigens and binding is inhibited by at least 80%.
- the ratio of the KD value for the CD3 (analyte) binding activity of the antigen-binding molecule to the KD value for the CD137 (immobilized) binding activity of the antigen-binding molecule is Calculate CD3 (analyte) concentrations that are 10-fold, 50-fold, 100-fold, or 200-fold higher in the ratio of KD values (KD(CD3)/KD(CD137)) than the CD137 (immobilized) concentrations above. can be used for competition measurement of (For example, if the ratio of KD values is 0.1, then 1-, 5-, 10-, or 20-fold higher concentrations can be chosen. In addition, if the ratio of KD values is 10, 100-fold , 500-fold, 1000-fold, or 2000-fold higher concentrations can be chosen.)
- Attenuation of the binding signal of the antigen-binding molecule to CD3 is determined by methods known in the prior art (i.e., ELISA, ECL, etc.). can be determined in the presence of antigens such as CD137.
- the attenuation of the binding signal of an antigen-binding molecule to CD137 can also be determined in the presence of CD3 while immobilizing CD137.
- the binding signal is at least 50%, preferably 60% or more, preferably 70% or more, more preferably 80% or more, more preferably 90% or more. , or even more preferably attenuated by 95% or more, the antigen-binding molecule of the present disclosure is determined not to bind to CD3 and CD137 simultaneously.
- the concentration of antigen injected as an analyte is at least 1-fold, 2-fold, 5-fold, 10-fold, 30-fold, 50-fold, or 100-fold higher than the concentration of other antigens to be immobilized. twice as expensive.
- the concentration of antigen injected as analyte is 100-fold higher than the concentration of other immobilized antigens and binding is inhibited by at least 80%.
- the ratio of the KD value for the CD3 (analyte) binding activity of the antigen-binding molecule to the KD value for the CD137 (immobilized) binding activity of the antigen-binding molecule is Calculate CD3 (analyte) concentrations that are 10-fold, 50-fold, 100-fold, or 200-fold higher in the ratio of KD values (KD(CD3)/KD(CD137)) than the CD137 (immobilized) concentrations above. can be used for the measurement of (For example, if the ratio of KD values is 0.1, then 1-, 5-, 10-, or 20-fold higher concentrations can be chosen. In addition, if the ratio of KD values is 10, 100-fold , 500-fold, 1000-fold, or 2000-fold higher concentrations can be chosen.)
- a biotin-labeled test antigen-binding molecule, sulfo-tag (Ru complex)-labeled CD3, and unlabeled CD137 are prepared. If the test antigen-binding molecule can bind to CD3 and CD137 and binds either CD3 or CD137, adding a mixture of the test antigen-binding molecule and labeled CD3 onto a streptavidin-immobilized plate; and subsequent luminescence detect the luminescent signal of the sulfo-tag in the absence of unlabeled CD137. In contrast, the luminescence signal is reduced in the presence of unlabeled CD137. This decrease in luminescence signal can be quantified to determine relative binding activity. This analysis can be performed similarly with labeled CD137 and unlabeled CD3.
- the test antigen-binding molecule interacts with CD3 in the absence of competing CD137 to generate a signal at 520-620 nm.
- Untagged CD137 competes with CD3 for interaction with the test antigen binding molecule.
- the decrease in fluorescence caused as a result of competition can be quantified, thereby determining relative avidity.
- Biotinylation of polypeptides, such as with sulfo-NHS-biotin is known in the art. e.g., fusing in-frame a polynucleotide encoding CD3 and a polynucleotide encoding GST; CD3 can be tagged with GST by any suitable method, including purification using a glutathione column.
- the signals obtained are preferably analyzed, for example, using the software GRAPHPAD PRISM (GraphPad Software, Inc., San Diego) fitted to a one-site competition model based on non-linear regression analysis. This analysis can be similarly analyzed with tagged CD137 and untagged CD3.
- GRAPHPAD PRISM GraphPad Software, Inc., San Diego
- FRET fluorescence resonance energy transfer
- FRET is a phenomenon in which excitation energy is directly transferred between two fluorescent molecules located in close proximity to each other by electronic resonance.
- the excitation energy of the donor a fluorescent molecule with an excited state
- the acceptor another fluorescent molecule located near the donor
- fluorescence emitted by the donor is quenched (more precisely , fluorescence lifetime is shortened), and fluorescence is emitted from the acceptor instead.
- This phenomenon can be used to analyze whether CD3 and CD137 are simultaneously bound.
- CD3 with a fluorescent donor and CD137 with a fluorescent acceptor bind simultaneously to a test antigen-binding molecule
- fluorescence of the donor is quenched while fluorescence is emitted from the acceptor. Therefore, a change in fluorescence wavelength is observed.
- Such antibodies are confirmed to bind CD3 and CD137 simultaneously.
- the test antigen-binding molecule can bind to CD3 and CD137, CD3 or It can be considered an antigen binding domain that binds to any of CD137.
- test antigen-binding molecules are bound to streptavidin on donor beads, while glutathione S-transferase (GST)-tagged CD3 is bound to acceptor beads.
- GST glutathione S-transferase
- a test antigen-binding molecule interacts with CD3 in the absence of a competing second antigen to generate a signal at 520-620 nm.
- a second untagged antigen competes with CD3 for interaction with the test antigen-binding molecule.
- the decrease in fluorescence caused as a result of competition can be quantified, thereby determining relative avidity.
- Biotinylation of polypeptides such as with sulfo-NHS-biotin, is known in the art.
- CD3 can be tagged with GST by any suitable method, including purification using a glutathione column.
- the signals obtained are preferably analyzed, for example, using the software GRAPHPAD PRISM (GraphPad Software, Inc., San Diego) adapted to a one-site competition model based on nonlinear regression analysis.
- GRAPHPAD PRISM GraphPad Software, Inc., San Diego
- Tagging is not limited to GST tagging and may be performed with any tag, including but not limited to histidine tag, MBP, CBP, Flag tag, HA tag, V5 tag, c-myc tag, etc. .
- Binding of test antigen-binding molecules to donor beads is not limited to binding using the biotin-streptavidin reaction.
- possible methods include binding the test antigen-binding molecule via an Fc-recognizing protein such as protein A or protein G on donor beads.
- a test antigen-binding molecule that has been confirmed to be positive in an ECL-ELISA for detecting simultaneous binding to CD3 and CD137 is also mixed with cells expressing CD3 and cells expressing CD137.
- a test antigen-binding molecule can be shown to be unable to bind simultaneously to CD3 and CD137 expressed on different cells unless the antigen-binding molecule and these cells bind to each other simultaneously.
- This assay can be performed, for example, by cell-based ECL-ELISA. Cells expressing CD3 are previously immobilized on plates. Cells expressing CD137 are added to the plate after the test antigen-binding molecule has bound to it.
- this assay may be performed by the ALPHAScreen method.
- a test antigen-binding molecule is mixed with cells expressing CD3 bound to donor beads and cells expressing CD137 bound to acceptor beads.
- a signal is observed when an antigen-binding molecule simultaneously binds two antigens expressed on two cells, respectively. If the antigen-binding molecule does not bind these antigens simultaneously, no signal is observed.
- this assay may be performed by the Octet interaction analysis method.
- cells expressing peptide-tagged CD3 are bound to a biosensor that recognizes the peptide tag.
- Cells expressing CD137 and a test antigen binding molecule are placed in wells and analyzed for interaction.
- an antigen-binding molecule simultaneously binds two antigens expressed on two cells each, a large wavelength shift caused by binding of the test antigen-binding molecule and cells expressing CD137 to the biosensor is observed. be. If the antigen-binding molecule does not bind to these antigens simultaneously, a small wavelength shift is observed caused by the binding of only the test antigen-binding molecule to the biosensor.
- assays based on biological activity may be performed.
- cells expressing CD3 and cells expressing CD137 are mixed with a test antigen-binding molecule and cultured.
- Two antigens each expressed on two cells are mutually activated via the test antigen-binding molecule when the antigen-binding molecule binds to these two antigens simultaneously.
- changes in activation signals such as increased levels of phosphorylation downstream of each of the antigens, can be detected.
- cytokine production is induced as a result of activation. Therefore, the amount of cytokine produced can be measured, thereby confirming whether it binds to two cells at the same time.
- cytotoxic activity against cells expressing CD137 is induced as a result of activation.
- reporter gene expression is induced by a promoter that is activated downstream of the CD137 or CD3 signaling pathway as a result of activation. Therefore, the cytotoxic activity or the amount of reporter protein produced can be measured, thereby confirming whether it binds to two cells simultaneously.
- Multispecific antigen binding molecules contained in anti-cancer agents, pharmaceutical compositions, combinations, kits of the present disclosure, or used in methods or uses of the present disclosure are capable of binding CD3 and CD137 simultaneously. (i.e., does not bind to CD3 and CD137 at the same time), so simultaneous binding to CD3 and/or CD137 expressed on different immune cells (e.g., T cells) by the same antigen-binding molecule does not occur; thereby responsible for adverse reactions when administered in vivo with conventional multispecific antigen-binding molecules that can simultaneously bind CD3 and a second molecule (e.g., CD137) expressed on T cells. Toxicity due to unwanted cross-linking between possible different immune cells is avoided.
- Toxicity when a multispecific antigen-binding molecule is administered in vivo can be measured by cytokine production and the like.
- Low toxicity refers to the absence of induction of immune activation, such as production of CLDN6-independent cytokines, when compared to a control multispecific antibody.
- Fab Molecules A "Fab molecule” refers to a protein consisting of the VH and CH1 domains of an immunoglobulin heavy chain (“Fab heavy chain”) and the VL and CL domains of the light chain (“Fab light chain”).
- Fused means that the components (e.g., the Fab molecule and the Fc domain subunit) are joined by a peptide bond, either directly or via one or more peptide linkers. do.
- Crossover Fab molecule refers to a Fab molecule in which either the variable or constant regions of the Fab heavy and Fab light chains have been exchanged, i.e. a crossover Fab molecule is , peptide chains composed of light chain variable regions and heavy chain constant regions, and peptide chains composed of heavy chain variable regions and light chain constant regions.
- a crossover Fab molecule is , peptide chains composed of light chain variable regions and heavy chain constant regions, and peptide chains composed of heavy chain variable regions and light chain constant regions.
- the peptide chain comprising the heavy chain constant region is referred to herein as the crossover Fab molecule "called the "heavy chain”.
- the peptide chain comprising the heavy chain variable region is referred to herein as the "heavy chain" of the crossover Fab molecule.
- Fab “Traditional” Fab
- a “traditional” Fab molecule is a Fab molecule in its native form, i.e., a heavy chain (VH-CH1) made up of the variable and constant regions of the heavy chain, and the variable and constant regions of the light chain.
- VH-CH1 a heavy chain
- VL-CL variable and constant regions of the light chain
- immunoglobulin molecule refers to a protein having the structure of a naturally occurring antibody.
- the IgG class of immunoglobulins is a heterotetrameric glycoprotein of approximately 150,000 daltons composed of two light and two heavy chains linked by disulfide bonds.
- Each heavy chain consists, from N-terminus to C-terminus, a variable region (VH), also called a variable heavy domain or heavy chain variable domain, followed by three constant domains (CH1, CH2, and CH3).
- each light chain has, from N-terminus to C-terminus, a variable region (VL), also called a variable light domain or light chain variable domain, followed by a constant light chain (CL) domain, also called a light chain constant region.
- VH variable region
- VL variable light domain
- CL constant light chain
- the heavy chains of immunoglobulins may be assigned to one of five types, called ⁇ (IgA), ⁇ (IgD), ⁇ (IgE), ⁇ (IgG), or ⁇ (IgM).
- immunoglobulins can be assigned to one of two types, called kappa and lambda, based on the amino acid sequences of their constant domains.
- Immunoglobulins consist essentially of two Fab molecules and an Fc domain, linked through an immunoglobulin hinge region.
- binding affinity is the total strength of non-covalent interactions between one binding site of a molecule (e.g. antigen-binding molecule or antibody) and its binding partner (e.g. antigen) point to Unless otherwise indicated, "binding affinity” as used herein reflects the 1:1 interaction between members of a binding pair (e.g., antigen-binding molecule and antigen, or antibody and antigen). refers to the binding affinity of The affinity of molecule X for its partner Y can generally be expressed by the dissociation constant (KD), which is the ratio of the dissociation rate constant and the association rate constant (koff and kon, respectively). Thus, equivalent affinities may involve different rate constants, as long as the ratio of rate constants remains the same. Affinity can be measured by established methods known in the art, including those described herein. A specific method for measuring affinity is surface plasmon resonance (SPR).
- SPR surface plasmon resonance
- antigen-binding molecules or antibodies provided herein are ⁇ 1 ⁇ M, ⁇ 120 nM, ⁇ 100 nM, ⁇ 80 nM, ⁇ 70 nM, ⁇ 50 nM, ⁇ 50 nM, ⁇ 1 ⁇ M, ⁇ 120 nM, ⁇ 100 nM, ⁇ 80 nM, ⁇ 70 nM, ⁇ 50 nM, 40 nM, ⁇ 30 nM, ⁇ 20 nM, ⁇ 10 nM, ⁇ 2 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM or ⁇ 0.001 nM (e.g., 10 -8 M or less, 10 -8 M to 10 -13 M, 10 -9 M ⁇ 10 -13 M) dissociation constant (KD).
- KD dissociation constant
- the KD value of the antibody/antigen binding molecule for CD3, CD137, or CLDN6 is 1-40, 1-50, 1-70, 1-80, 30-50, 30-70, 30-80 , 40-70, 40-80, or 60-80 nM.
- KD is measured by a radiolabeled antigen binding assay (RIA).
- the RIA is performed using the Fab version of the antibody of interest and its antigen.
- the in-solution binding affinity of a Fab for an antigen can be determined by equilibrating the Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of an increasing dose series of unlabeled antigen and then coating the bound antigen with an anti-Fab antibody. measured by trapping with a plate that has been (See, eg, Chen et al., J. Mol. Biol. 293:865-881 (1999)).
- the Fab of interest is then incubated overnight, although this incubation can be continued for a longer time (eg, about 65 hours) to ensure equilibrium is reached.
- the mixture is then transferred to a capture plate for incubation (eg, 1 hour) at room temperature.
- the solution is then removed and the plate washed 8 times with 0.1% polysorbate 20 (TWEEN-20®) in PBS. Once the plates are dry, 150 ⁇ l/well scintillant (MICROSCINT-20TM, Packard) is added and the plates are counted for 10 minutes in a TOPCOUNTTM gamma counter (Packard). Concentrations of each Fab that give 20% or less of maximal binding are selected for use in competitive binding assays.
- the Kd is measured using a BIACORE® surface plasmon resonance assay.
- assays using the BIACORE®-2000 or BIACORE®-3000 (BIAcore, Inc., Piscataway, NJ) measured approximately 10 response units (RU) of antigen-immobilized CM5 It is carried out at 25° C. with chips.
- a carboxymethylated dextran biosensor chip (CM5, BIACORE, Inc.) is combined with N-ethyl-N'-(3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N -activated with hydroxysuccinimide (NHS).
- Antigen was diluted to 5 ⁇ g/ml (approximately 0.2 ⁇ M) with 10 mM sodium acetate, pH 4.8, before injection at a flow rate of 5 ⁇ l/min to achieve approximately 10 response units (RU) of protein binding. diluted. After injection of antigen, 1M ethanolamine is injected to block unreacted groups. For kinetic measurements, two-fold serial dilutions of Fabs (0.78 nM ⁇ 500 nM) is injected. The association rate (k on ) and dissociation rate (k off ) were determined by simultaneously fitting the association and dissociation sensorgrams using a simple one-to-one Langmuir binding model (BIACORE® evaluation software version 3.2). Calculated.
- a spectrometer e.g., a stopped-flow spectrophotometer (Aviv Instruments) or an 8000 series SLM-1 using a stirred cuvette.
- antibody is used in the broadest sense and includes, but is not limited to, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., , bispecific antibodies, tribodies) and antibody fragments.
- the multispecific antibodies described herein bind to epitopes of CD3, CD137, or CLDN6 that are conserved among CD3, CD137, or CLDN6 of different species.
- multispecific antibodies of the present disclosure are trispecific antibodies, antibodies capable of specifically binding three different antigens.
- the multispecific antibodies of the present disclosure are capable of binding CD3 and CD137, and bind either CD3 or CD137, i.e., do not bind both CD3 and CD137 antigens simultaneously. It is a trispecific antibody that is capable of binding specifically to CLDN6.
- Class of Antibody refers to the type of constant domain or constant region provided by the heavy chains of the antibody.
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- amino acid residues in the light chain constant region are numbered herein according to Kabat et al.
- amino acid residue numbering in the heavy chain constant region is according to Kabat et al., Sequences of Proteins of Immunological Interest. According to the EU numbering system, also called the EU Index, as described in , 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
- Framework “Framework” or “FR” refers to variable domain residues other than hypervariable region (HVR) residues.
- the FRs of variable domains usually consist of four FR domains: FR1, FR2, FR3 and FR4. Accordingly, HVR and FR sequences usually appear in VH (or VL) in the following order: FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
- Human Consensus Framework A "human consensus framework" is a framework that represents the most commonly occurring amino acid residues in a selected group of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Typically, the subgroup of sequences is the subgroup in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3. In one embodiment, for VL, the subgroup is subgroup ⁇ I according to Kabat et al., supra. In one embodiment, for VH, the subgroup is subgroup III according to Kabat et al., supra.
- Chimeric antibodies refer to antibodies in which a portion of the heavy and/or light chains are derived from a particular source or species, while the remainder of the heavy and/or light chains are derived from a different source or species. It refers to the antibody from which it originated.
- chimeric antibody variable domain means that a portion of the heavy and/or light chain variable region is derived from a particular source or species while the remaining portion of the heavy and/or light chain variable region is Refers to antibody variable regions that are derived from different sources or species.
- a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody comprises substantially all of at least one, typically two, variable domains in which all or substantially all HVRs (e.g., CDRs) are non- Corresponds to that of a human antibody, and all or substantially all FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody eg, a non-human antibody refers to an antibody that has undergone humanization.
- a “humanized antibody variable region” refers to the variable region of a humanized antibody.
- human antibody is an antibody with amino acid sequences that correspond to those of an antibody produced by a human or human cells or derived from a human antibody repertoire or other non-human source using human antibody coding sequences. be. This definition of human antibody specifically excludes humanized antibodies that contain non-human antigen-binding residues.
- human antibody variable region refers to the variable region of a human antibody.
- Polynucleotide refers to polymers of nucleotides of any length, and include DNA and RNA.
- Nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or analogs thereof, or any substance that can be incorporated into a polymer by a DNA or RNA polymerase or by a synthetic reaction.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may contain modifications made after synthesis, such as conjugation to a label.
- modifications include, e.g., "caps", substitutions of one or more naturally occurring nucleotides with analogues, internucleotide modifications, e.g., uncharged linkages (e.g., methylphosphonates, phosphotriesters, phosphoramidates, , carbamates, etc.) and charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), including pendant moieties such as proteins (e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.).
- proteins e.g., nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.
- intercalating agents e.g., acridine, psoralen, etc.
- chelating agents e.g., metals, radiometals, boron, metal oxides, etc.
- alkylating agents e.g., modified linkages (e.g., alpha anomeric nucleic acids) and those with unmodified forms of polynucleotides.
