WO2023028501A1 - Anti-cd161 antibodies and uses thereof - Google Patents
Anti-cd161 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2023028501A1 WO2023028501A1 PCT/US2022/075370 US2022075370W WO2023028501A1 WO 2023028501 A1 WO2023028501 A1 WO 2023028501A1 US 2022075370 W US2022075370 W US 2022075370W WO 2023028501 A1 WO2023028501 A1 WO 2023028501A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- sequence
- cdr
- isolated anti
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- the invention relates generally to anti-CD161 antibodies, pharmaceutical compositions comprising these antibodies, and methods of using these antibodies for treating disorders associated with or mediated by CD161, for example, certain cancers.
- the invention also relates to expression vectors and host cells for making these antibodies.
- BACKGROUND [0004] Modulation of immune cell checkpoint receptors via antibody-directed therapeutic approaches has been gaining interest over the last decade. Many of these receptors are involved in T cell checkpoint modulation. However, B cell, natural killer (NK) cell, and myeloid cell checkpoint modulation, in particular, is highly desirable and is attracting attention.
- NK cells are part of the innate immunity which recognize and induce cytotoxicity against a wide range of target cells, such as tumor cells or virus infected cells.
- Activated NK cells typically kill target cells by means similar to cytotoxic T cells, i.e., via cytolytic granules that contain perforin and granzymes as well as via death receptor pathways.
- Activated NK cells also secrete inflammatory cytokines such as IFN- ⁇ and chemokines that promote the recruitment of other leukocytes to the target tissue.
- the NK cell receptors are divided into two main structural classes: the immunoglobulin and C-type lectin-like (CLRs) superfamilies.
- NKR-Protein1 (e.g., CD161) are a family of CLR transmembrane molecules that are important immuno-regulatory genes and are expressed on various cell types including spleen dendritic cells subsets of T cells Member D (CLEC2D) or osteoclast inhibitory lectin (OCIL) molecule is the cognate ligand for the CD161 receptor and this interaction inhibits the NK cell and T cell function.
- CLEC2D spleen dendritic cells subsets of T cells Member D
- OCIL osteoclast inhibitory lectin
- the polypeptide chain of CLEC2D contains multiple domains including the N- terminal cytoplasmic domain, the trans-membrane domain, the stalk regions, and a C-terminal CLR ectodomain with two predicted N-glycosylation sites.
- the interaction between CLEC2D and CD161 can result in certain disorders, including certain cancers, that evade the immune system of a subject. Such immune evasion or escape has been reported in human glioblastoma and other diseases.
- CLEC2D expression on germinal center B cells is thought to regulate cross-talk between NK cells and antigen presenting cells (APC). Therefore, blocking CLEC2D-CD161 interaction provides a new therapeutic option for treating various cancers.
- the invention is based, in part, upon the discovery of high affinity anti-CD161 antibodies that disrupt the CLEC2D-CD161 interaction that can be used, among other things, to prevent certain cancers from evading the immune system of a subject.
- the present disclosure provides an isolated anti-CD161 antibody comprising a light chain variable region; and a heavy chain variable region comprising CDR-H1, CDR-H2, and CDR-H3 sequences, wherein: (a) the CDR-H1 sequence is FX1FX2X3X4AMS (SEQ ID NO: 1); (b) the CDR-H2 sequence is AISX 5 X 6 GGX 7 TX 8 YADSVKG (SEQ ID NO: 2); and (c) the CDR-H3 sequence is AKPLDSSX9WADFX10X11 (SEQ ID NO: 3); wherein: X1 is T or A; X2 is G, S, or E; X3 is Q, T, P, or R; X 4 is Y or F; X 5 is A or G; X 6 is A, V, or S; X 7 is T or S; X 8 is K, A, or Y; X 9 is Q, F,
- the light chain variable region comprises CDR-L1, CDR-L2 and CDR-L3 sequences, wherein (d) the CDR-L1 sequence is RASQX12IX13SWLA (SEQ ID NO: 4); (e) the CDR-L2 sequence is X14ASX15LQX16 (SEQ ID NO: 5); and (f) the CDR-L3 sequence is QQX17X18X19LPIT (SEQ ID NO: 6); wherein: X12 is G, D, or T; X 13 is D, S, or Y; X 14 is A, Y, or F; X 15 is S, A, G, or F; X 16 is D or S; X 17 is A, H, or Q; X18 is S, D, W, or L; and X19 is V, D, Y, or K.