- any hydroxyl group normally present on sugars can be replaced by, for example, a phosphonate group, a phosphate group, protected by standard protecting groups, or activated to generate additional linkages to additional nucleotides. , or conjugated to a solid or semi-solid support.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of 1-20 carbon atoms. Other hydroxyls can also be derivatized to standard protecting groups.
- Polynucleotides may also contain analogous forms of ribose or deoxyribose sugars commonly known in the art, including, for example: 2'-O-methyl-, 2'-O-allyl-, 2'-fluoro-, or 2'-azido-ribose, carbocyclic sugar analogues, ⁇ -anomeric sugars, epimeric sugars such as arabinose or xylose or lyxose, pyranose sugars, furanose sugars, sedoheptulose, acyclic analogues, and methylriboside Basic nucleoside analogues such as.
- One or more phosphodiester bonds may be replaced by alternative linking groups.
- alternative linking groups include, but are not limited to, embodiments in which the phosphate is replaced by: P(O)S (“thioate”), P(S)S (“ dithioate”), (O) NR2 ("amidate"), P(O)R, P(O)OR', CO, or CH2 ("formacetal"), where each R or R' is independently is H, or substituted or unsubstituted alkyl (1-20C), optionally with ether (--O--) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl, or araldyl. Not all linkages in a polynucleotide need be identical. The above description applies to all polynucleotides referred to herein, including RNA and DNA.
- nucleic acid An "isolated" nucleic acid molecule refers to one that is separated from a component of its original environment.
- An isolated nucleic acid molecule further includes a nucleic acid molecule contained within cells that normally contain the nucleic acid molecule, but the nucleic acid molecule is located extrachromosomally or in a different chromosome than its natural chromosomal location. present in the upper position.
- Vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it has been linked.
- the term includes vectors as self-replicating nucleic acid structures and vectors that integrate into the genome of a host cell into which they are introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operably linked.
- Such vectors are also referred to herein as "expression vectors”.
- Vectors can be introduced into host cells using viruses or electroporation. However, vector introduction is not limited to in vitro methods. For example, vectors can be introduced directly into a subject using in vivo methods.
- host cell refers to cells (including progeny of such cells) into which exogenous nucleic acid has been introduced.
- a host cell includes “transformants” and “transformed cells,” including the primary transformed cell and progeny derived therefrom at any passage number. Progeny may not be completely identical in nucleic acid content to the parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as with which the originally transformed cell was screened or selected are also included herein.
- Specific means that a molecule that specifically binds to one or more binding partners does not show any significant binding to molecules other than said partner. Furthermore, “specific” is also used when the antigen-binding site is specific for a particular epitope among multiple epitopes contained in the antigen. When an antigen-binding molecule specifically binds to an antigen, it is also described as “the antigen-binding molecule has/exhibits specificity for/for an antigen.” When the epitope to which the antigen-binding site binds is contained in multiple different antigens, the antigen-binding molecule containing the antigen-binding site can bind to various antigens having the epitope.
- antibody fragment refers to a molecule other than an intact antibody that contains a portion of the intact antibody that binds to the antigen to which the intact antibody binds.
- antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab')2, diabodies, linear antibodies, single chain antibody molecules (e.g. scFv ), and single domain antibodies.
- scFv single chain antibody molecules
- Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific.
- Single domain antibodies are antibody fragments that contain all or part of the heavy chain variable domain or all or part of the light chain variable domain of an antibody.
- the single domain antibody is a human single domain antibody (Domantis, Inc., Waltham, Mass.; see, eg, US Pat. No. 6,248,516 B1).
- Antibody fragments are produced by a variety of techniques, including, but not limited to, proteolytic digestion of intact antibodies, production by recombinant host cells (e.g., E. coli or phage), as described herein. be able to.
- variable fragment (Fv) refers to the minimum unit of an antibody-derived antigen-binding site composed of a pair of an antibody light chain variable region (VL) and an antibody heavy chain variable region (VH).
- VL antibody light chain variable region
- VH antibody heavy chain variable region
- single-chain antibodies As used herein, the terms “scFv,” “single-chain antibody,” and “sc(Fv) 2 ” all refer to a single antibody comprising variable regions from heavy and light chains, but no constant region. Refers to an antibody fragment of a polypeptide chain.
- single-chain antibodies further comprise a polypeptide linker between the VH and VL domains that enables formation of the desired structure likely to permit antigen binding.
- Single-chain antibodies are discussed in detail by Pluckthun in The Pharmacology of Monoclonal Antibodies, Vol. 113, Rosenburg and Moore, eds., Springer-Verlag, New York, 269-315 (1994). See also International Publication WO1988/001649, US Pat. Nos. 4,946,778 and 5,260,203.
- single-chain antibodies can be bispecific and/or humanized.
- scFv is a single chain low molecular weight antibody in which VH and VL forming an Fv are linked together by a peptide linker (Proc. Natl. Acad. Sci. USA (1988) 85 (16), 5879-5883). The peptide linker can hold VH and VL in close proximity.
- sc(Fv) 2 is a single-chain antibody in which four variable regions of two VL and two VH are linked by a linker such as a peptide linker to form a single chain (J Immunol. Methods (1999) 231 (1 -2), 177-189). The two VHs and the two VLs may be derived from different monoclonal antibodies.
- Such sc(Fv) 2 include, for example, bispecific sc(Fv) 2s that recognize two epitopes present in a single antigen, as disclosed in Journal of Immunology (1994) 152 (11), 5368-5374.
- a preferred example is sc(Fv) 2 .
- sc(Fv) 2 can be produced by methods known to those skilled in the art. For example, sc(Fv) 2 can be produced by linking scFvs with a linker such as a peptide linker.
- sc(Fv) 2 is VH, VL, VH, VL ([VH]-linker-[VL]-linker-[VH]-linker-[ VL]) containing 2 VH units and 2 VL units in sequence.
- the order of the two VH units and the two VL units is not limited to the configuration described above, and may be arranged in any order. Examples of configurations are listed below.
- sc(Fv) 2 The molecular form of sc(Fv) 2 is also described in detail in WO2006/132352. Those skilled in the art can appropriately prepare the desired sc(Fv) 2 for producing the polypeptide complexes disclosed herein according to these descriptions.
- the antigen-binding molecule or antibody of the present disclosure may be conjugated with a carrier polymer such as PEG or an organic compound such as an anticancer agent.
- glycosylation sequences are suitably inserted into the antigen-binding molecule or antibody such that the sugar chain produces the desired effect.
- Linkers used to join antibody variable regions include any peptide linker that can be introduced by genetic engineering, synthetic linkers, and linkers disclosed, for example, in Protein Engineering, 9 (3), 299-305, 1996. However, peptide linkers are preferred in the present disclosure.
- the length of the peptide linker is not particularly limited, and can be appropriately selected by those skilled in the art depending on the purpose. The length is preferably 5 amino acids or more (although not particularly limited, the upper limit is usually 30 amino acids or less, preferably 20 amino acids or less), particularly preferably 15 amino acids.
- sc(Fv) 2 contains three peptide linkers, they may all be the same or different in length.
- such peptide linkers include: Ser, Gly-Ser, Gly-Gly-Ser, Ser-Gly-Gly, Gly-Gly-Gly-Ser (SEQ ID NO: 171), Ser-Gly-Gly-Gly (SEQ ID NO: 172), Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 173), Ser-Gly-Gly-Gly-Gly (SEQ ID NO: 174), Gly-Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 175), Ser-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 176), Gly-Gly-Gly-Gly-Gly-Gly-Ser (SEQ ID NO: 177), Ser-Gly-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 178), (Gly-Gly-Gly-Gly-Gly-Gly-Gly (SEQ ID NO: 173)
- Synthetic linkers are commonly used to cross-link peptides, examples include N-hydroxysuccinimide (NHS), disuccinimidyl suberate (DSS), bis(sulfosuccinimidyl) suberate (BS3), dithiobis (succinimidyl propionate) (DSP), dithiobis (sulfosuccinimidyl propionate) (DTSSP), ethylene glycol bis (succinimidyl succinate) (EGS), ethylene glycol Bis(sulfosuccinimidyl succinate) (sulfo-EGS), disuccinimidyl tartrate (DST), disulfosuccinimidyl tartrate (sulfo-DST), bis[2-(succinimidoxycarbonyloxy) ethyl]sulfone (BSOCOES), and bis[2-(sulfosuccinimidoxycarbonyloxy)ethyl]sulfone
- linkers are usually required to link four antibody variable regions.
- the linkers used may be of the same type or of different types.
- Fab fragment antigen binding protein
- F(ab') 2 fragment antigen binding protein
- Fab' A "Fab” consists of one light chain and the CH1 domain and variable region of one heavy chain.
- the heavy chain of a Fab molecule cannot form disulfide bonds with another heavy chain molecule.
- F(ab') 2 " or "Fab” is produced by treating immunoglobulin (monoclonal antibody) with proteases such as pepsin and papain, and immunoglobulin (monoclonal antibody) is attached to each of the two H-chain hinges. Refers to antibody fragments produced by digestion near the disulfide bonds that exist between regions.
- papain cleaves IgG upstream of the disulfide bond that exists between the hinge region of each of the two H chains, resulting in the formation of an L chain containing VL (L chain variable region) and CL (L chain constant region) at VH ( H chain fragments containing CH ⁇ 1 ( ⁇ 1 region in H chain constant region) and CH ⁇ 1 ( ⁇ 1 region in H chain constant region) and two homologous antibody fragments linked at their C-terminal regions by disulfide bonds are generated. Each of these two homologous antibody fragments is called Fab'.
- F(ab′) 2 is composed of two light chains and two heavy chains comprising the constant regions of the CH1 and partial CH2 domains such that disulfide bonds are formed between the two heavy chains.
- F(ab') 2 disclosed herein can be suitably produced as follows. A whole monoclonal antibody or the like containing the desired antigen-binding site is partially digested with a protease such as pepsin, and the Fc fragment is removed by adsorption to a protein A column.
- the protease is not particularly limited as long as it can selectively cleave all antibodies to F(ab') 2 under appropriately set enzymatic reaction conditions such as pH.
- proteases include pepsin and ficin.
- Fc region refers to the region in an antibody molecule that includes the hinge or a portion thereof and fragments consisting of the CH2 and CH3 domains.
- the Fc region of the IgG class means, for example, the region from cysteine 226 (EU numbering (also referred to herein as the EU index)) to the C-terminus or from proline 230 (EU numbering) to the C-terminus, but not limited to.
- IgG1, IgG2, IgG3, or IgG4 monoclonal antibody is partially digested with a proteolytic enzyme such as pepsin, and the fraction adsorbed to a protein A column or protein G column is re-eluted.
- a proteolytic enzyme such as pepsin
- pepsin a proteolytic enzyme capable of digesting full-length antibodies to form Fab or F(ab') 2 in a restrictive manner under appropriately set enzyme reaction conditions (e.g., pH). It is not particularly limited. Examples may include pepsin and papain.
- an Fc region derived from native IgG can be used as the "Fc region" of the present disclosure.
- native IgG refers to a polypeptide that contains the same amino acid sequence as naturally occurring IgG and belongs to the class of antibodies substantially encoded by immunoglobulin gamma genes.
- Native human IgG means, for example, native human IgG1, native human IgG2, native human IgG3, or native human IgG4.
- Native IgG also includes variants etc. naturally derived therefrom.
- human IgG1 sequence may have DEL or EEM as the amino acid sequence from EU numbering positions 356-358.
- the Fc domain of the multispecific antigen binding molecule consists of a pair of polypeptide chains comprising the heavy chain domain of an immunoglobulin molecule.
- the Fc domain of immunoglobulin G (IgG) molecules is a dimer, each subunit of which contains CH2 and CH3 IgG heavy chain constant domains. The two subunits of the Fc domain can stably associate with each other.
- the multispecific antigen binding molecules described herein comprise no more than one Fc domain.
- the Fc domain of the multispecific antigen binding molecule is an IgG Fc domain. In certain embodiments, the Fc domain is an IgG1 Fc domain. In another embodiment, the Fc domain is an IgG1 Fc domain. In a further specific embodiment, the Fc domain is a human IgG1 Fc region.
- a multispecific antigen binding molecule comprised in an anti-cancer agent, pharmaceutical composition, combination, kit of the disclosure, or used in a method or use of the disclosure comprises (iii) a multispecific antigen-binding molecule further comprising an Fc domain that exhibits reduced binding affinity for human Fc ⁇ receptors compared to a native human IgG1 Fc domain, wherein the Fc domains are stably associated It is composed of a first Fc region subunit and a second Fc region subunit that can be
- the anticancer agent, pharmaceutical composition, combination, kit, method, or use of the present disclosure uses a chemotherapeutic agent in combination with the aforementioned multispecific antigen-binding molecule.
- a platinum agent and a multispecific antigen binding molecule as described above are used in combination.
- carboplatin or cisplatin is used in combination with the aforementioned multispecific antigen binding molecules.
- the anticancer agent, pharmaceutical composition, combination, kit, method, or use of the present disclosure uses an immune checkpoint inhibitor in combination with the aforementioned multispecific antigen-binding molecule.
- an anti-PD-L1 antibody and a multispecific antigen-binding molecule as described above are used in combination.
- the anticancer agent, pharmaceutical composition, combination, kit, method, or use of the present disclosure uses a PARP inhibitor in combination with a multispecific antigen-binding molecule as described above.
- olaparip is used in combination with a multispecific antigen-binding molecule as described above.
- an Fc region with reduced Fc receptor (Fc ⁇ receptor) binding activity the Fc domain of the multispecific antigen binding molecules described herein has an Fc Shows reduced binding affinity for the receptor.
- the Fc domain (or multispecific antigen-binding molecule comprising said Fc domain) is compared to a native IgG1 Fc domain (or multispecific antigen-binding molecule comprising a native IgG1 Fc domain). and exhibit a binding affinity for Fc receptors of less than 50%, preferably less than 20%, more preferably less than 10%, and most preferably less than 5%.
- the Fc domain (or multispecific antigen binding molecule comprising said Fc domain) does not substantially bind to an Fc receptor.
- the Fc receptor is an Fc ⁇ receptor. In one embodiment, the Fc receptor is a human Fc receptor. In one embodiment, the Fc receptor is an activated Fc receptor. In certain embodiments, the Fc receptor is an activating human Fc ⁇ receptor, more specifically human Fc ⁇ RIIIa, Fc ⁇ RI, or Fc ⁇ RIIa, most specifically human Fc ⁇ RIIIa.
- the Fc domain of the multispecific antigen-binding molecule comprises one or more amino acid mutations that reduce the binding affinity of the Fc domain for Fc receptors. Typically the same one or more amino acid mutations are present in each of the two subunits of the Fc domain. In one embodiment, the amino acid mutation reduces the binding affinity of the Fc domain for Fc receptors. In one embodiment, the amino acid mutation reduces the binding affinity of the Fc domain for an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
- a multispecific antigen binding molecule comprising an engineered Fc domain is less than 20%, particularly less than 10%, compared to a multispecific antigen binding molecule comprising a non-engineered Fc domain , more particularly exhibiting a binding affinity for Fc receptors of less than 5%.
- the Fc receptor is an Fc ⁇ receptor. In some embodiments, the Fc receptor is a human Fc receptor.
- the Fc receptor is an activated Fc receptor.
- the Fc receptor is an activated human Fc ⁇ receptor, more specifically human Fc ⁇ RIIIa, Fc ⁇ RI, or Fc ⁇ RIIa, most specifically human Fc ⁇ RIIIa. Preferably, binding to each of these receptors is reduced.
- the amino acid mutation that reduces the binding affinity of the Fc domain for Fc receptors is an amino acid substitution.
- the Fc domain comprises amino acid substitutions at positions selected from the group E233, L234, L235, N297, P331, and P329.
- the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329.
- the Fc domain comprises amino acid substitutions L234A and L235A.
- the Fc domain is an IgG1 Fc domain, particularly a human IgG1 Fc domain.
- the Fc domain comprises an amino acid substitution at position P329.
- the amino acid substitution is P329A or P329G, especially P329G.
- the Fc domain comprises an amino acid substitution at position P329 and additional amino acid substitutions at positions selected from E233, L234, L235, N297 and P331.
- the additional amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D, or P331S.
- the Fc domain comprises amino acid substitutions at positions P329, L234 and L235.
- the Fc domain comprises amino acid mutations L234A, L235A and P329G (“P329G LALA”).
- the Fc domain is an IgG1 Fc domain, particularly a human IgG1 Fc domain.
- the "P329G LALA" combination of amino acid substitutions almost completely abolishes Fc ⁇ receptor (as well as complement) binding of the human IgG1 Fc domain, as described in PCT Publication No. WO2012/130831.
- WO2012/130831 also describes methods for preparing such mutant Fc domains and methods for determining their properties such as Fc receptor binding or effector function.
- the Fc domain of the T cell-activating bispecific antigen binding molecules described herein is an IgG4 Fc domain, particularly a human IgG4 Fc domain.
- the IgG4 Fc domain comprises an amino acid substitution at position S228, particularly the amino acid substitution S228P.
- the IgG4 Fc domain comprises an amino acid substitution at position L235, in particular the amino acid substitution L235E.
- the IgG4 Fc domain comprises an amino acid substitution at position P329, particularly amino acid substitution P329G.
- the IgG4 Fc domain comprises amino acid substitutions at positions S228, L235 and P329, in particular amino acid substitutions S228P, L235E and P329G.
- Such IgG4 Fc domain variants and their Fc ⁇ receptor binding properties are described in PCT Publication No. WO2012/130831.
- the Fc domain comprises an amino acid mutation at position N297, particularly an amino acid substitution that replaces asparagine with alanine (N297A) or aspartic acid (N297D).
- the Fc domain exhibiting reduced binding affinity for Fc receptors compared to the native IgG1 Fc domain is a human IgG1 Fc domain comprising amino acid substitutions L234A, L235A and N297A.
- Mutant Fc domains can be prepared by deletion, substitution, insertion, or modification of amino acids using genetic or chemical methods well known in the art. Genetic methods can include site-directed mutagenesis of coding DNA sequences, PCR, gene synthesis, and the like. Precise nucleotide changes can be verified, for example, by sequencing.
- Binding to Fc receptors can be readily determined, for example, by ELISA or by surface plasmon resonance (SPR) using standard instrumentation such as the BIAcore instrument (GE Healthcare), Fc receptors, etc. It may also be obtained by recombinant expression. Suitable such binding assays are described herein.
- the binding affinity of an Fc domain or of a cell-activating bispecific antigen binding molecule comprising an Fc domain to an Fc receptor can be determined using a cell line known to express a particular Fc receptor, such as Fc ⁇ . It can be evaluated using human NK cells that express IIIa receptors.
- Fc receptor refers to a receptor that binds to the Fc region of an antibody.
- the FcR is a native human FcR.
- the FcR is one that binds IgG antibodies (gamma receptors), and receptors of the Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII subclasses, allelic variants and alternatively spliced forms of these receptors.
- Fc ⁇ RII receptors include Fc ⁇ RIIA (an “activating receptor”) and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in their cytoplasmic domains.
- Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain.
- the inhibitory receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain.
- ITAM immunoreceptor tyrosine-based activation motif
- ITIM immunoreceptor tyrosine-based inhibition motif
- FcRs are, e.g., Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); al., Immunomethods 4:25-34 (1994); and de Haas et al., J. Lab. Clin. Med 126:330-41 (1995).
- Other FcRs including those identified in the future, are also encompassed by the term "FcR" herein.
- Fc receptor or “FcR” also refers to the transfer of maternal IgG to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)) as well as the neonatal receptor FcRn, which is responsible for regulating immunoglobulin homeostasis. Methods for measuring binding to FcRn are known (e.g., Ghetie and Ward., Immunol. Today 18(12):592-598 (1997); Ghetie et al., Nature Biotechnology, 15(7):637- 640 (1997); Hinton et al., J. Biol. Chem. 279(8):6213-6216 (2004); see WO2004/92219 (Hinton et al.)).
- Binding to human FcRn in vivo and plasma half-life of human FcRn high-affinity binding polypeptides have been evaluated, e.g., in transgenic mice or transfected human cell lines expressing human FcRn or polypeptides with variant Fc regions. can be measured in primates administered with WO2000/42072 (Presta) describes antibody variants with increased or decreased binding to FcRs. See also, e.g., Shields et al. J. Biol. Chem. 9(2):6591-6604 (2001).
- Fc ⁇ receptor Fc ⁇ receptor refers to a receptor that can bind to the Fc domain of an IgG1, IgG2, IgG3, or IgG4 monoclonal antibody, which includes all members of the family of proteins substantially encoded by the Fc ⁇ receptor gene.
- Fc ⁇ RI CD64
- Fc ⁇ RII CD32
- Fc ⁇ RIII CD16
- Fc ⁇ RIIIa including allotypes V158 and F158
- Fc ⁇ RIIIb including allotypes Fc ⁇ RIIIb-NA1 and Fc ⁇ RIIIb-NA2
- Fc ⁇ RIIIb including allotypes Fc ⁇ RIIIb-NA1 and Fc ⁇ RIIIb-NA2
- Fc ⁇ receptors are not limited to these examples.
- Fc ⁇ receptors include, but are not limited to, those derived from humans, mice, rats, rabbits, and monkeys.
- Fc ⁇ receptors may be derived from any organism.
- Mouse Fc ⁇ receptors include, but are not limited to, Fc ⁇ RI (CD64), Fc ⁇ RII (CD32), Fc ⁇ RIII (CD16), and Fc ⁇ RIII-2 (CD16-2), and unidentified mouse Fc ⁇ receptors, Fc ⁇ receptors All isoforms and their allotypes are included.
- Such preferred Fc ⁇ receptors include, for example, human Fc ⁇ RI (CD64), Fc ⁇ RIIA (CD32), Fc ⁇ RIIB (CD32), Fc ⁇ RIIIA (CD16), and/or Fc ⁇ RIIIB (CD16).
- the polynucleotide and amino acid sequences of Fc ⁇ RI are shown in RefSeq Accession No.
- NM_000566.3 and RefSeq Accession No. NP_000557.1 respectively;
- the polynucleotide and amino acid sequences of Fc ⁇ RIIB are shown in RefSeq Accession No. BC146678.1 and RefSeq Accession No. AAI46679.1, respectively;
- the polynucleotide and amino acid sequences of Fc ⁇ RIIIA are shown in RefSeq Accession No. BC033678, respectively. 1 and RefSeq Accession No. AAH33678.1;
- the polynucleotide and amino acid sequences of Fc ⁇ RIIIB are shown in RefSeq Accession No. BC128562.1 and RefSeq Accession No. AAI28563.1, respectively.
- an Fc ⁇ receptor has binding activity to the Fc domain of an IgG1, IgG2, IgG3, or IgG4 monoclonal antibody can be determined by the ALPHA screen (amplified luminescence proximity homogeneous assay), surface plasmon resonance ( SPR)-based BIACORE method, and others (Proc. Natl. Acad. Sci. USA (2006) 103 (11), 4005-4010).
- ALPHA screen amplified luminescence proximity homogeneous assay
- SPR surface plasmon resonance
- Fc ligand or “effector ligand”, on the other hand, refers to a molecule, and preferably a polypeptide, that binds to an antibody Fc domain to form an Fc/Fc ligand complex.
- the molecule may be derived from any organism. Binding of an Fc ligand to Fc preferably induces one or more effector functions.
- Fc ligands include Fc receptors, Fc ⁇ receptors, Fc ⁇ receptors, Fc ⁇ receptors, FcRn, C1q, and C3, mannan-binding lectins, mannose receptors, Staphylococcus protein A, Staphylococcus Examples include, but are not limited to, Coccus protein G, as well as viral Fc ⁇ receptors.
- Fc ligands also include the Fc receptor homologues (FcRH) (Davis et al., (2002) Immunological Reviews 190, 123-136), a family of Fc receptors that are homologous to the Fc ⁇ receptors.
- Fc ligands also include unidentified molecules that bind Fc.
- Fc ⁇ Receptor Binding Activity Impaired binding activity of the Fc domain to any of the Fc ⁇ receptors Fc ⁇ RI, Fc ⁇ RIIA, Fc ⁇ RIIB, Fc ⁇ RIIIA, and/or Fc ⁇ RIIIB is determined using the FACS and ELISA formats described above, as well as the ALPHA screen (amplified luminescence proximity homogeneous assay) and surface plasmon resonance (SPR)-based BIACORE method (Proc. Natl. Acad. Sci. USA (2006) 103 (11), 4005-4010).
- the ALPHA screen is performed by ALPHA technology based on the following principles, using two types of beads: donor beads and acceptor beads.
- a luminescent signal is detected only when the molecule linked to the donor bead biologically interacts with the molecule linked to the acceptor bead and the two beads are positioned in close proximity.
- a photosensitizer within the donor bead is excited by laser light to convert the oxygen surrounding the bead to excited singlet oxygen. Singlet oxygen diffuses around the donor bead and reaches the nearby acceptor bead, inducing a chemiluminescent reaction within the acceptor bead. This reaction ultimately emits light. If the molecule linked to the donor bead does not interact with the molecule linked to the acceptor bead, then the singlet oxygen generated by the donor bead will not reach the acceptor bead and no chemiluminescent reaction will occur.
- biotin-labeled antigen-binding molecules or antibodies are immobilized on donor beads, and Fc ⁇ receptors tagged with glutathione S transferase (GST) are immobilized on acceptor beads.
- GST glutathione S transferase
- the Fc ⁇ receptor interacts with an antigen-binding molecule or antibody comprising a wild-type Fc domain, resulting in the induction of a signal at 520-620 nm .
- Antigen-binding molecules or antibodies with untagged mutated Fc domains compete with antigen-binding molecules or antibodies containing wild-type Fc domains for interaction with Fc ⁇ receptors.
- a suitable method for adding a GST tag to an Fc ⁇ receptor involves fusing an Fc ⁇ receptor-encoding polypeptide and a GST-encoding polypeptide in-frame, and introducing a vector carrying the fusion gene. Methods involving expressing the gene using cells and then purifying using a glutathione column are included.
- the induced signal can preferably be analyzed by fitting a one-site competition model based on non-linear regression analysis, for example, using software such as GRAPHPAD PRISM (GraphPad; San Diego).
- One of the substances for observing the interaction is immobilized on the gold thin film of the sensor chip as a ligand.
- the other substance for observing interactions is injected onto the surface of the sensor chip as the analyte.
- the mass of the immobilized ligand molecule increases. This changes the refractive index of the solvent on the surface of the sensor chip. A change in refractive index causes a shift in the position of the SPR signal (conversely, dissociation shifts the signal back to its original position).
- the Biacore system plots the amount of this shift (i.e., the change in mass over the sensor chip surface) on the vertical axis, thus displaying the change in mass over time as measured data (sensorgram).
- Kinetic parameters association rate constant (ka) and dissociation rate constant (kd)
- KD affinity
- An inhibition assay is preferably used in the BIACORE method. Examples of such inhibition assays are described in Proc. Natl. Acad. Sci. USA (2006) 103(11), 4005-4010.
- the multispecific antigen binding molecule is an isolated multispecific antigen binding molecule.
- the multispecific antigen-binding molecules described herein are two different antigen-binding portions (e.g., the "first antigen-binding portion") fused to one or the other of the two subunits of the Fc domain. and a "second antigen-binding portion"), and thus the two subunits of an Fc domain are typically contained in two non-identical polypeptide chains. Recombinant co-expression and subsequent dimerization of these polypeptides opens up the possibility of multiple combinations of the two polypeptides. Therefore, in order to improve the yield and purity of multispecific antigen-binding molecules in recombinant production, it is advantageous to introduce modifications into the Fc domain of multispecific antigen-binding molecules that promote association of desired polypeptides. Become.
- the Fc domain of the multispecific antigen-binding molecules described herein comprises modifications that promote association of the first and second subunits of the Fc domain.
- the site of the most extensive protein-protein interaction between the two subunits of the human IgG Fc domain is within the CH3 domain of the Fc domain.
- the modification is in the CH3 domain of the Fc domain.
- the modification comprises a "knob” modification in one of the two subunits of the Fc domain and a "hole” modification in the other of the two subunits of the Fc domain, the so-called “knob-into- Hall” modification.
- Knob-into-hole technology is described, for example, in U.S. Patent No. 5,731,168; U.S. Patent No. 7,695,936; Ridgway et al., Prot Eng 9, 617-621 (1996); and Carter, J Immunol Meth 248, 7-15 ( 2001).
- the method involves placing the protrusions (“knobs”) secondly such that the protrusions (“knobs”) are located in cavities (“holes”) to promote heterodimer formation and prevent homodimer formation. It involves introducing a corresponding void at the interface of one polypeptide and at the interface of the second polypeptide.
- Protrusions are constructed by replacing small amino acid side chains at the interface of the first polypeptide with larger side chains (eg, tyrosine or tryptophan).
- Compensatory cavities of the same or similar size as the protrusions are created at the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (eg, alanine or threonine).
- amino acid residues in the CH3 domain of the first subunit of the Fc domain of the multispecific antigen binding molecule are replaced with amino acid residues having a larger side chain volume, thereby A protrusion within the CH3 domain of the first subunit is generated that can be positioned in a cavity within the CH3 domain of the second subunit, and in the CH3 domain of the second subunit of the Fc domain, the amino acid residues are , is replaced with an amino acid residue with a smaller side chain volume, thereby creating a cavity within the CH3 domain of the second subunit into which a protrusion within the CH3 domain of the first subunit can be positioned.
- Protrusions and cavities can be created by altering the nucleic acid encoding the polypeptide, eg, by site-directed mutagenesis, or by peptide synthesis.
- the threonine residue at position 366 in the CH3 domain of the first subunit of the Fc domain, is replaced with a tryptophan residue (T366W) and in the CH3 domain of the second subunit of the Fc domain, The tyrosine residue at position is replaced with a valine residue (Y407V).
- the threonine residue at position 366 in the second subunit of the Fc domain, is additionally replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue ( L368A).
- the serine residue at position 354 is replaced with a cysteine residue (S354C) and in the second subunit of the Fc domain further at position 349 A tyrosine residue is replaced by a cysteine residue (Y349C).
- S354C cysteine residue
- Y349C cysteine residue
- amino acid residues that contact at the interface of the other constant region of the H chain include EU numbering in the CH3 region. Regions corresponding to residues at positions 356, 439, 357, 370, 399 and 409 are included.
- an antibody comprising two types of H chain CH3 regions, wherein the first H chain CH3 region, one selected from the following pairs of amino acid residues (1) to (3)
- Examples include antibodies in which ⁇ 3 pairs of amino acid residues are homogenously charged: (1) amino acid residues at EU numbering positions 356 and 439, contained in the H chain CH3 region, (2) the H chain The amino acid residues at EU numbering positions 357 and 370 contained in the CH3 region, and (3) the amino acid residues at EU numbering positions 399 and 409 contained in the H chain CH3 region.
- the pair of amino acid residues in the second H chain CH3 region different from the first H chain CH3 region is selected from the amino acid residue pairs (1) to (3) above, 1 to 3 pairs of amino acid residues corresponding to the pairs of amino acid residues (1) to (3) having the same charge in the first H chain CH3 region, in the first H chain CH3 region
- Antibodies may have a charge opposite to the corresponding amino acid residue.
- amino acid residues shown in (1) to (3) above are close to each other when associated.
- a person skilled in the art can find positions corresponding to the above amino acid residues (1) to (3) in the desired H chain CH3 region or H chain constant region by homology modeling using commercially available software. It is possible to subject the amino acid residues at these positions to modifications as appropriate.
- the "charged amino acid residue” is preferably selected, for example, from amino acid residues included in any one of the following groups: (a) glutamic acid (E) and aspartic acid (D), and (b) lysine (K), arginine (R), and histidine (H).
- the phrase “having the same charge” means, for example, that any of two or more amino acid residues are amino acid residues included in any one of the above groups (a) and (b) means to be selected from
- the phrase “having opposite charges” means, for example, that at least one amino acid residue of the two or more amino acid residues is included in any one of groups (a) and (b) above. When selected from amino acid residues, it means that the remaining amino acid residues are selected from amino acid residues included in other groups.
- the antibody may have the first H chain CH3 region and the second H chain CH3 region crosslinked by disulfide bonds.
- amino acid residues to be modified are not limited to the amino acid residues of the antibody variable region or antibody constant region described above. Those skilled in the art can identify the amino acid residues that form the interface in the mutant polypeptide or heterologous multimer by homology modeling or the like using commercially available software, and then identify the amino acid residues at these positions, Modifications can be made to control association.
- a strand exchange engineering domain CH3 generated by altering a portion of one H chain CH3 of an antibody to the corresponding IgA-derived sequence and introducing the corresponding IgA-derived sequence into the complementary portion of the other H chain CH3 can efficiently induce the association of polypeptides with different sequences through complementary association of CH3 (Protein Engineering Design & Selection, 23; 195-202, 2010 ).
- This known technique can also be used to efficiently form the desired multispecific antigen-binding molecule.
- multispecific antigen-binding molecules may involve the association of CH1 and CL of antibodies as described in WO2011/028952, WO2014/018572 and Nat Biotechnol.
- Antibody manufacturing techniques utilizing VH and VL association techniques for manufacturing bispecific antibodies using a combination of separately prepared monoclonal antibodies as described in WO2008/119353 and WO2011/131746 (Fab Arm Exchange) ), technology for controlling association between antibody heavy chain CH3 as described in WO2012/058768 and WO2013/063702, composed of two light chains and one heavy chain as described in WO2012/023053
- Antibody fragments containing one heavy chain and one light chain as described by Christoph et al. (Nature Biotechnology Vol. 31, p 753-758 (2013)) Techniques such as the production of multispecific antibodies utilizing two bacterial cell lines each expressing a chain may also be used.
- the desired multispecific antigen-binding molecule can be separated and purified from the produced molecules to obtain a multiplex of the present disclosure. It is possible to obtain specific antigen-binding molecules. For example, by introducing amino acid substitutions into the variable regions of two types of H chains to give them different isoelectric points, it is possible to purify two types of homozygotes and the target heteroantibodies by ion-exchange chromatography. A method has been reported (WO2007114325).
- a method for purifying a heteroantibody a method of purifying a heterodimeric antibody containing a mouse IgG2a H chain that binds to protein A and a rat IgG2b H chain that does not bind to protein A using protein A. have been reported (WO98050431 and WO95033844). Furthermore, using an H chain in which the amino acid residues at EU numbering positions 435 and 436, which are binding sites for IgG and protein A, are substituted with amino acids such as Tyr and His that provide different protein A affinities, or By using H chains with different protein A affinities to vary the interaction between each H chain and protein A, and then using a protein A column, only heterodimeric antibodies can be efficiently purified. .
- an Fc region with improved heterogeneity at the C-terminus of the Fc region can be used as appropriate. More specifically, the present disclosure lacks glycine at position 446 and lysine at position 447 identified by EU numbering in the amino acid sequences of the two polypeptides that make up the Fc region derived from IgG1, IgG2, IgG3 or IgG4. An Fc region generated by deletion is provided.
- Multispecific antigen-binding molecules prepared as described herein can be used using techniques in the art, such as, for example, high performance liquid chromatography, ion exchange chromatography, gel electrophoresis, affinity chromatography, and size exclusion chromatography. may be purified by techniques known in The actual conditions used to purify a particular protein will depend in part on factors such as net charge, hydrophobicity, hydrophilicity, etc., and will be apparent to those skilled in the art. Affinity chromatography purification can use antibodies, ligands, receptors, or antigens to which the multispecific antigen binding molecules bind. For example, matrices with protein A or protein G may be used in affinity chromatography purification of the multispecific antigen binding molecules of the invention.
- Sequential protein A or G affinity chromatography and size exclusion chromatography can be used to isolate multispecific antigen binding molecules. Purity of multispecific antigen binding molecules can be determined by any of a variety of well-known analytical methods, including gel electrophoresis, high pressure liquid chromatography, and the like.
- Antibody-dependent cell-mediated cytotoxicity refers to the presence of secreted Ig on specific cytotoxic cells (e.g. NK cells, neutrophils and macrophages). , so that these cytotoxic effector cells can specifically bind to antigen-bearing target cells and subsequently kill the target cells by cytotoxins. refers to a form of cytotoxicity that results in NK cells, the primary cells that mediate ADCC, express only Fc ⁇ RIII, while monocytes express Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev.
- ADCC activity of a molecule of interest can be assessed in vitro, for example in an animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998). good.
- Complement dependent cytotoxicity refers to the lysis of target cells in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (C1q) to antibodies (of the appropriate subclass), which are bound to the corresponding antigen.
- C1q first component of the complement system
- the CDC assay described by Gazzano-Santoro et al., J. Immunol. Methods 202:163 (1996) can be performed.
- Polypeptide variants with altered Fc region amino acid sequences polypeptides with variant Fc regions
- increased or decreased C1q binding capacity are described, for example, in US Pat. No. 6,194,551 B1 and WO1999/51642. See also, eg, Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
- T-cell-dependent cytotoxicity refers to the combination of an antigen-binding molecule with an antigen expressed on a target cell such that cytotoxicity against the target cell is induced by the T-cell. It refers to a form of cytotoxicity that binds to both another antigen expressed on the T cell and redirects the T cell closer to the target cell.
- An in vitro TDCC assay a method for assessing T-cell dependent cytotoxicity, is also described in the "Measurement of T-cell dependent cytotoxicity" section herein.
- the antigen-binding molecule of the present disclosure is combined with CLDN6-expressing cells to which the antigen-binding site of the antigen-binding molecule of the present disclosure binds.
- TDCC T-cell dependent cytotoxicity
- Methods for evaluating or determining cytotoxic activity in vitro include methods for determining activity of cytotoxic T cells and the like.
- the antigen-binding molecule of the present disclosure has the activity of inducing T cell-mediated cytotoxicity can be determined by known methods (e.g., Current protocols in Immunology, Chapter 7. Immunologic studies in humans, Editor, See John E, Coligan et al., John Wiley & Sons, Inc., (1993)).
- an antigen-binding molecule that can bind to an antigen that is different from CLDN6 and not expressed in cells and CD3/CD137 is used as a control antigen-binding molecule. Control antigen binding molecules are assayed in the same way.
- Activity is then assessed by testing whether an antigen-binding molecule of the present disclosure exhibits stronger cytotoxic activity than that of a control antigen-binding molecule.