- the CDR-H1 sequence is SEQ ID NO: 8; (b) the CDR-H2 sequence is SEQ ID NO: 9; and (c) the CDR-H3 sequence is SEQ ID NO: 10.
- the CDR-L1 sequence is SEQ ID NO: 12; (e) the CDR-L2 sequence is SEQ ID NO: 13; and (f) the CDR-L3 sequence is SEQ ID NO: 14.
- the CDR-H1 sequence is SEQ ID NO: 16; (b) the CDR-H2 sequence is SEQ ID NO: 17; and (c) the CDR-H3 sequence is SEQ ID NO: 18.
- the CDR-L1 sequence is SEQ ID NO: 20; (e) the CDR-L2 sequence is SEQ ID NO: 21; and (f) the CDR-L3 sequence is SEQ ID NO: 22. [0012] In some embodiments, (a) the CDR-H1 sequence is SEQ ID NO: 24; (b) the CDR-H2 sequence is SEQ ID NO: 25; and (c) the CDR-H3 sequence is SEQ ID NO: 26.
- the CDR-L1 sequence is SEQ ID NO: 28; (e) the CDR-L2 sequence is SEQ ID NO: 29; and (f) the CDR-L3 sequence is SEQ ID NO: 30. [0013] In some embodiments, (a) the CDR-H1 sequence is SEQ ID NO: 32; (b) the CDR-H2 sequence is SEQ ID NO: 33; and (c) the CDR-H3 sequence is SEQ ID NO: 34.
- the CDR-L1 sequence is SEQ ID NO: 36; (e) the CDR-L2 sequence is SEQ ID NO: 37; and (f) the CDR-L3 sequence is SEQ ID NO: 38.
- the CDR-H1 sequence is SEQ ID NO: 40; (b) the CDR-H2 sequence is SEQ ID NO: 41; and (c) the CDR-H3 sequence is SEQ ID NO: 42.
- the CDR-L1 sequence is SEQ ID NO: 44; (e) the CDR-L2 sequence is SEQ ID NO: 45; and (f) the CDR-L3 sequence is SEQ ID NO: 46. [0015] In some embodiments, (a) the CDR-H1 sequence is SEQ ID NO: 48; (b) the CDR-H2 sequence is SEQ ID NO: 49; and (c) the CDR-H3 sequence is SEQ ID NO: 50.
- the CDR-L1 sequence is SEQ ID NO: 52; (e) the CDR-L2 sequence is SEQ ID NO: 53; and (f) the CDR-L3 sequence is SEQ ID NO: 54.
- the CDR-H1 sequence is SEQ ID NO: 56; (b) the CDR-H2 sequence is SEQ ID NO: 57; and (c) the CDR-H3 sequence is SEQ ID NO: 58.
- the CDR-L1 sequence is SEQ ID NO: 60; (e) the CDR-L2 sequence is SEQ ID NO: 61; and (f) the CDR-L3 sequence is SEQ ID NO: 62.
- the CDR-H1 sequence is SEQ ID NO: 64; (b) the CDR-H2 sequence is SEQ ID NO: 65; and (c) the CDR-H3 sequence is SEQ ID NO: 66.
- the CDR-L1 sequence is SEQ ID NO: 68; (e) the CDR-L2 sequence is SEQ ID NO: 69; and (f) the CDR-L3 sequence is SEQ ID NO: 70.
- the CDR-H1 sequence is SEQ ID NO: 72; (b) the CDR-H2 sequence is SEQ ID NO: 73; and (c) the CDR-H3 sequence is SEQ ID NO: 74.
- the CDR-L1 sequence is SEQ ID NO: 76; (e) the CDR-L2 sequence is SEQ ID NO: 77; and (f) the CDR-L3 sequence is SEQ ID NO: 78.
- the CDR-H1 sequence is SEQ ID NO: 80; (b) the CDR-H2 sequence is SEQ ID NO: 81; and (c) the CDR-H3 sequence is SEQ ID NO: 82.