- in vivo antitumor effects are evaluated or determined, for example, by the following methods.
- Cells expressing an antigen bound by the antigen-binding site of the antigen-binding molecule of the present disclosure are implanted intradermally or subcutaneously into a non-human animal subject.
- a test antigen-binding molecule is then administered intravenously or intraperitoneally daily or at intervals of several days on or after the day of transplantation. Tumor size is measured over time. Differences in tumor size change can be defined as cytotoxic activity.
- a control antigen binding molecule is administered.
- the tumor size in the group administered with the antigen-binding molecule of the present disclosure is smaller than that in the group administered with the control antigen-binding molecule, the antigen-binding molecule of the present disclosure is judged to have cytotoxic activity. can be done.
- the MTT method and isotope injection into cells are preferably performed. A measurement of labeled thymidine incorporation is used.
- TDCC of an antibody or antigen-binding molecule of the disclosure can be assessed by any suitable method known in the art.
- TDCC can be measured by a lactate dehydrogenase (LDH) release assay.
- target cells e.g., CLDN6-expressing cells
- T cells e.g., PBMCs
- the activity of LDH released from target cells killed by T cells is measured. is measured using appropriate reagents.
- cytotoxic activity is measured against LDH activity produced by 100% killing of target cells (e.g., lysed by treatment with Triton-X) versus LDH produced by incubation with an antibody or antigen-binding molecule. Calculated as percent activity.
- a test antibody or antigen-binding molecule is determined to have a higher TDCC when the cytotoxic activity calculated as described above is higher.
- TDCC can be measured by real-time cell growth inhibition assays.
- target cells e.g., CLDN6-expressing cells
- T cells e.g., PBMCs
- Target cell proliferation is monitored by using an appropriate analytical instrument (eg, the xCELLigence real-time cell analyzer).
- CIAb represents the Cell Index of wells with antibody or antigen-binding molecule and "CINoAb” represents the average Cell Index of wells without antibody or antigen-binding molecule at a particular experimental time. If the CGI rate of an antibody or antigen-binding molecule is high, ie has a significant positive value, the antibody or antigen-binding molecule can be said to have TDCC activity. In one aspect, the antibodies or antigen-binding molecules of this disclosure have T cell activation activity.
- T-cell activation is controlled by a modified T-cell line (e.g., Jurkat/NFAT-RE reporter cell line (T-cell activation bioassay, Promega)) that expresses a reporter gene (e.g., luciferase) in response to its activation. It can be assayed by methods known in the art, such as those used.
- target cells e.g, CLDN6-expressing cells
- the level or activity of the reporter gene expression product is determined as a suitable indicator of T cell activation. method.
- the reporter gene is a luciferase gene
- luminescence produced by the reaction of luciferase with its substrate can be measured as an indicator of T cell activation.
- a test antibody or antigen-binding molecule is determined to have higher T cell activation activity if the T cell activation measured as described above is higher.
- a multispecific antigen-binding molecule or antibody of the present disclosure exhibits equivalent or higher (ie, greater) cytotoxic activity compared to a control multispecific antibody. Measurement and comparison of cytotoxic activity and determination of equivalent or higher (i.e., greater) cytotoxic activity should be performed as described in the "Measurement of T cell-dependent cytotoxicity" section above. can be done.
- the control multispecific antibody is identical in structure to the multispecific antigen-binding molecule or antibody of the disclosure, except that the first antigen-binding portion can only bind to CD3.
- control multispecific antibody is capable of binding a T-cell receptor complex comprising a heavy chain comprising the amino acid sequence of SEQ ID NO:194 and a light chain comprising the amino acid sequence of SEQ ID NO:192. and a multispecific antibody (CS3348) comprising an antigen binding portion capable of binding to CLDN6 comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 193 and a light chain comprising the amino acid sequence of SEQ ID NO: 195 be.
- CS3348 multispecific antibody
- the disclosure provides pharmaceutical compositions comprising the multispecific antigen binding molecules or antibodies of the disclosure.
- the pharmaceutical compositions of this disclosure induce T-cell dependent cytotoxicity, in other words, the pharmaceutical compositions of this disclosure are therapeutic agents for inducing cytotoxicity.
- the pharmaceutical composition of the present disclosure is a pharmaceutical composition used for treating and/or preventing cancer.
- the pharmaceutical compositions of this disclosure are used for ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, testicular cancer, breast cancer, cervical cancer, CLDN6-positive cancer or CLDN6-expressing cancers; and other CLDN6-positive cancers or CLDN6-expressing cancers.
- the pharmaceutical compositions of this disclosure are cytostatics (cytostatics). In certain embodiments, the pharmaceutical compositions of this disclosure are anticancer agents. In certain embodiments, the pharmaceutical composition of the present disclosure is a cytotoxicity-inducing agent, an immune response activating agent against cancer cells or tumor tissue containing cancer cells, a cancer therapeutic agent or a cancer preventive agent.
- compositions of the present disclosure therapeutic agents for inducing cell injury of the present disclosure, cytostatic agents, cytotoxicity-inducing agents, immune response activators against cancer cells or tumor tissue containing cancer cells, cancer
- a therapeutic agent, cancer preventive agent, or anticancer agent can be formulated with various types of antigen-binding molecules or antibodies, as appropriate.
- a cocktail of multiple multispecific antigen binding molecules or antibodies of the disclosure can enhance cytotoxicity against cells expressing the antigen.
- compositions comprising the multispecific antigen-binding molecules or antibodies described herein can be prepared by combining antigen-binding molecules or antibodies of desired purity in one or more of any pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)) in the form of lyophilized formulations or aqueous solutions.
- pharmaceutically acceptable carriers Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations at which they are employed and include, but are not limited to: phosphate salts, Buffers such as citrate and other organic acids; antioxidants, including ascorbic acid and methionine; preservatives (octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl , or benzyl alcohol; alkylparabens such as methyl or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; or proteins such as immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, man
- chelating agents such as EDTA
- sugars such as sucrose, mannitol, trehalose, sorbitol
- salt-forming counterions such as sodium
- metal complexes eg, Zn-protein complexes
- Nonionic surfactant e.g, soluble neutrally active hyaluronidase glycoprotein (sHASEGP) (e.g., human soluble hyaluronidase glycoprotein such as rHuPH20 (HYLENEX®, Baxter International, Inc.)). PH-20 hyaluronidase glycoprotein).
- sHASEGP soluble neutrally active hyaluronidase glycoprotein
- rHuPH20 e.g., human soluble hyaluronidase glycoprotein
- PH-20 hyaluronidase glycoprotein e.g., PH-20 hyaluronidase glycoprotein.
- sHASEGP is combined with one or more additional glycosaminoglycanase, such as chondroitinase.
- additional glycosaminoglycanase such as chondroitinase.
- An exemplary lyophilized antibody formulation is described in US Pat. No. 6,267,958.
- Aqueous antibody formulations include those described in US Pat. No. 6,171,586 and WO2006/044908, the latter formulation containing a histidine-acetate buffer.
- compositions herein may contain more than one active ingredient if required for the particular indication being treated. Those with complementary activities that do not adversely affect each other are preferred. Such active ingredients are present in any suitable combination in amounts that are effective for the purpose intended.
- the antigen-binding molecules or antibodies of this disclosure can be encapsulated in microcapsules (microcapsules made from hydroxymethylcellulose, gelatin, poly[methyl methacrylate], etc.) and colloidal drug delivery systems (liposomes). , albumin microspheres, microemulsions, nanoparticles, and nanocapsules) (see, eg, Remington's Pharmaceutical Science 16th edition, Oslo Ed. (1980)).
- microcapsules made from hydroxymethylcellulose, gelatin, poly[methyl methacrylate], etc.
- colloidal drug delivery systems liposomes
- albumin microspheres, microemulsions, nanoparticles, and nanocapsules see, eg, Remington's Pharmaceutical Science 16th edition, Oslo Ed. (1980)
- methods for preparing drugs as sustained-release drugs are also known, and these can be applied to the antigen-binding molecules of the present disclosure (J. Biomed. Mater. Res. (1981) 15, 267-277 Chemtech. (1982) 12,
- a vector containing a nucleic acid molecule encoding the antigen-binding molecule or antibody of the present disclosure may be introduced into the subject in order to directly express the multispecific antigen-binding molecule or antibody of the present disclosure in the subject.
- a non-limiting example of a vector that can be used is an adenovirus.
- Administering a nucleic acid molecule encoding an antigen-binding molecule or antibody of the disclosure directly to a subject, or transferring or expressing a nucleic acid molecule encoding an antigen-binding molecule or antibody of the disclosure into a subject via electroporation and a cell containing a nucleic acid molecule encoding an antigen-binding molecule or antibody of the present disclosure to be secreted can be administered to a subject to continuously express and secrete the antigen-binding molecule or antibody of the present disclosure in the subject.
- the pharmaceutical compositions, cytostatic agents, or anticancer agents of this disclosure can be administered to patients either orally or parenterally.
- parenteral administration specifically such administration methods include injection, nasal administration, pulmonary administration, and transdermal administration.
- Injections include, for example, intravenous, intramuscular, intraperitoneal, and subcutaneous injections.
- the pharmaceutical compositions, therapeutic agents for inducing cytotoxicity, cytostatic agents, or anticancer agents of this disclosure can be administered locally or systemically by injection.
- an appropriate administration method can be selected according to the patient's age and symptoms.
- the dosage for administration can be selected, for example, from the range of 0.0001 mg to 1,000 mg per kg of body weight for each administration.
- doses can be selected, for example, from the range of 0.001 mg to 100,000 mg per patient.
- the doses of the pharmaceutical compositions of this disclosure are not limited to these doses.
- the pharmaceutical compositions of the present disclosure comprise multispecific antigen-binding molecules or antibodies as described herein.
- the composition is a pharmaceutical composition for use in inducing cytotoxicity.
- the composition is a pharmaceutical composition for use in treating or preventing cancer.
- the cancer is a CLDN6-expressing cancer.
- Pharmaceutical compositions of the present disclosure can be used to treat or prevent cancer. Accordingly, the present disclosure provides methods for treating or preventing cancer, wherein the multispecific antigen binding molecules or antibodies described herein are administered to a patient in need thereof.
- the present disclosure also provides methods for damaging CLDN6-expressing cells or CLDN6-positive cancers or suppressing cell proliferation by contacting CLDN6-expressing cells with an antigen-binding molecule of the present disclosure that binds to CLDN6. It also provides a method for Cells to which the antigen-binding molecules of the present disclosure bind are not particularly limited as long as they express CLDN6.
- preferred CLDN6-expressing or CLDN6-positive cancers include ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, testis.
- atypical teratoid rhabdoid tumor AT/RT
- contacting can be performed, for example, by adding the antigen-binding molecule of the present disclosure to the culture medium of CLDN6-expressing cells cultured in vitro.
- the antigen-binding molecule to be added can be used in an appropriate form such as a solution or a solid prepared by lyophilization or the like.
- the solution may be a pure aqueous solution containing the antigen-binding molecule alone, or the surfactants, excipients, coloring agents, flavoring agents, preservatives, etc. described above.
- concentration added is not particularly limited; however, the final concentration in the medium is preferably in the range of 1 pg/ml to 1 g/ml, more preferably 1 ng/ml to 1 mg/ml, and even more preferably 1 ⁇ g /ml to 1 mg/ml.
- "contacting" can also be performed by administering in vivo to a non-human animal transplanted with CLDN6-expressing cells or an animal having cancer cells that endogenously express CLDN6.
- the method of administration may be oral or parenteral, with parenteral administration being particularly preferred.
- parenteral administration methods include injection, nasal administration, pulmonary administration, and transdermal administration.
- Injections include, for example, intravenous, intramuscular, intraperitoneal, and subcutaneous injections.
- the pharmaceutical compositions, therapeutic agents for inducing cytotoxicity, cytostatic agents, or anticancer agents of this disclosure can be administered locally or systemically by injection.
- an appropriate administration method can be selected according to the age and condition of the animal subject.
- the solution may be a pure aqueous solution containing the antigen-binding molecule alone, or may contain surfactants, excipients, coloring agents, flavoring agents, preservatives, stabilizing agents, such as those described above. It may be a solution containing agents, buffers, suspending agents, tonicity agents, binders, disintegrants, lubricants, flow enhancers, and flavoring agents.
- the dosage for administration can be selected, for example, from the range of 0.0001 to 1,000 mg/kg body weight for each administration. Alternatively, doses can be selected, for example, from the range 0.001-100,000 mg for each patient. However, doses of antigen-binding molecules of the present disclosure are not limited to these examples.
- compositions are preparations in a form such that the biological activity of the active ingredients contained therein can be effected, and refers to a preparation that does not contain additional elements that are unacceptably toxic to the subject to whom the formulation is administered.
- Pharmaceutically Acceptable Carrier refers to an ingredient, other than the active ingredient, in a pharmaceutical formulation that is non-toxic to the subject.
- Pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers, or preservatives.
- treatment refers to clinical treatments intended to alter the natural course of the individual being treated. therapeutic intervention and can be performed both for prophylaxis and during the course of a clinical condition. Desirable effects of treatment include, but are not limited to, prevention of disease onset or recurrence, relief of symptoms, attenuation of any direct or indirect pathological effects of disease, prevention of metastasis, prevention of disease Includes reduced rate of progression, amelioration or amelioration of disease state, and remission or improved prognosis.
- the antigen-binding molecules or antibodies of this disclosure are used to delay disease onset or slow disease progression.
- the present invention provides treatment for cancer chemotherapy resistance, cancer recurrence or cancer metastasis, particularly during or after cancer treatment, comprising treating cancer by the methods of the invention.
- the "treatment" of the present invention means reduction in the number of cancer cells in an individual by single-agent administration or combination therapy using the anticancer agent or pharmaceutical composition of the present invention. Suppression of cell proliferation, reduction of tumor size, suppression of invasion of cancer cells into peripheral organs, suppression of metastasis of cancer cells, or various symptoms caused by cancer is improved.
- prevention in the present invention means preventing an increase in the number of cancer cells due to re-proliferation of decreased cancer cells, re-proliferation of cancer cells whose proliferation has been suppressed. to prevent the size of a tumor that has been reduced from increasing again.
- cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation.
- cancer means not only epithelial malignant tumors such as ovarian cancer and gastric cancer, but also non-epithelial malignant tumors including hematopoietic cancers such as chronic lymphocytic leukemia and Hodgkin's lymphoma.
- cancer cancer
- cancer cancer
- cancer cancer
- metastatic cancers metastatic cancers
- recurrent cancers or combinations thereof.
- the cancer is ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, testicular cancer, breast cancer, cervical cancer, esophageal cancer, CLDN6-expressing or CLDN6-positive cancers, including pancreatic cancer, bile duct cancer, renal cancer, head and neck cancer, colorectal cancer, bladder cancer, atypical teratoid rhabdoid tumor (AT/RT); and Other CLDN6-positive or CLDN6-expressing cancer.
- Tumor refers to all neoplastic cell growth and proliferation and all precancerous and cancerous cells and tissues, whether malignant or benign.
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- cancer cancer
- Metastasis refers to cancer cells entering blood vessels and lymphatic vessels from the place where they first appeared, traveling with the flow of blood and lymph to another organ or organ, and multiplying there. “Dissemination” refers to the shedding of cancer cells from a cancer-bearing organ and the spread of these cells into adjacent body spaces, such as the thoracic and abdominal cavities. In a specific embodiment, “metastasis to the peritoneum” refers to peritoneal dissemination and spread of cancer cells to the peritoneum covering the peritoneal cavity.
- ovarian cancer has metastasized to the peritoneum means that ovarian cancer cells spread from the ovary to the peritoneum as if they were scattered due to peritoneal disseminated metastasis outside the pelvis. Cancer cells of cancer that has metastasized to the peritoneum are present, for example, in the patient's ascites. In certain embodiments, the cancer is cancer that has metastasized to the peritoneum. Also, in certain embodiments, the cancer is peritoneal disseminated cancer.
- the multispecific antigen binding molecules described above may be administered in combination with one or more other agents in therapy.
- the multispecific antigen binding molecules described herein may be co-administered with at least one additional therapeutic agent.
- the multispecific antigen binding molecules described herein may be administered before or after at least one additional therapeutic agent.
- the term “combination” in relation to administration of therapy refers to the use of more than one therapy or therapeutic agent.
- the use of the term “in combination” does not limit the order in which the therapies or therapeutic agents are administered to a subject.
- a therapy or therapeutic agent can be administered prior to, concurrently with, or after administration of a second therapy or therapeutic agent to the subject.
- the therapy or therapeutic agents are administered to the subject in a sequence, amount and/or time interval that allows the therapy or therapeutic agents to work together.
- the therapies or therapeutic agents are administered to the subject in a sequence, amount and/or time interval that provides greater benefit than if they were administered otherwise, particularly independently of each other. .
- the high benefit is a synergistic effect.
- therapeutic agent includes any agent administered to treat a condition or disease in an individual in need of such treatment.
- additional therapeutic agents may include any active ingredients suitable for the particular indication being treated, preferably with complementary activities that do not adversely affect each other.
- the additional therapeutic agent is an immunomodulatory agent, a cytostatic agent, an inhibitor of cell adhesion, a cytotoxic agent, an activator of cell apoptosis, or an agent that increases the sensitivity of a cell to an apoptosis inducer. .
- the additional therapeutic agent is an anti-cancer agent, e.g., microtubule disrupting agents, antimetabolic agents, topoisomerase inhibitors, DNA intercalating agents, alkylating agents, hormone therapy, kinase inhibitors, receptor antagonists , an activator of tumor cell apoptosis, or an anti-angiogenic agent.
- an anti-cancer agent e.g., microtubule disrupting agents, antimetabolic agents, topoisomerase inhibitors, DNA intercalating agents, alkylating agents, hormone therapy, kinase inhibitors, receptor antagonists , an activator of tumor cell apoptosis, or an anti-angiogenic agent.
- Such other agents are present in suitable combination in amounts that are effective for the intended purpose. Effective amounts of such other agents will depend on the amount of multispecific antigen binding molecule used, the type of disorder or treatment, and other factors discussed above. Multispecific antigen binding molecules are generally at the same doses and routes of administration as described herein, or at about 1 to 99% of the doses described herein, or empirically/clinically Any dosage and any route deemed appropriate for the purpose of administration may be used.
- the combination therapy of the present invention comprises administering an effective amount of a multispecific antigenic molecule as described above and at least one other anticancer agent that damages cells.
- Methods of inhibiting proliferation, activating immunity against cancer cells or tumor tissue containing cancer cells, treating cancer, or preventing cancer are provided.
- the combination therapy of the present invention is a cell-damaging, cell-proliferative, anti-cancer agent, or cancer cell-killing agent, compared to monotherapy of the above-described multispecific antigen-binding molecules or other anti-cancer agents. It is highly effective in activating immunity against tumor tissue containing cells or cancer cells, treating cancer, or preventing cancer.
- the combination therapy of the invention is used to kill cells, suppress cell proliferation, activate immunity against cancer cells or tumor tissue containing cancer cells, treat cancer, or treat cancer. have synergistic or additive effects to prevent cancer.
- "effective amount" in the present invention means a dose of the above-described multispecific antigen-binding molecules and/or other therapeutic agents effective for treating or preventing disease in an individual.
- the disease is not particularly limited, it is preferably cancer.
- the type of cancer is not particularly limited, it is preferably a tumor containing cancer cells expressing CLDN6.
- Such combination therapy described above includes combined administration (two or more therapeutic agents are contained in the same or separate compositions) and individual administration.
- administration of the multispecific antigen binding molecules described herein may be simultaneous with or separate from administration of additional therapeutic agents and/or adjuvants. That is, administration of the multispecific antigen molecule may precede the additional therapeutic agent and/or adjuvant, and administration of the multispecific antigen binding molecule is concurrent with administration of the additional therapeutic agent and/or adjuvant. Alternatively, administration of the multispecific antigen binding molecule may follow administration of additional therapeutic agents and/or adjuvants.
- the multispecific antigen binding molecules described herein can also be used in combination with radiotherapy.
- the combination therapy of the present invention uses the above-described multispecific antigen-binding molecules to treat or prevent cancer with at least one other anticancer agent, at least one A method for enhancing the therapeutic or preventive effect of other anticancer agents is provided.
- the combination therapy of the present invention uses at least one other anticancer agent to treat cancer with a multispecific antigen-binding molecule as described above.
- the enhancement of the therapeutic or preventive effect means, for example, that the therapeutic response rate is increased, the amount of the anticancer agent administered for treatment is reduced, and / or by the anticancer agent It includes, but is not limited to, shortening the duration of treatment.
- the combination therapy of the invention increases progression-free survival in an individual comprising administering an effective amount of a multispecific antigen binding molecule as described above and at least one other anticancer agent. provide a way to
- the combination therapy of the invention comprises administration of a multispecific antigen binding molecule as described above and at least one other anticancer agent.
- the multispecific antigen binding molecule and at least one other anticancer agent can be administered by any suitable method known in the art.
- the multispecific antigen binding molecule and at least one other anticancer agent can be administered concurrently (ie simultaneously) and/or sequentially (ie at different times).
- the multispecific antigen-binding molecule and two or more other anticancer agents e.g., first other anticancer agent and second other anticancer agent
- the multispecific antigen-binding molecule and the two or more other anticancer agents are administered in any order.
- the multispecific antigen-binding molecule and two or more other anticancer agents may be administered sequentially (i.e., all at different times); of the anticancer agents may be administered simultaneously, preceded by or followed by a second other anticancer agent; alternatively, the first and second other anticancer agents are administered simultaneously,
- the multispecific antigen binding molecule may be administered before or after.
- the administration interval of the anticancer agent is not particularly limited, and can be set in consideration of factors such as administration route and dosage form.
- the dosing interval is 0 hours to 168 hours, preferably 0 hours to 72 hours, also preferably 0 to 24 hours, more preferably 0 hours to 12 hours, but is not limited thereto. .
- the multispecific antigen-binding molecule described above and at least one other anticancer agent are co-administered.
- the multispecific antigen binding molecules are administered intermittently (ie intermittently).
- the multispecific antigen binding molecule is administered prior to administration of at least one other anticancer agent.
- the multispecific antigen binding molecule is administered after administration of at least one other anticancer agent.
- At least one other anticancer agent is administered intermittently (ie, intermittently). In some embodiments, at least one other anti-cancer agent is administered prior to administration of said multispecific antigen binding molecule. In some embodiments, at least one other anti-cancer agent is administered after administration of said multispecific antigen binding molecule.
- a multispecific antigen binding molecule described herein and an anti-cancer agent known or described herein is a combination of said multispecific antigen binding molecule and at least one other anti-cancer agent. It can be used in combination therapy with cancer drugs.
- additional therapy can be administered in addition to the above-described combination therapy of the multispecific antigen-binding molecule and at least one other anticancer agent.
- additional therapy to the combination therapy of the invention may include administration of additional said multispecific antigen binding molecules and/or at least one other anti-cancer agent.
- the present invention provides a multispecific antigen binding molecule as described above, at least one other anticancer agent, or the multispecific antigen binding molecule and at least one other anticancer agent.
- a pharmaceutical composition or the like comprising a combination of agents is provided.
- the pharmaceutical composition is a cytotoxic agent, a cell growth inhibitor (cell growth inhibitor), an immune response activator against cancer cells or tumor tissue containing cancer cells, a cancer therapeutic agent or a cancer preventive agent. be.
- the pharmaceutical composition, etc. of the present invention can be used in the combination therapy of the present invention.
- the pharmaceutical composition, etc. can be used in the combination therapy of the present invention.
- the pharmaceutical composition of the present invention is a combination of the multispecific antigen-binding molecule described above and at least one other anticancer agent that damages cells, suppresses cell proliferation, have a synergistic or additive effect of activating immunity against cancer cells or tumor tissue containing cancer cells, or treating or preventing cancer.
- administration of at least one other anticancer agent enhances the antitumor effect of the multispecific antigen-binding molecule described above.
- administration of the multispecific antigen-binding molecule described above enhances the anti-tumor effect of at least one other anti-cancer agent.
- the pharmaceutical composition or the like "combining a multispecific antigen-binding molecule with at least one other anticancer agent" in the present invention includes the above-described multispecific antigen-binding molecule and at least one means a pharmaceutical composition or the like in which two other anticancer agents are combined for simultaneous, separate and/or sequential administration in the treatment or prevention of disease.
- the pharmaceutical composition, etc. of the present invention can be provided in the form of a combination drug containing both the multispecific antigen-binding molecule and at least one other anticancer drug.
- an agent containing a multispecific antigen-binding molecule and an agent containing at least one other anticancer agent are provided separately, and these agents are administered simultaneously. , or may be used sequentially.
- the disease is not particularly limited, it is preferably cancer.
- the present invention provides pharmaceutical compositions, etc., which comprise the above-described multispecific antigen-binding molecules as active ingredients, and which are to be used in combination with at least one other anticancer agent.
- the present invention provides pharmaceutical compositions, etc. for use in combination with the multispecific antigen-binding molecules described above, which contain at least one other anticancer agent as an active ingredient.
- the present invention provides a method for treating cancer with at least one other anticancer agent by combining the above-described multispecific antigen-binding molecule with another anticancer agent.
- the present invention also provides pharmaceutical compositions and the like for enhancing the therapeutic effects of two other anticancer agents.
- the present invention provides the above-described multispecific antigen-binding molecules in combination with other anticancer agents to treat cancer with multispecific antibodies.
- the present invention provides a multispecific antigen-binding molecule for producing a pharmaceutical composition or the like containing the above-described multispecific antigen-binding molecule and/or at least one other anticancer agent as an active ingredient. Uses of molecules and/or other anti-cancer agents are provided.
- “comprising the multispecific antigen-binding molecule and/or at least one other anticancer agent as an active ingredient” means that the multispecific antigen-binding molecule and/or at least one other anticancer agent It means containing a cancer drug as a main active ingredient, and does not limit the content of the multispecific antigen-binding molecule and/or at least one other anticancer drug.
- the multispecific antigen-binding molecules described herein and at least one other anticancer agent known or described herein can be used in the pharmaceutical composition and the like.
- At least one other anticancer agent is one, two, three, four, five, or more anticancer agents.
- at least one other anticancer agent or “another anticancer agent” means that the anticancer agent is the multispecific antigen-binding molecule described herein. means that it is an anticancer drug with a different substance as an active ingredient.
- the term “another anticancer agent” only specifies that the anticancer agent contains an active ingredient that is different from the multispecific antigen-binding molecule.
- the multispecific antigen-binding molecule used in combination with at least one other anticancer agent is not limited to that used as an anticancer agent.
- an anticancer agent, pharmaceutical composition, combination, kit, method, or use characterized by combining (using in combination with) a multispecific antigen-binding molecule and at least one other anticancer agent also includes embodiments in which no anticancer agent other than the at least one other anticancer agent is used, in which case the multispecific antigen-binding molecule is, for example, the at least one other anticancer agent A mode of use as an enhancer, a concomitant agent, an additive, or the like is included.
- said at least one other anticancer agent includes Nitrogen mustard analogues, Alkyl suIfonates, Ethylene imines, Nitrosourea (Nitrosoureas), Epoxides, Other alkylating agents, Folic acid analogues, Purine analogues, Pyrimidine analogues, Other antimetabolites, Vinca alkaloids or their analogues (Vinca alkaloids) or analogues, Podophyllotoxin derivatives, Camptothecan analogs, CoIchicine derivatives, Taxanes, other plant alkaloids or natural substances, Actinomycines, anthracyclines or their AnthracycIines or related substances, Other cytotoxic antibiotics, Platinum compounds, Methylhydrazines, Kinase inhibitors, Angiogenesis inhibitors, Hormones, DNA-modifying enzyme inhibitors drugs, immunostimulators, proteosome inhibitors, enzymes (Enzymes), histone deace
- the "immune checkpoint molecule" in the present invention is expressed on immunocompetent cells (including T cells) or cancer cells, and binds to ligands to the immunocompetent cells.
- Immune checkpoint molecules and their ligands include, for example, PD-1, CTLA-4, TIM3, LAG3, PD-L1, PD-L2, BTNL2, B7-H3, B7-H4, CD48, CD80, 2B4, BTLA, Including, but not limited to, molecules such as CD160, CD60, CD86i, or VISTA.
- the "immune checkpoint inhibitor" in the present invention refers to an agent that inhibits signal transduction by an immune checkpoint molecule by inhibiting the binding of the immune checkpoint molecule to its ligand. .
- PARP inhibition in the present invention prevents repair of single-strand breaks by inhibiting poly(ADP-ribose) polymerase (PARP), particularly PARP-1 and PARP-2.
- PARP poly(ADP-ribose) polymerase
- a PARP inhibitor is a drug that has the function of preventing single-strand break repair by inhibiting PARP.
- Some cancers such as breast cancer and ovarian cancer are known to have defects in double-strand break repair due to BRCA gene mutations. A drug that has anti-tumor effects.
- said at least one other anticancer agent is a chemotherapeutic agent, an immune checkpoint inhibitor, a PARP inhibitor, a T cell activation agonist, and/or an angiogenesis inhibitor.
- said at least one other anticancer agent is selected from the group consisting of chemotherapeutic agents, immune checkpoint inhibitors, PARP inhibitors, T cell activation agonists, and angiogenesis inhibitors
- a pharmaceutical composition or the like is provided that is one or more anticancer agents.
- multiple types may be selected from the same type of anticancer drug, or multiple types may be selected from different types of anticancer drugs.
- multiple types may be selected from chemotherapeutic agents, and one or more types may be selected from each of chemotherapeutic agents and immune checkpoint inhibitors. The same is true when selecting multiple types from other types of anticancer agents.
- the at least one other anticancer agent includes an agent that enhances CLDN6 expression in cancer cells. That is, administration of the at least one other anticancer drug increases the expression of CLDN6 in cancer cells.
- chemotherapeutic agents include, but are not limited to, antimetabolites, plant alkaloids, anthracyclines, or platinum agents.
- Suitable examples of antimetabolites include, but are not limited to, enocitabine, capecitabine, carmofur, gemcitabine, cytarabine, tegafur, tegafur uracil, nerarabine, fluorouracil, fludarabine, pemetrexed, pentostatin, methotrexate.
- examples of particularly preferred antimetabolites include gemcitabine.
- Suitable examples of plant alkaloids include, but are not limited to, irinotecan, etoposide, sobuzoxandocetaxel, topotecan, paclitaxel, vinorelbine, vincristine, vindesine, vinblastine.
- Examples of particularly preferred plant alkaloids include paclitaxel.
- Suitable examples of platinum agents include, but are not limited to, oxaliplatin, carboplatin, cisplatin, and nedaplatin. Examples of particularly preferred platinum agents include carboplatin and cisplatin.
- suitable examples of immune checkpoint inhibitors include anti-PD-1 antibody, anti-PD-L1 antibody, anti-CTLA-4 antibody, anti-TIM3 antibody and anti-LAG3 antibody.
- anti-PD-1 antibodies include PembroIizumab (CAS Registry Number: 1374853-91-4), Nivolumab (CAS Registry Number: 946414-94-4), MEDI0680, PDR001, BGB-A317, REGN2810, SHR- 1210, PF-0680159I and various known anti-PD-1 antibodies can be mentioned.
- anti-PD-L1 antibodies examples include AtezoIizumab (CAS Registry Number: 1380723-44-3), Avelumab (CAS Registry Number: 1537032-82-8), Durvalumab (CAS Registry Number: 1428935-60-7), MDX -11 05 and various known anti-PD-L1 antibodies.
- anti-CTLA-4 antibodies examples include Ipilimumab (CAS Registry Number: 477202-00-9), TremeIimumab (CAS Registry Number: 745013-59-6) and various known anti-CTLA-4 antibodies.
- anti-TIM3 antibodies examples include MBG452 and various known anti-TIM3 antibodies.
- anti-LAG3 antibodies examples include BMS-986016s LAG525 and various known anti-LAG3 antibodies.
- particularly preferred immune checkpoint inhibitors include anti-PD-L1 antibodies.
- preferred examples of PARP inhibitors include olaparib, rucaparib, niraparib, veliparib, pamiparib, or talazoparib.
- particularly preferred PARP inhibitors include olaparib.
- agonistic agents for T cell activation include, but are not limited to, agonistic antibodies of the TNF receptor superfamily (TNFRSF), or agonistic antibodies of co-stimulatory molecules.
- TNFRSF TNF receptor superfamily
- the target molecule of the "TNF receptor superfamily agonist antibody” is not particularly limited as long as it is a factor that activates cells expressing the TNF receptor superfamily (e.g., T cells, NK cells, etc.), but is preferably , is a factor belonging to the " ⁇ NF superfamily” or "TNF receptor superfamily”.
- Factors belonging to the "TNF superfamily” or “TNF receptor superfamily” include ligands having a trimeric structure that contribute to the activation of various immune cells, and receptors with a trimeric structure to which the ligand binds. known (Nat. Rev. Immunol., 2012, 12, 339-51).
- Factors belonging to the TNF superfamily or TNF receptor superfamily include, for example, CD137, CD137L, CD40, CD40L, 0X40, OX40L, CD27, CD70, HVEM, LIGHT, RANK, RANKL, CD30, CD153, GITR, GITRL, TNFRSF25 , TL1A.
- Preferred factors include, for example, CD137.
- examples of CD137 agonist antibodies include urelumab (CAS Registry Number: 934823-49-1), PF-05082566 and various known CD137 agonist antibodies.
- Factors belonging to co-stimulatory molecules include TMIGD2, HHLA2, ICOS, ICOS Ligand, CD28, CD80 and CD86.
- Examples of OX40 agonist antibodies include MOXR0916, MEDI6469, MEDI0562, MEDI6383, PF-04518600s GSK-3174998 and various known OX40 agonist antibodies.
- Examples of CD40 agonist antibodies include RG-7876, ADC-1013, SEA-CD40, APX005M, Dacetuzumab and various known CD40 agonist antibodies.
- Examples of GITR agonist antibodies include AMG228, AMK-1248, MK-4166, BMS-986156s TRX518 and various known GITR agonist antibodies.
- Examples of CD27 agonist antibodies include Varlilumab (CAS Registry Number: 1393344-72-3) and various known CD27 agonist antibodies.
- angiogenesis inhibitors include, but are not limited to, VEGFR2 antibodies.
- the angiogenesis inhibitors of the present invention prevent the extensive growth of blood vessels (angiogenesis) necessary for tumor survival.
- angiogenesis promoted by tumor cells to meet their increased nutritional and oxygen demands can be blocked by targeting various molecules.
- angiogenesis inhibitors include bevacizumab, sorafenib, everolimus, temsirolimus, and various known angiogenesis inhibitors.
- At least one other anticancer agent in the present invention enhances the therapeutic or preventive effect of the other anticancer agent when used in combination with the multispecific antigen-binding molecule of the present invention. or enhances the therapeutic or prophylactic effect of the multispecific antigen-binding molecule, and is not particularly limited. In certain embodiments, said therapeutic or prophylactic effect is an anti-tumor effect.
- the combination therapy of the invention comprises a multispecific antigen binding molecule as described above and at least one other therapeutic agent, immunomodulatory agent, cancer therapeutic vaccine, adoptive T cell therapy, Tregs. It may include, but is not limited to, removal and the like.
- Suitable cancer therapeutic vaccines include, but are not limited to, whole tumor cell vaccines, tumor antigen vaccines, vector-based vaccines, oncolytic virus vaccines and dendritic cell vaccines.
- multidisciplinary therapy combining surgery, radiation therapy, and the like may be performed.
- the combination therapy of the present invention may be performed in combination with the multispecific antigen-binding molecule described above and cytokine therapy using a cytokine as an anti-tumor immune response enhancer.
- cytokine therapy include IL-2, IL-7, IL-12, IL-15, IL-17, IL-18, IL-21, IL-21, IL-23, IL-27, GM-CSF, Cytokines such as, but not limited to, IFN ⁇ (interferon- ⁇ ), IFN ⁇ -2b, IFN ⁇ , IFN ⁇ .
- a cytotoxicity inducer, cell growth inhibitor, cell growth inhibitor, immune response activator, cancer therapeutic agent, or cancer preventive agent containing the pharmaceutical composition described above is provided. do.
- the "individual" to whom the multispecific antigen-binding molecules and/or other anticancer agents described above are administered is a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline. means any mammal, including Preferably, the individual is human. Individuals include patients (including humans and non-human mammals). In some embodiments, the individual is a patient with cancer cells or tumor tissue comprising cancer cells. The cancer cells or tumor tissue containing cancer cells that are the target of the anticancer agent or combination therapy in the present invention are not particularly limited as long as CLDN6 is expressed. Preferred CLDN6-expressing cells, ie, CLDN6-positive cells, in the present invention are cancer cells.
- More preferred cancer types include, for example, ovarian cancer (Ovary), non-small cell lung cancer (NSCLC), gastric cancer (Gastric), esophageal cancer (Esophageal), liver cancer (Liver), breast cancer (Breast), and colon. Cancer (including Colon and Rectum), Germ cell tumor, Germinoma, Testis, Uterine, Cervical cancer ), Cholangiocarcinoma, Kidney, Head and Neck, Pancreatic cancer (PDAC), Urinary bladder, Atypical teratoid rhabdoid tumor (AT /RT), but not limited to.
- More preferred cancer types are ovarian cancer, non-small cell lung cancer, gastric cancer, liver cancer, endometrial cancer, germ cell tumor, colon cancer, bladder cancer, and atypical teratoid rhabdoid tumor. Examples include, but are not limited to.
- the patient has received the multispecific antibody and/or any anti-cancer drug treatment prior to the above-described combination therapy of the multispecific antigen-binding molecule and other anti-cancer drug.
- a patient In some embodiments, the patient is a patient who cannot receive standard therapy or for whom standard therapy is ineffective. In some embodiments, the cancer the patient has is in early stage or late stage.
- the target cancer type for treatment with an anticancer agent or combination therapy using a pharmaceutical composition of the present invention is the number of CLDN6 antigens on the cell surface per cell. is 100 or more, and the number of CLDN6 antigens on the cell surface per cell is 200 or more, 300 or more, 400 or more, 500 or more, 600 or more, 700 or more, 800 or more, 900 or more, 1000 or more, 1200 1400 or more, 1600 or more, 1800 or more, 2000 or more cancer types are more preferable, and the number of CLDN6 antigens on the cell surface per cell is 3000 or more, 4000 or more, 5000 or more, 6000 or more, 7000 or more, 8000 or more , 9000 or more, 10000 or more, 20000 or more, 30000 or more, 40000 or more, 50000 or more cancer types are more preferable.
- Methods for measuring the number of CLDN6 antigens on the cell surface per cell can be appropriately measured using methods known to those skilled in the art in addition to the methods described herein.
- the antibody binding capacity (ABC) of CLDN6 above can also be calculated by flow cytometry using QIFIKIT (DAKO).
- DAKO QIFIKIT
- CLDN6 on the cell surface per cell Antigen number can be determined.
- the subject from which the preparation is derived is the anticancer agent or pharmaceutical composition (combination therapy) of the present invention. It can be a subject to be administered.
- the anticancer agents of the present invention can be used to treat patients with cancers that are refractory to treatment with other anticancer agents.
- the anticancer agents of the present invention can be used to treat patients with cancers that are refractory to treatment with chemotherapeutic agents.
- Patients with CLDN6-positive cancer who did not achieve the desired efficacy after administration of chemotherapeutic agents, patients whose cancer recurred in response to administration of chemotherapeutic agents, or chemotherapy Patients whose resistance to the drug has been confirmed can be treated with the anticancer drug of the present invention.
- CLDN6-positive cancer that has already been treated with a chemotherapeutic agent can be treated with the anticancer agent of the present invention.
- the anticancer agents of the present invention can be used to treat patients with cancers that are refractory to treatment with immune checkpoint inhibitors.
- Patients or patients confirmed to be resistant to immune checkpoint inhibitors can be treated with the anticancer agent of the present invention.
- CLDN6-positive cancers that have been treated with immune checkpoint inhibitors can be treated with the anticancer agents of the present invention.
- the pharmaceutical compositions (combination therapy) of the invention can be used to treat patients with cancers that are refractory to treatment with other anticancer agents.
- the pharmaceutical compositions of the invention can be used to treat patients with cancers that are refractory to treatment with chemotherapeutic agents.
- Patients with CLDN6-positive cancer who did not achieve the desired efficacy after administration of chemotherapeutic agents, patients whose cancer recurred in response to administration of chemotherapeutic agents, or chemotherapy Patients for whom drug resistance has been confirmed can be treated with the pharmaceutical composition of the present invention.
- CLDN6-positive cancers that have been treated with chemotherapeutic agents can be treated with the pharmaceutical composition of the present invention.
- the pharmaceutical compositions of the invention can be used to treat patients with cancers that are refractory to treatment with immune checkpoint inhibitors.
- patients with CLDN6-positive cancer who did not respond to the administration of immune checkpoint inhibitors with the desired efficacy, and patients who experienced cancer recurrence in response to administration of immune checkpoint inhibitors.
- Patients or patients confirmed to be resistant to immune checkpoint inhibitors can be treated with the pharmaceutical composition (combination therapy) of the present invention.
- the pharmaceutical composition (combination therapy) of the present invention can be used to treat CLDN6-positive cancers that have been previously treated with immune checkpoint inhibitors.
- Suitable examples of other anticancer agents contained in the pharmaceutical composition include, but are not limited to, immune checkpoint inhibitors.
- the pharmaceutical composition (combination therapy) of the present invention is used to treat patients with cancer refractory to treatment with the anticancer agent of the present invention.
- a patient with CLDN6-positive cancer a patient who became resistant to the anticancer agent after administration of the anticancer agent of the present invention, the desired by administration of the anticancer agent of the present invention
- the pharmaceutical composition (combination therapy) of the present invention can be used to treat patients for whom drug efficacy has not been observed or patients who have been confirmed to have resistance to the anticancer drug of the present invention.
- the pharmaceutical composition (combination therapy) of the present invention can be used to treat CLDN6-positive cancer that has already been treated with the anticancer drug therapy of the present invention.
- suitable examples of other anticancer agents contained in the pharmaceutical composition include immune checkpoint inhibitors and chemotherapeutic agents, but are not limited thereto.
- CLDN6-positive cancers cancers in which CLDN6 expression has been confirmed
- those skilled in the art will appropriately test by methods known to those skilled in the art such as immunohistochemical staining, flow cytometry, and in situ hybridization. It is possible to judge positive.
- CLDN6-positive cancers that have been treated with anticancer agents other than the anticancer agents of the present invention are exemplified as CLDN6-positive cancers that are resistant to other anticancer agents.
- CLDN6-positive cancer that has been treated with platinum drugs is platinum-resistant CLDN6-positive cancer
- CLDN6-positive cancer that has been treated with immune checkpoint inhibitors is exemplified as immune checkpoint inhibitor-resistant CLDN6-positive cancer. be done.
- “Tolerance" can be replaced with "resistance”.
- CLDN6-positive cancer that has relapsed after platinum-containing therapy is included in the platinum-treated CLDN6-positive cancer.
- CLDN6-positive cancer that has relapsed after treatment with an immune checkpoint inhibitor is included in CLDN6-positive cancer that has been treated with an immune checkpoint inhibitor.
- “resistance” as used herein means that cells or individuals are not responsive (also referred to as sensitivity) to treatment or therapy of a disease and/or have a significant response (e.g., partial response and/or complete response). It is not limited as long as the ability to produce success) is reduced.
- a cancer that is resistant to other anticancer agents may be resistance developed after treatment with an anticancer agent other than the anticancer agent of the present invention.
- the cancer may eventually acquire resistance to the treatment and may no longer regress in the presence of other anticancer drugs, or It may even progress.
- Other examples of CLDN6-positive cancers that are resistant to other anticancer agents include cancers that have recurred after treatment with anticancer agents other than the anticancer agents of the present invention.
- kits for use in the methods of the disclosure which contain antigen-binding molecules of the disclosure or antigen-binding molecules produced by the methods of the disclosure.
- the kit can be packaged with an additional pharmaceutically acceptable carrier or vehicle, or an instruction manual or the like that describes how to use the kit.
- an article of manufacture includes a device useful for treating, preventing, and/or diagnosing the disorders described above.
- the product includes the container and any label on or accompanying the container.
- Preferred containers include, for example, bottles, vials, syringes, IV solution bags, and the like.
- Containers may be formed from a variety of materials, such as glass or plastic.
- the container may hold the composition alone or in combination with another composition effective for treating, preventing, and/or diagnosing a condition, and may have a sterile access port.
- the container may be an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle).
- At least one active ingredient in the composition is a multispecific antigen binding molecule described in this disclosure.
- the label or package insert indicates that the composition is used for treating the condition of choice.
- the article of manufacture further comprises (a) a first container with a composition comprising a multispecific antigen binding molecule according to the present disclosure contained therein; and (b) a first 2 container, further cytotoxic agent contained therein (at least one other anticancer agent, when multiple types of other anticancer agents are used in combination, the first other anticancer agent
- a second container may be included with a composition comprising a therapeutic agent) or otherwise therapeutic agent.
- the product is (c) a third container in which an additional cytotoxic agent (or a second other anticancer agent when multiple types of other anticancer agents are used in combination) ) or otherwise with a composition comprising a therapeutic agent.
- Articles of manufacture in this aspect of the invention may further include a package insert indicating that the composition may be used to treat a particular condition.
- the product further comprises a second (or A third (or fourth) container may be included. It may further include other commercially desirable or user-desirable equipment such as other buffers, diluents, filters, needles, and syringes.
- Package Insert is used to refer to the instructions normally included in the commercial packaging of therapeutic products, including indications, dosage, dosage, method of administration, concomitant therapies for use of such therapeutic products. , Contraindications, and/or warning information.
- the present invention provides (1) a multispecific antigen binding molecule as described above, (2) a container, (3) at least one of said multispecific antigen binding molecules to treat cancer in an individual. and instructions or labels for administration to an individual in combination with the anticancer agent.
- the present invention provides a method comprising (1) at least one other anti-cancer agent, (2) a container, (3) said at least one other anti-cancer agent for treating cancer in an individual. and at least one multispecific antigen binding molecule described above in combination, instructions or labels indicating administration to an individual.
- the present invention provides (1) a multispecific antigen binding molecule as described above, (2) at least one other anticancer agent, (3) a container, (4) treating cancer in an individual.
- a kit comprising instructions or a label indicating that said multispecific antigen binding molecule and said at least one other anti-cancer agent are to be administered in combination to an individual for the purpose.
- the kit further comprises a pharmaceutically acceptable carrier.
- the kit may further comprise a sterile diluent, preferably stored in another additional container. That is, the kit further comprises a second (or tertiary) pharmaceutically acceptable buffer, such as Bacterial Bacterial Water for Injection (BWFI), phosphate-buffered saline, Ringer's solution, and dextrose solution. ) container.
- Kits in the present disclosure may also further include other commercially desirable or user-desirable equipment, such as other buffers, diluents, filters, needles, and syringes.
- the kit can further include instructions for combination therapy for treating or preventing cancer.
- the multispecific antigen-binding molecule and/or the anticancer agent can be filled in a container.
- kits in the present disclosure are provided as commercial packages, eg, as therapeutic products.
- the kit may be a kit that is used only for the purpose of using the multispecific antigen-binding molecule of the present invention in combination with at least one other anticancer agent. As long as the kit is used in combination with a binding molecule and at least one other anticancer agent, the kit may also be used for other purposes. Other embodiments, such as the multispecific antigen binding molecule or the at least one other anti-cancer molecule, as long as the instructions or label of the kit of the present invention, for example, indicate administration to an individual in combination. Agents may be indicated for use alone.
- A, B, and/or C includes the following seven variations: (i) A, (ii) B, (iii) C, (iv) A and B, (v) A and C, (vi) B and C, (vii) A, B, and C.
- the indefinite articles “one (a)” and “one (an)” refer to the grammatical objects of one or more than one (that is, at least one) of the indefinite article.
- a (a) element means one element or more than one element.
- Example 1 Expression of CLDN6 in Various Cancer Tissues CLDN6 expression in various cancer tissues was compared based on TCGA (The Cancer Genome Atlas) data.
- CLDN6 is upregulated in ovarian cancer (Ovary), lung adenocarcinoma (non-small cell lung cancer, NSCLC), germinoma, and endometrial cancer (Uterus).
- ovarian cancer Ovary
- lung adenocarcinoma non-small cell lung cancer, NSCLC
- germinoma germinoma
- endometrial cancer Uterus
- Cholangiocarcinoma Cervix Uteri, Breast, Colorectal cancer (Colon and Rectum)
- Liver cancer Liver
- kidney cancer Kidney
- esophageal cancer Esophagus
- pancreatic cancer Pancreatic cancer
- stomach cancer Stomach
- bladder cancer Urinary Bladder
- H183L072 was used as a template for the variable region. More than 1,000 Dual-Fab variants were created by introducing single or multiple mutations. Antibodies were expressed using Expi293 (Invitrogen) and purified by Protein A purification, followed by gel filtration where required. The sequences of 15 representative variants with multiple mutations are listed in Table 1 and the binding kinetics were analyzed using a Biacore T200 instrument (GE Healthcare) at 25°C and/or as described below in Example 2.2.2. or evaluated at 37°C.
- Human CD137 extracellular domain (ECD) (SEQ ID NO: 179) with hexahistidine (His-tag) and biotin acceptor peptide (BAP) at its C-terminus was transiently transfected using FreeStyle293F cell line (Thermo Fisher). expressed in Culture supernatant expressing human CD137 ECD was loaded onto a HisTrap HP column (GE healthcare) and eluted with a buffer containing imidazole (Nacalai). Fractions containing human CD137 ECD were collected and subsequently applied to a Superdex 200 gel filtration column (GE healthcare) equilibrated with 1 ⁇ D-PBS. Fractions containing human CD137 ECD were then pooled and stored at -80°C.
- ECD extracellular domain
- His-tag hexahistidine
- BAP biotin acceptor peptide
- Binding affinities were determined by processing data and fitting to a 1:1 binding model using Biacore T200 Evaluation software, version 2.0 (GE Healthcare). CD137 binding affinity assays were performed under the same conditions except that the assay temperature was set at 37°C.
- H0868L581 was selected for co-crystal analysis with hCD137 protein.
- Bivalent antibodies were transiently transfected and expressed using the Expi293 Expression system (Thermo Fisher Scientific). Culture supernatants were harvested and antibodies were purified from the supernatants using MabSelect SuRe affinity chromatography (GE Healthcare) followed by gel filtration chromatography using Superdex200 (GE Healthcare).
- CD137 ectodomain was filtered on a tandemly connected gel filtration column (HiLoad 16/600 Superdex 200 pg, GE healthcare) and a protein A column (HiTrap MabSelect SuRe 1ml, GE Healthcare) followed by purification using Benzamidine Sepharose resin (GE Healthcare). Fractions containing the CD137 extracellular domain were pooled and stored at -80°C.
- Fab fragments of H0868L0581 and a known anti-CD137 control antibody (hereinafter referred to as 137Ctrl, heavy chain SEQ ID NO: 167, light chain SEQ ID NO: 168) were subjected to restriction digestion with Lys-C (Roche) followed by Using loading onto a Protein A column (MabSlect SuRe, GE Healthcare), a cation exchange column (HiTrap SP HP, GE Healthcare), and a gel filtration column (Superdex200 16/60, GE Healthcare) to remove Fc fragments , prepared by conventional methods. Fractions containing Fab fragments were pooled and stored at -80°C.
- X-ray diffraction data were measured by X06SA at SLS. During the measurement, the crystal was kept frozen by constantly placing it in a stream of nitrogen at -178°C, rotating the crystal 0.25 degrees at a time, using an Eiger X16M (DECTRIS) attached to the beamline. A total of 1440 X-ray diffraction images were collected. Determination of cell parameters, indexing of diffraction spots and processing of diffraction data obtained from diffraction images were performed using the autoPROC program (Acta. Cryst. 2011, D67: 293-302), the XDS Package (Acta. Cryst. 2010, D66 : 125-132), and AIMLESS (Acta.
- Crystallographic data statistics are shown in Table 3.
- the structure was determined by molecular replacement in the program Phaser (J. Appl. Cryst. 2007, 40: 658-674).
- Search models were derived from published crystal structures (PDB codes: 4NKI and 6MI2).
- the model was made with the Coot program (Acta Cryst. 2010, D66: 486-501) and refined with the programs Refmac5 (Acta Cryst. 2011, D67: 355-367) and PHENIX (Acta Cryst. 2010, D66: 213-221). turned into The crystallographic confidence factor (R) for diffraction intensity data from 77.585 to 3.705 Angstroms was 22.33% and the free R value was 27.50%. Structure refinement statistics are shown in Table 3.
- the crystal structure shows that L24-N30, particularly L24-S29, in CRD1 of CD137 bound to the pocket formed between the heavy and light chains of H0868L0581 Fab is the N-terminus of CD137. was shown to be deeply buried in a manner directed against the depth of the pocket.
- N39-I44 in CRD1 and G58-I64 in CRD2 in CD137 were recognized by the heavy chain CDRs of H0868L0581 Fab.
- CRD is the name for domains separated by structures formed by Cys-Cys, called CRD references as described in WO2015/156268.
- the present inventors identified an anti-human CD137 antibody that recognizes the N-terminal region of human CD137, particularly L24-N30, and also identified that antibodies against this region can activate CD137 on cells.
- Table 4 shows the target antigen of each Fv region in the trispecific antibody. The naming convention for each strand is shown in FIG. SEQ ID NOs are shown in Table 5. The sequence of each variable region is shown in Table 6.
- the Fc region was Fc ⁇ R silent and deglycosylated.
- FcRn-enhancing mutations Act5 (M428L, N434A, Q438R, S440E) were applied to improve the PK of the antibody.
- the engineering components applied to each antibody are shown in Tables 7-1 and 7-2, and details for FAST06, FAST22, and FAST30 are shown in Table 8. All antibodies were expressed in trispecific form by transient expression in Expi293 cells (Invitrogen) and purified according to Reference Example 1.
- 6PHU3/TR01 and KLH/TR01 contain the same CD3 binding Fv (heavy chain variable region SEQ ID NO: 188, light chain variable region SEQ ID NO: 189).
- the CLDN6 binding Fv of 6PHU3/TR01 contains the heavy chain variable region shown in SEQ ID NO:190 and the light chain variable region shown in SEQ ID NO:191.
- KLH/TR01 contains a KLH-binding Fv (heavy chain variable region SEQ ID NO: 186, light chain variable region SEQ ID NO: 187).
- Anti-CLDN6/CD3 bispecific antibody (CS3348) and five anti-CLDN6/CD3 bispecific antibodies against NIH:OVCAR-3 (high CLDN6 expressing ovarian cancer cell line) and A2780 and COV413A (low CLDN6 expressing ovarian cancer cell line) of anti-CLDN6/Dual-Fab trispecific antibodies (PPU4134, PPU4135, PPU4136, PPU4137, and PPU4138).
- the antibody sequences are shown in Table 9.
- Cytotoxic activity (%) (A - B - C) x 100 / (D - C) 'A' represents the average absorbance value of antibody and PBMC treated wells, 'B' represents the average absorbance value of wells with effector cell PBMCs only, and 'C' represents untreated target cells only. Represents the mean absorbance value of the wells and "D" represents the mean absorbance value of the wells with target cells lysed with Triton-X. In addition, cytotoxicity calculated in wells containing PBMC and target cells without antibody was set to 0%. All anti-CLDN6/Dual-Fab trispecific antibodies exhibited T-cell dependent cytotoxicity against CLDN6-expressing cells.
- a human CD137 knock-in (KI) mouse strain was generated by replacing the mouse endogenous Cd137 genomic region with the human CD137 genomic sequence using mouse embryonic stem cells.
- Human CD3 EDG replacement mice were established as a strain in which all three components of the CD3 complex, CD3e, CD3d and CD3g, have been replaced with their human counterparts CD3E, CD3D and CD3G (Scientific Rep. 2018; 8 : 46960).
- a CD137/CD3 double-humanized mouse strain was established by crossing human CD137 KI mice with human CD3 EDG replacement mice.
- Antibodies prepared in Example 4 are evaluated for their in vivo efficacy using a tumor-bearing model.
- the CD3/CD137 double-humanized mice established in Example 6, hereinafter referred to as "hCD3/hCD137 mice” are used.
- Cells with stable expression of human CLDN6 are implanted into hCD3/hCD137 mice, and hCD3/hCD137 mice with confirmed tumor formation are treated by administration of antibody.
- CLDN6-expressing cells (1 ⁇ 10 6 cells) are implanted into the inguinal subcutaneous area of hCD3/hCD137 mice. The day of transplantation is defined as day 0.
- mice are randomized and grouped according to their body weight and tumor size.
- antibodies are administered intravenously through the tail vein at 6 mg/kg.
- Antibodies are administered only once. Tumor volumes and body weights are measured every 3-4 days with an anti-tumor test system (ANTES version 7.0.0.0).
- CLDN6-expressing cells are implanted into the right flank of hCD3/hCD137 mice.
- mice are randomized into groups based on their tumor volume and body weight and injected i.v. with vehicle or antibody prepared in Example 3. Tumor volumes are measured twice weekly. Mice are bled 2 hours after treatment for IL-6 analysis. Plasma samples are analyzed by the Bio-Plex Pro Mouse Cytokine Th1 Panel according to the manufacturer's protocol.
- Cytotoxic activity of the anti-CLDN6/Dual-Fab trispecific antibody PPU4135 was assessed by a lactate dehydrogenase (LDH) release assay.
- Frozen PBMCs were washed by CTL anti-aggregate wash and RPMI-1640 medium containing 10% FBS (SIGMA) (referred to as 10% FBS/RPMI) to reduce PBMCs to 3 ⁇ 10 6 cells/mL. It was adjusted. These PBMC were used as effector cells.
- Target cells were detached from culture flasks and seeded in U-bottom clear 96-well plates (Corning) at 100 ⁇ L/well at 1.5 ⁇ 10 4 cells. 50 ⁇ L of human PMBC solution (1.5 ⁇ 10 5 cells) and 50 ⁇ L of prepared antibody at concentrations selected from 0.004, 0.04, 0.4, 4, or 40 nM were added into each well.
- T cell-dependent proliferation inhibition mediated by the anti-CLDN6/Dual-Fab trispecific antibody was evaluated by a cell proliferation assay using the xCELLigence RTCA MP instrument (ACEA Biosciences).
- Human CLDN6-expressing human ovarian cancer cell line NIH:OVCAR-3 (ATCC) and human lung cancer cell line NCI-H1435 (ATCC) were used as target cells.
- peripheral blood mononuclear cell hereinafter referred to as PBMC
- PBMC peripheral blood mononuclear cell
- CGI Cell growth inhibition rate
- T cell activation through CD3 binding by the anti-CLDN6/Dual-Fab trispecific antibody was measured by a luciferase assay system using GloResponse NFAT-luc2 Jurkat cells (Promega, J1601) as effector cells.
- Human ovarian cancer cell line OVCAR-3 (ATCC) and lung adenocarcinoma cell line NCI-H1435 (ATCC) were used as cells endogenously expressing claudin-6.
- Human bladder cancer cell line 5637 (ATCC) was used as CLDN6-negative cells.
- Assays were performed as follows. First, the cancer cell lines were detached from culture flasks and plated at 25 ⁇ L/well (2 ⁇ 10 4 cells) in white flat-bottomed 96-well plates (Coster #3917). 1 ⁇ 10 5 Jurkat/NFAT-RE reporter cell lines were then added at 25 ⁇ L/well each with antibody at concentrations selected from 0.003, 0.03, 0.3, 3, or 30 nM. After overnight incubation at 37° C., Bio-Glo reagent (Promega #G7941) was added at 75 ⁇ L/well followed by further incubation for 10 minutes at room temperature. Luminescence generated from activated Jurkat cells was then measured by EnSpire (PerkinElmer Japan). The luminescence fold for each well was calculated by making a comparison between wells with antibody and wells without antibody.
- Example 12 NF ⁇ B activation in a Jurkat reporter cell line expressing human 4-1BB and luciferase co-cultured with CLDN6-expressing tumor cells
- NF ⁇ B activation through CD137 binding by the anti-CLDN6/Dual-Fab trispecific antibody was evaluated using GloResponseTM NF ⁇ B luc2/4-1BB Jurkat (Promega, CS196004).
- Human ovarian cancer cell line OVCAR-3 (ATCC) and lung adenocarcinoma cell line NCI-H1435 (ATCC) were used as cells endogenously expressing claudin-6.
- Human bladder cancer cell line 5637 was used as CLDN6-negative cells.
- Assays were performed as follows. First, the cancer cell lines described above were detached from culture flasks and plated at 25 ⁇ L/well (2.5 ⁇ 10 4 cells) in white flat bottom 96-well plates (Coster #3917). 5 ⁇ 10 4 NF ⁇ B luc2/4-1BB Jurkat reporter cell lines were then transferred and mixed with 25 ⁇ l media containing increasing amounts of antibody. Assay plates were incubated at 37° C. for 6 hours, then Bio-Glo reagent (Promega #G7941) was added at 75 ⁇ L/well, followed by an additional incubation for 10 minutes at room temperature. Luminescence generated from activated Jurkat cells was then measured by EnVision (PerkinElmer Japan). The fold emission of each well was calculated by comparing wells with each antibody (0.003, 0.03, 0.3, 3, and 30 nM) to wells without antibody.
- NF ⁇ B activation by all antibodies was observed in a dose-dependent manner. In particular, much higher activation was confirmed in the presence of the anti-CLDN6/Dual-Fab trispecific antibody. On the other hand, in the presence of claudin-6-negative cell line 5637, no activation was observed even at high antibody concentrations.
- anti-CLDN6/Dual-Fab trispecific antibody was administered intravenously.
- the anti-CLDN6/Dual-Fab trispecific antibody was administered only once.
- Example 14 Toxicity study of anti-CLDN6/Dual-Fab trispecific antibody
- the potential toxicity of PPU4135 antibody was investigated in toxicity studies using cynomolgus monkey CS3348 antibody (anti CLDN6/CD3 bispecific antibody). Both the PPU4135 and CS3348 antibodies cross-react with their antigens in cynomolgus monkeys, thus cynomolgus monkeys were selected as the animal species for evaluation in in vivo toxicity studies.
- a summary of the single dose toxicity studies is shown in Table 11.
- IV intravenous
- AST aspartate aminotransferase
- ALT aslanine aminotransferase
- GLDH glutamate dehydrogenase
- TBA total bile acids
- CRP C-reactive protein
- Example 15 Characterization of Anti-CLDN6/Dual-Fab Trispecific Antibodies Binding Affinity of Anti-CLDN6/Dual-Fab Trispecific Antibodies to Human and Cynomolgus Monkey (cyno) CLDN6 VLPs (Virus-Like Particles) at pH 7.4 was determined at 25° C. using a Biacore T200 instrument (GE Healthcare). An anti-human CD81 (BD Pharmingen) antibody was immobilized on all flow cells of the C1 sensor chip using an amine coupling kit (GE Healthcare). Human and cynomolgus CLDN6 VLPs were captured on the sensor surface by anti-human CD81 antibodies.
- Each VLP was diluted 5-fold with buffer (20 mM Na phosphate, 150 mM NaCl, 0.1 mg/mL BSA, 0.005% NaN3 , pH 7.4).
- Test antibodies were prepared in buffer (20 mM Na phosphate, 150 mM NaCl, 0.1 mg/mL BSA, 0.005% NaN3 , pH 7.4).
- Anti-CLDN6/Dual-Fab trispecific antibody was injected at 50 and 200 nM followed by dissociation. The sensor surface was regenerated with 0.1% SDS and 100 mM H3PO4 after each cycle.
- Table 12 the binding affinity of PPU4135 for cynomolgus CLDN6 is comparable to that for human CLDN6. Binding affinities were determined by processing data and fitting to a 1:1 binding model using Biacore T200 Evaluation software, version 2.0 (GE Healthcare).
- Binding affinities of anti-CLDN6/Dual-Fab trispecific antibodies to recombinant human and cynomolgus monkey CD3eg ( ⁇ and ⁇ subunits of CD3) at pH 7.4 were determined at 25°C using a Biacore 8K instrument (GE Healthcare). bottom. Binding affinities of anti-CLDN6/Dual-Fab trispecific antibodies to recombinant human and cynomolgus monkey CD137 at pH 7.4 were determined at 37°C using a Biacore 8K instrument (GE Healthcare). An anti-human Fc (GE Healthcare) antibody was immobilized on all flow cells of the CM4 sensor chip using an amine coupling kit (GE Healthcare).
- Test antibodies and analytes were prepared in ACES pH 7.4 containing 20 mM ACES, 150 mM NaCl, 0.05% Tween 20, 0.005% NaN3 .
- Anti-CLDN6/Dual-Fab trispecific antibody was captured on the sensor surface by anti-human Fc. The antibody capture level was aimed at 300 resonance units (RU).
- Recombinant CD3eg and CD137 were injected at both 500 and 2000 nM, followed by dissociation. The sensor surface was regenerated with 3M MgCl2 after each cycle.
- Table 12 the binding affinities of PPU4135 for cynomolgus CD3eg and cynomolgus CD137 are comparable to those for human CD3eg and CD137, respectively. Binding affinities were determined by processing data and fitting to a 1:1 binding model using Biacore Insight Evaluation software (GE Healthcare).
- Example 16 In vivo efficacy evaluation test in peritoneal dissemination model Anti-CLDN6/Dual-Fab trispecific antibody CS4135 against peritoneal metastasis of ovarian cancer (the same antibody as PPU4135 described in Table 9 of Example 6 above) In order to evaluate the efficacy of the drug, we evaluated the drug efficacy using a mouse peritoneal dissemination model.
- Human ovarian cancer cell line OV-90 (ATCC) was used as target cells.
- NOD/ShiJic-scid Jcl mice were intraperitoneally implanted with 5 ⁇ 10 6 cells/500 ⁇ L/mouse of OV-90 cells.
- FIG. 15 shows the survival rate of each group.
- the solvent-administered group some mice showed worsening of condition from 48 days after transplantation, and the deterioration of condition was observed in all mice up to 55 days after transplantation.
- the CS4135 antibody-administered group some mice exhibited worsening of condition from 57 days after transplantation, but the survival rate was 78% at 66 days after transplantation and 22% at 80 days after transplantation. A 50% survival rate was 71 days after transplantation.
- cisplatin CDDP, Nichi-Iko
- CBDCA carboplatin
- Fig. 16 shows the results of FACS analysis of CLDN6 expression in various cells treated with cisplatin or carboplatin for 5 days and in various untreated cells. It was confirmed that the expression of CLDN6 was increased in all cells by the action of cisplatin and carboplatin. That is, it was confirmed that cisplatin and carboplatin are agents that enhance the expression of CLDN6 in cancer cells.
- Assays were performed as follows. First, OVCAR3 and H1435 cells treated with chemotherapeutic agents for 5 days as described above were detached from culture flasks and plated at 25 ⁇ L/well (2 ⁇ 10 4 cells) in white flat bottom 96-well plates (Coster #3917). . 1 ⁇ 10 5 Jurkat/NFAT-RE reporter cell lines were then added at 25 ⁇ L/well each with CS4135 antibody at concentrations selected from 0.003, 0.03, 0.3, 3, or 30 nM. After overnight incubation at 37° C., Bio-Glo reagent (Promega #G7941) was added at 75 ⁇ L/well followed by further incubation for 10 minutes at room temperature. Luminescence generated from activated Jurkat cells was then measured by EnSpire (PerkinElmer Japan). The luminescence fold for each well was calculated by making a comparison between wells with antibody and wells without antibody.
- Fig. 17 shows the results of analyzing the ability of CS4135 to activate T cells via CD3 in cells treated with cisplatin or carboplatin for 5 days and untreated cells by Jurkat luciferase assay. Cells treated with cisplatin or carboplatin for 5 days were confirmed to have enhanced T cell activation ability by CS4135, suggesting that chemotherapeutic agents may enhance the cytotoxicity of CS4135.
- CLDN6-specific primers Power SYBR (registered trademark) Green Master Mix, ThermoFisher
- hCLDN6-1 GGG TGG ACG TCT TAT CAG GA (SEQ ID NO: 206)
- hCLDN6-2 GAG CTC CTC TCT TCA CCC CT (SEQ ID NO: 207)
- hGAPDH-F GAG TCC ACT GGC
- GTC TTC AC SEQ ID NO: 208
- hGAPDH-R ATC TTG AGG CTG TTG TCA TAC TT (SEQ ID NO: 209)
- Fig. 18 shows that mice engrafted with SNG-M tumors were administered vehicle or carboplatin twice at 40 mg/kg and 80 mg/kg, then the tumors were harvested and the expression of CLDN6 in the tumors was determined by qPCR. This is the result of analysis. It was confirmed that the expression of CLDN6 in the tumor was elevated in the carboplatin-administered group compared to the vehicle-administered group.
- Tumor volumes were measured 13, 16, 20, 23, 26 and 30 days after transplantation, and the average tumor volume for each group is shown. The tumor volume was calculated by the following formula.
- Tumor volume (mm 3 ) major axis (mm) x minor axis (mm) x minor axis (mm)/2
- Tumor growth inhibition was calculated by the following formula.
- the TGI of the CS4135 antibody and carboplatin combination administration group was 65%, but the TGI of the CS4135 antibody single-agent administration group and carboplatin single-agent administration group were 35% and 44%, respectively. Therefore, it was shown that the combined administration group of CS4135 antibody and carboplatin had a stronger anti-tumor effect than the group administered CS4135 antibody single agent and carboplatin single agent administration group (Fig. 19, Table 14).
- the OVCAR3 cell line was subcutaneously implanted into the right flank of mice, and grouping was performed 38 days after implantation. Individuals with a tumor volume of 119-210 mm 3 were used for grouping. Vehicle 1 and CS4135 were administered into the tail vein of mice 38 and 45 days after transplantation. PBS containing 0.05% Tween-20 was used as solvent 1. Vehicle 2 and carboplatin (Bristol-Myers Squibb Co.) were intraperitoneally administered to mice 38 and 45 days after transplantation. Physiological saline was used as solvent 2.
- Tumor volume was measured 38, 42, 45, 48, 52 and 56 days after transplantation, and the mean tumor volume for each group is shown. The tumor volume was calculated by the following formula.
- Tumor volume (mm 3 ) major axis (mm) x minor axis (mm) x minor axis (mm)/2
- Tumor growth inhibition was calculated by the following formula.
- the TGI of the CS4135 antibody and carboplatin combination administration group was 180%, while the TGI of the CS4135 antibody single agent group and the carboplatin single agent group were 18% and -9%, respectively. rice field. Therefore, the CS4135 antibody and carboplatin combination group was shown to have stronger and synergistic anti-tumor effects than the CS4135 antibody single-agent administration group and the carboplatin single-agent administration group (FIG. 20, Table 16).
- CS4135 was administered continuously after carboplatin administration, the TGI 56 days after transplantation was 180%, similar to the carboplatin and CS4135 co-administration group. Therefore, CS4135 was shown to have similar effects not only when co-administered with carboplatin, but also when administered sequentially after carboplatin administration (Fig. 21, Table 16).
- Example 18 Efficacy evaluation test for combination of anti-CLDN6/Dual-Fab trispecific antibody CS4135 and immune checkpoint inhibitor 18.1.1 Preparation of cell lines and syngenic transplantation models, and methods for evaluating antitumor activity (described in Example 7) was used.
- the CLDN6-LLC1 cell line was subcutaneously transplanted into the right flank of mice, and grouping was performed 7 days after transplantation. Individuals with tumor volumes of 262-353 mm 3 were used for grouping. Vehicle and CS4135 were administered into the mouse tail vein 8 days after transplantation. PBS containing 0.05% Tween-20 was used as solvent.
- Tumor volumes were measured 7, 10, and 14 days after transplantation, and the average tumor volume of each group was shown. The tumor volume was calculated by the following formula.
- Tumor volume (mm 3 ) major axis (mm) ⁇ minor axis (mm) ⁇ minor axis (mm)/2
- Tumor growth inhibition was calculated by the following formula.
- TV change (mm 3 ) tumor volume 14 days after transplantation - tumor volume at the time of grouping
- TGI (%) (1 - (average TV change for each group/average TV change for vehicle control group)) x 100
- the results are shown in Fig. 22.
- the TGI of the CS4135-administered group 14 days after transplantation was 71%.
- Tumor volumes were measured 6, 10, 12, 14 and 17 days after transplantation, and the average tumor volume for each group is shown. The tumor volume was calculated by the following formula.
- Tumor volume (mm 3 ) major axis (mm) ⁇ minor axis (mm) ⁇ minor axis (mm)/2
- Tumor growth inhibition was calculated by the following formula.
- TV change (mm 3 ) tumor volume 17 days after transplantation - tumor volume at grouping
- TGI (%) (1 - (mean value of TV change for each group/mean value of TV change for vehicle control group)) ⁇ 100
- the TGI of the CS4135 antibody and anti-mouse PD-L1 antibody combined administration group was 108%, but the TGI of the CS4135 antibody single-agent administration group and the anti-mouse PD-L1 antibody single-agent administration group were respectively 71%, -1%. Therefore, the combined administration group of CS4135 antibody and anti-mouse PD-L1 antibody was shown to have a stronger and synergistic anti-tumor effect than the CS4135 antibody single-agent administration group and the anti-mouse PD-L1 antibody single-agent administration group. (Fig. 24, Table 20).
- FIG. 25 shows the fluorescence values of the target cells collected from the wells added with each concentration of olaparib when the fluorescence value of the target cells collected from the control well is set to 1.
- BRCA1-deficient ovarian cancer cell line UWB1.289 (ATCC) or BRAC1 wild-type ovarian cancer cell line OV-90 (ATCC) expressing human CLDN6 were used as target cells. 3 ⁇ 10 5 of each target cell was seeded in 5 mL in a 25 cm 2 flask. Two flasks were prepared. After overnight culture, olaparib was added to one flask to a final concentration of 3 ⁇ M. DMSO was added to the other flask. After culturing the flask for 3 days, the target cells were collected and the cytotoxic activity of the CS4135 antibody was evaluated by a lactate dehydrogenase (LDH) release assay using human PBMC as effector cells.
- LDH lactate dehydrogenase
- Example 20 Mechanistic analysis of CS4135 antibody using real-time cell growth inhibition assay (xCELLigence assay) The mechanism of T cell-dependent growth inhibition mediated by anti-CLDN6/Dual-Fab trispecific antibody was analyzed using the xCELLigence RTCA MP instrument ( were analyzed by cell proliferation assay using ACEA Biosciences).
- Spleens of hCD3 transgenic mice and hCD3/hCD137 knock-in mice were aseptically collected. Spleens were ground in RPMI-1640 medium containing 10% FBS, passed through a 70 ⁇ m Cell strainer, and splenocytes were isolated by centrifugation (1200 rpm for 10 minutes at room temperature). The isolated spleen cells were hemolyzed, and only T cells were separated using CD3 MicroBeads (Miltenyi Biotec) and used as effector cells.
- E-Plate 96 plates (Roche Diagnostics) at 50 ⁇ L/well to measure background, followed by plating 5 ⁇ 10 3 target cells at 50 ⁇ L/well. After overnight culture, 1 nM (final concentration) of CS4135 and KLH/CD137 bispecific antibodies selected from 100 nM and 500 nM (final concentration) were added at 25 ⁇ L/well, respectively. An additional 2.5 ⁇ 10 4 effector cells were added at 50 ⁇ L/well. During plate incubation, cell growth was monitored using xCELLigence every 10 minutes for 48 hours.
- CGI Cell growth inhibition rate
- CGI (%) 100 - (CI Ab x 100 / CI NoAb ) was determined from the Cell Index value according to the formula given as "CI Ab " represents the Cell Index value of wells with antibody at a particular experimental time, and "CI NoAb " represents the average Cell Index value of wells without antibody at the same experimental time. Each Cell Index value was corrected by setting the Cell Index value of each well to 1 before addition of antibody and effector cells.
- Heavy and light chain variable regions were cloned into expression vectors containing heavy and light chain constant regions with respective mutations for heterodimerization.
- antibody was transiently expressed using Expi293F cells (Life technologies) according to the manufacturer's instructions. rice field. First, the culture medium containing recombinant antibody was purified with MabSelect Sure (GE healthcare) column and eluted with 50 mM acetic acid. Eluted antibodies were neutralized with 1.5 M Tris HCl/1 M Arginine HCl buffer.
- the ProA eluate was then loaded onto a cation exchange HiTrap SP-HP (GE healthcare) column in 20 mM sodium phosphate, pH 6 buffer and eluted with 20 mM sodium phosphate, 1 M NaCl, pH 6 buffer. Fractions containing the bispecific antibody were pooled and concentrated. To remove high and/or low molecular weight components, size exclusion chromatography was performed on a Superdex 200 column (GE healthcare) in P1 buffer (20 mM histidine, 150 mM arginine, 162.1 mM Asp, pH 6.0). was carried out using The purified bispecific antibody was concentrated and stored in a -80°C freezer.
- HiTrap SP-HP GE healthcare
- Claudin family proteins have two extracellular domains that are accessible to antibodies. Regarding the amino acid sequence similarity between the extracellular domains of human CLDN6 and human CLDN9, the first extracellular domain is nearly identical and the second extracellular domain has only two different amino acids (Fig. 18). ). Glutamine at position 156 of human claudin-6 (position 156 in the sequence shown in SEQ ID NO: 196 or 197) was replaced with leucine to create a human CLDN6 mutant containing the same amino acid at position 156 as human claudin-9. bottom. This human CLDN6 mutant was named hCLDN6 (Q156L) (SEQ ID NO: 205). Ba/F3 transfectants stably expressing hCLDN6(Q156L) were generated using methods similar to those described above. The established Ba/F3 transfectant was named hCLDN6(Q156L)/BaF.
- Human and murine CLDN3, 4 by introducing expression vectors for human and murine CLDN (including CLDN6, CLDN9, CLDN3, and CLDN4) into FreeStyleTM 293-F cells (Invitrogen) using 293fectin (Invitrogen).
- FreeStyleTM 293-F transfectant cells transiently expressing , 6, and 9 were generated.
- the generated FreeStyleTM 293-F transfectant cells were labeled with hCLDN3/FS293, hCLDN4/FS293, hCLDN6/FS293, hCLDN9/FS293, mCLDN3/FS293, mCLDN4/FS293, mCLDN6/FS293, and mCLDN9/FS293, respectively. named.
- anticancer agents comprising multispecific antigen binding molecules capable of binding CD3 and CD137 (4-1BB), capable of binding either CD3 or CD137, and capable of binding CLDN6 , a combination therapy of the anticancer agent and at least one other anticancer agent, and a pharmaceutical composition for use in the combination therapy.
- Multispecific antigen-binding molecules contained in anti-cancer agents, pharmaceutical compositions, combinations, kits of the disclosure, or used in the methods or uses of the disclosure are suitable for various cancers, particularly CLDN6-positive cancers, etc. It can be used to target cells expressing CLDN6 for use in immunotherapy to treat cancers associated with CLDN6.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2022578651A JPWO2023053282A1 (https=) | 2021-09-29 | 2021-09-29 | |
| PCT/JP2021/035917 WO2023053282A1 (ja) | 2021-09-29 | 2021-09-29 | がんの治療に用いるための細胞傷害誘導治療剤 |
| US18/696,616 US20240425589A1 (en) | 2021-09-29 | 2022-09-28 | Cytotoxicity-inducing therapeutic agent for use in treatment of cancer |
| AU2022357831A AU2022357831A1 (en) | 2021-09-29 | 2022-09-28 | Cytotoxicity-inducing therapeutic agent for use in treatment of cancer |
| IL311629A IL311629A (en) | 2021-09-29 | 2022-09-28 | Cytotoxic therapeutic agent for use in cancer treatment |
| TW111136721A TW202330630A (zh) | 2021-09-29 | 2022-09-28 | 用於癌症之治療的細胞毒性誘導治療劑 |
| MX2024003918A MX2024003918A (es) | 2021-09-29 | 2022-09-28 | Agente terapeutico que induce citotoxicidad para usarse en terapia del cancer. |
| PCT/JP2022/036060 WO2023054421A1 (ja) | 2021-09-29 | 2022-09-28 | がんの治療に用いるための細胞傷害誘導治療剤 |
| KR1020220122937A KR102747409B1 (ko) | 2021-09-29 | 2022-09-28 | 암의 치료에 이용하기 위한 세포 상해 유도 치료제 |
| CA3233531A CA3233531A1 (en) | 2021-09-29 | 2022-09-28 | Cytotoxicity-inducing therapeutic agent for use in treatment of cancer |
| EP22876287.8A EP4410308A4 (en) | 2021-09-29 | 2022-09-28 | CYTOTOXICITY-INDUCING THERAPEUTIC AGENT FOR USE IN THE TREATMENT OF CANCER |
| CN202280076512.9A CN118284432A (zh) | 2021-09-29 | 2022-09-28 | 用于治疗癌症的细胞毒性-诱导治疗剂 |
| KR1020240193841A KR20250007466A (ko) | 2021-09-29 | 2024-12-23 | 암의 치료에 이용하기 위한 세포 상해 유도 치료제 |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/JP2021/035917 WO2023053282A1 (ja) | 2021-09-29 | 2021-09-29 | がんの治療に用いるための細胞傷害誘導治療剤 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023053282A1 true WO2023053282A1 (ja) | 2023-04-06 |
Family
ID=85781545
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2021/035917 Ceased WO2023053282A1 (ja) | 2021-09-29 | 2021-09-29 | がんの治療に用いるための細胞傷害誘導治療剤 |
| PCT/JP2022/036060 Ceased WO2023054421A1 (ja) | 2021-09-29 | 2022-09-28 | がんの治療に用いるための細胞傷害誘導治療剤 |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2022/036060 Ceased WO2023054421A1 (ja) | 2021-09-29 | 2022-09-28 | がんの治療に用いるための細胞傷害誘導治療剤 |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240425589A1 (https=) |
| EP (1) | EP4410308A4 (https=) |
| JP (1) | JPWO2023053282A1 (https=) |
| KR (2) | KR102747409B1 (https=) |
| CN (1) | CN118284432A (https=) |
| AU (1) | AU2022357831A1 (https=) |
| CA (1) | CA3233531A1 (https=) |
| IL (1) | IL311629A (https=) |
| MX (1) | MX2024003918A (https=) |
| TW (1) | TW202330630A (https=) |
| WO (2) | WO2023053282A1 (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12049502B2 (en) | 2022-11-30 | 2024-07-30 | Integral Molecular, Inc. | Antibodies directed to claudin 6, including bispecific formats thereof |
| WO2024227424A1 (zh) * | 2023-04-30 | 2024-11-07 | 泰诚思(上海)生物医药有限公司 | hCLDN6的抗原结合蛋白和其用途 |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR102813659B1 (ko) | 2013-11-11 | 2025-05-28 | 추가이 세이야쿠 가부시키가이샤 | 개변된 항체 가변영역을 포함하는 항원 결합 분자 |
| MX2022000111A (es) * | 2019-07-10 | 2022-02-10 | Chugai Pharmaceutical Co Ltd | Moleculas de union a claudina-6 y usos de las mismas. |
Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016500059A (ja) * | 2012-11-13 | 2016-01-07 | バイオエヌテック アーゲーBioNTech AG | クローディンを発現するガン疾患を処置するための剤 |
| WO2019111871A1 (en) * | 2017-12-05 | 2019-06-13 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region binding cd3 and cd137 |
| WO2019135404A1 (en) * | 2018-01-05 | 2019-07-11 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
| WO2020067419A1 (en) * | 2018-09-28 | 2020-04-02 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules capable of binding cd3 and cd137 but not simultaneously |
| WO2020067399A1 (en) * | 2018-09-28 | 2020-04-02 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region |
| JP2021168648A (ja) * | 2020-03-31 | 2021-10-28 | 中外製薬株式会社 | クローディン6を標的とする多重特異性抗原結合分子およびその使用 |
Family Cites Families (62)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773719A (en) | 1966-12-06 | 1973-11-20 | Hoffmann La Roche | 2-aminoxy-2'-acyl-acetanilide |
| IE52535B1 (en) | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| HUT35524A (en) | 1983-08-02 | 1985-07-29 | Hoechst Ag | Process for preparing pharmaceutical compositions containing regulatory /regulative/ peptides providing for the retarded release of the active substance |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5260203A (en) | 1986-09-02 | 1993-11-09 | Enzon, Inc. | Single polypeptide chain binding molecules |
| EP0281604B1 (en) | 1986-09-02 | 1993-03-31 | Enzon Labs Inc. | Single polypeptide chain binding molecules |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| EP0368684B2 (en) | 1988-11-11 | 2004-09-29 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| EP1400536A1 (en) | 1991-06-14 | 2004-03-24 | Genentech Inc. | Method for making humanized antibodies |
| GB9114948D0 (en) | 1991-07-11 | 1991-08-28 | Pfizer Ltd | Process for preparing sertraline intermediates |
| US7018809B1 (en) | 1991-09-19 | 2006-03-28 | Genentech, Inc. | Expression of functional antibody fragments |
| FI941572A7 (fi) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenete lmä |
| CA2372813A1 (en) | 1992-02-06 | 1993-08-19 | L.L. Houston | Biosynthetic binding protein for cancer marker |
| DE122009000068I2 (de) | 1994-06-03 | 2011-06-16 | Ascenion Gmbh | Verfahren zur Herstellung von heterologen bispezifischen Antikörpern |
| US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
| ATE299938T1 (de) | 1997-05-02 | 2005-08-15 | Genentech Inc | Ein verfahren zur herstellung multispezifischer antikörper die heteromultimere und gemeinsame komponenten besitzen |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| ATE375365T1 (de) | 1998-04-02 | 2007-10-15 | Genentech Inc | Antikörper varianten und fragmente davon |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| PL209392B1 (pl) | 1999-01-15 | 2011-08-31 | Genentech Inc | Przeciwciało, komórka gospodarza, sposób wytwarzania przeciwciała oraz zastosowanie przeciwciała |
| US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
| ES2248127T3 (es) | 1999-10-04 | 2006-03-16 | Medicago Inc. | Metodo para regular la transcripcion de genes foraneos en presencia de nigtrogeno. |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
| US7871607B2 (en) | 2003-03-05 | 2011-01-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
| JO3000B1 (ar) | 2004-10-20 | 2016-09-05 | Genentech Inc | مركبات أجسام مضادة . |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2006132352A1 (ja) | 2005-06-10 | 2006-12-14 | Chugai Seiyaku Kabushiki Kaisha | sc(Fv)2を含有する医薬組成物 |
| EP2009101B1 (en) | 2006-03-31 | 2017-10-25 | Chugai Seiyaku Kabushiki Kaisha | Antibody modification method for purifying bispecific antibody |
| ES2593484T3 (es) | 2007-03-29 | 2016-12-09 | Genmab A/S | Anticuerpos biespecíficos y métodos de producción de los mismos |
| EP2241578B1 (en) | 2008-01-11 | 2016-04-20 | The University of Tokyo | Anti-cldn6 antibody |
| EP2669298A3 (en) | 2008-05-23 | 2014-02-26 | Ablexis, LLC | Single variable immunoglobulin domain comprising VL-DH-JL |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| DK3305813T3 (da) | 2009-11-11 | 2020-04-20 | Astellas Pharma Inc | Antistoffer, der er specifikke for claudin 6 (cldn6) |
| HRP20241208T1 (hr) | 2010-04-20 | 2024-11-22 | Genmab A/S | Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju |
| EP2404936A1 (en) | 2010-07-06 | 2012-01-11 | Ganymed Pharmaceuticals AG | Cancer therapy using CLDN6 target-directed antibodies in vivo |
| CN103261220B (zh) | 2010-08-16 | 2016-06-15 | 诺夫免疫股份有限公司 | 用于生成多特异性和多价抗体的方法 |
| ES2758994T3 (es) | 2010-11-05 | 2020-05-07 | Zymeworks Inc | Diseño anticuerpo heterodimérico estable con mutaciones en el dominio Fc |
| ES2692268T5 (en) | 2011-03-29 | 2025-02-26 | Roche Glycart Ag | Antibody fc variants |
| ES2989943T3 (es) | 2011-05-13 | 2024-11-28 | Astellas Pharma Inc | Anticuerpos para el tratamiento de un cáncer que expresa la Claudina 6 |
| CN109134658B (zh) | 2011-10-31 | 2022-10-14 | 中外制药株式会社 | 控制了重链与轻链的缔合的抗原结合分子 |
| BR112014010580B1 (pt) | 2011-11-04 | 2021-01-12 | Zymeworks, Inc. | constructo de fc heteromultimérico isolado, composição, uso de um constructo de fc heteromultimérico isolado, composição de ácido nucléico e método para expressar o constructo de fc heteromultimérico isolado |
| IN2015DN01299A (https=) | 2012-07-23 | 2015-07-03 | Zymeworks Inc | |
| WO2014075697A1 (en) * | 2012-11-13 | 2014-05-22 | Biontech Ag | Agents for treatment of claudin expressing cancer diseases |
| EP3738611B1 (en) * | 2013-07-31 | 2025-09-03 | BioNTech SE | Diagnosis and therapy of cancer involving cancer stem cells |
| RU2016122041A (ru) | 2013-11-06 | 2017-12-11 | ЭББВИ СТЕМСЕНТРКС ЭлЭлСи | Новые анти-клаудин антитела и способы их применения |
| CA3124228C (en) | 2014-03-21 | 2024-05-14 | Regeneron Pharmaceuticals, Inc. | Non-human animals that make single domain binding proteins |
| AU2015244814B2 (en) | 2014-04-07 | 2020-12-24 | Chugai Seiyaku Kabushiki Kaisha | Immunoactivating antigen-binding molecule |
| MX2016014434A (es) | 2014-05-13 | 2017-02-23 | Chugai Pharmaceutical Co Ltd | Molecula de union a antigeno redirigida a celulas t para celulas que tienen funcion de inmunosupresion. |
| MA54955A (fr) * | 2019-02-15 | 2021-12-22 | Integral Molecular Inc | Anticorps anti-claudine 6 et leurs utilisations |
| US20220177583A1 (en) * | 2019-03-20 | 2022-06-09 | The Regents Of The University Of California | Claudin-6 bispecific antibodies |
| CA3139180A1 (en) * | 2019-03-27 | 2020-10-01 | Daiichi Sankyo Company, Limited | Combination of antibody-pyrrolobenzodiazepine derivative conjugate and parp inhibitor |
-
2021
- 2021-09-29 WO PCT/JP2021/035917 patent/WO2023053282A1/ja not_active Ceased
- 2021-09-29 JP JP2022578651A patent/JPWO2023053282A1/ja active Pending
-
2022
- 2022-09-28 WO PCT/JP2022/036060 patent/WO2023054421A1/ja not_active Ceased
- 2022-09-28 CN CN202280076512.9A patent/CN118284432A/zh not_active Withdrawn
- 2022-09-28 CA CA3233531A patent/CA3233531A1/en active Pending
- 2022-09-28 AU AU2022357831A patent/AU2022357831A1/en active Pending
- 2022-09-28 IL IL311629A patent/IL311629A/en unknown
- 2022-09-28 EP EP22876287.8A patent/EP4410308A4/en not_active Withdrawn
- 2022-09-28 KR KR1020220122937A patent/KR102747409B1/ko active Active
- 2022-09-28 US US18/696,616 patent/US20240425589A1/en active Pending
- 2022-09-28 MX MX2024003918A patent/MX2024003918A/es unknown
- 2022-09-28 TW TW111136721A patent/TW202330630A/zh unknown
-
2024
- 2024-12-23 KR KR1020240193841A patent/KR20250007466A/ko not_active Withdrawn
Patent Citations (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2016500059A (ja) * | 2012-11-13 | 2016-01-07 | バイオエヌテック アーゲーBioNTech AG | クローディンを発現するガン疾患を処置するための剤 |
| WO2019111871A1 (en) * | 2017-12-05 | 2019-06-13 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region binding cd3 and cd137 |
| WO2019135404A1 (en) * | 2018-01-05 | 2019-07-11 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
| WO2020067419A1 (en) * | 2018-09-28 | 2020-04-02 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules capable of binding cd3 and cd137 but not simultaneously |
| WO2020067399A1 (en) * | 2018-09-28 | 2020-04-02 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule comprising altered antibody variable region |
| JP2021168648A (ja) * | 2020-03-31 | 2021-10-28 | 中外製薬株式会社 | クローディン6を標的とする多重特異性抗原結合分子およびその使用 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12049502B2 (en) | 2022-11-30 | 2024-07-30 | Integral Molecular, Inc. | Antibodies directed to claudin 6, including bispecific formats thereof |
| WO2024227424A1 (zh) * | 2023-04-30 | 2024-11-07 | 泰诚思(上海)生物医药有限公司 | hCLDN6的抗原结合蛋白和其用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4410308A1 (en) | 2024-08-07 |
| AU2022357831A1 (en) | 2024-04-11 |
| KR20230047009A (ko) | 2023-04-06 |
| KR20250007466A (ko) | 2025-01-14 |
| JPWO2023053282A1 (https=) | 2023-04-06 |
| CN118284432A (zh) | 2024-07-02 |
| IL311629A (en) | 2024-05-01 |
| KR102747409B1 (ko) | 2024-12-27 |
| MX2024003918A (es) | 2024-04-26 |
| TW202330630A (zh) | 2023-08-01 |
| WO2023054421A1 (ja) | 2023-04-06 |
| US20240425589A1 (en) | 2024-12-26 |
| EP4410308A4 (en) | 2025-10-08 |
| CA3233531A1 (en) | 2023-04-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6175590B1 (ja) | 癌の治療に用いるための細胞傷害誘導治療剤 | |
| JP2022122972A (ja) | Dll3標的多重特異性抗原結合分子およびその使用 | |
| TWI900776B (zh) | 密連蛋白6靶向多特異性抗原結合分子及其用途 | |
| KR102747409B1 (ko) | 암의 치료에 이용하기 위한 세포 상해 유도 치료제 | |
| TW202204410A (zh) | 免疫活化多特異性抗原結合分子及其用途 | |
| KR20230047520A (ko) | Dll3 표적 다중 특이성 항원 결합 분자의 사용 | |
| JP2026010057A (ja) | 部位特異的Notch活性化分子およびその使用 | |
| JP7557922B2 (ja) | Dll3標的多重特異性抗原結合分子の使用 | |
| JP7603785B2 (ja) | がんの治療に用いるための細胞傷害誘導治療剤 | |
| HK40106610A (zh) | 用於治疗癌症的细胞毒性-诱导治疗剂 | |
| EA047044B1 (ru) | Таргетирующие клаудин-6 мультиспецифические антигенсвязывающие молекулы и их применения | |
| HK40102796A (zh) | 用於癌症治疗的诱导细胞损伤的治疗药物 | |
| HK40074344A (en) | Immune activating multispecific antigen binding molecules and uses thereof | |
| HK40107687A (zh) | 靶向dll3的多特异性抗原结合分子的用途 | |
| EA049685B1 (ru) | Таргетирующие dll3 мультиспецифические антигенсвязывающие молекулы и их применения | |
| HK1258783B (zh) | 用於癌症治疗的诱导细胞损伤的治疗药物 | |
| HK1258783A1 (en) | Cell injury inducing therapeutic drug for use in cancer therapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022578651 Country of ref document: JP |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21959327 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 21959327 Country of ref document: EP Kind code of ref document: A1 |