- the CDR-L1 sequence is SEQ ID NO: 84; (e) the CDR-L2 sequence is SEQ ID NO: 85; and (f) the CDR-L3 sequence is SEQ ID NO: 86.
- the CDR-H1 sequence is SEQ ID NO: 88; (b) the CDR-H2 sequence is SEQ ID NO: 89; and (c) the CDR-H3 sequence is SEQ ID NO: 90.
- the CDR-L1 sequence is SEQ ID NO: 92; (e) the CDR-L2 sequence is SEQ ID NO: 93; and (f) the CDR-L3 sequence is SEQ ID NO: 94.
- the present disclosure provides an isolated anti-CD161 antibody, wherein the heavy chain variable region comprises the amino acid sequence: EVQLLESGGGLVQPGGSLRLSCAASGFX 1 FX 2 X 3 X 4 AMSWVRQAPGKGLEWVSAISX 5 X 6 GGX7TX8YADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKPLDSSX9WADFX10 X11WGRGTLVTVSS (SEQ ID NO: 188), wherein: X1 is T or A; X2 is G, S, or E; X3 is Q, T, P, or R; X 4 is Y or F; X 5 is A or G; X 6 is A, V, or S; X 7 is T or S; X 8 is K, A, or Y; X 9 is Q, F, or L; X10 is D or Q; and X11 is L or A.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to a sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 31, SEQ ID NO: 39, SEQ ID NO: 47, SEQ ID NO: 55, SEQ ID NO: 63, SEQ ID NO: 71, SEQ ID NO: 79, and SEQ ID NO: 87.
- the heavy chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23, SEQ ID NO: 31, SEQ ID NO: 39, SEQ ID NO: 47, SEQ ID NO: 55, SEQ ID NO: 63, SEQ ID NO: 71, SEQ ID NO: 79, and SEQ ID NO: 87.
- the present disclosure provides an isolated anti-CD161 antibody, wherein the light chain variable region comprises the amino acid sequence: DIQXaTQSPSSVSASVGDRVTITCRASQX12IX13SWLAWYQQKPGKAPKXbLIYX14ASX15L QX 16 GVPSRFSGSGSGTDFTLTIX c SLQPEDFATYYCQQX 17 X 18 X 19 LPITFGGGTKVEIK (SEQ ID NO: 189), wherein: X12 is G, D, or T; X13 is D, S, or Y; X14 is A, Y, or F; X15 is S, A, G, or F; X 16 is D or S; X 17 is A, H, or Q; X 18 is S, D, W, or L; X 19 is V, D, Y, or K; X a is M or L; Xb is L or F; and Xc is S or N.
- the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to a sequence selected from the group consisting of: SEQ ID NO: 11, SEQ ID NO: 19, SEQ ID NO: 27, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 51, SEQ ID NO: 59, SEQ ID NO: 67, SEQ ID NO: 75, SEQ ID NO: 83, and SEQ ID NO: 91.
- the light chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 11, SEQ ID NO: 19, SEQ ID NO: 27, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 51, SEQ ID NO: 59, SEQ ID NO: 67, SEQ ID NO: 75, SEQ ID NO: 83, and SEQ ID NO: 91.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 7 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 11.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 7 and the light chain variable region comprises the sequence of SEQ ID NO: 11. [0026] In some embodiments, the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 15 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 19. In some embodiments, the heavy chain variable region comprises the sequence of SEQ ID NO: 15 and the light chain variable region comprises the sequence of SEQ ID NO: 19.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 23 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 27.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 23 and the light chain variable region comprises the sequence of SEQ ID NO: 27.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 31 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 35.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 31 and the light chain variable region comprises the sequence of SEQ ID NO: 35.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 39 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 43.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 39 and the light chain variable region comprises the sequence of SEQ ID NO: 43.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 47 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 51.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 47 and the light chain variable region comprises the sequence of SEQ ID NO: 51.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 55 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 59.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 55 and the light chain variable region comprises the sequence of SEQ ID NO: 59.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 63 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 67.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 63 and the light chain variable region comprises the sequence of SEQ ID NO: 67.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 71 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 75.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 71 and the light chain variable region comprises the sequence of SEQ ID NO: 75.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 79 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 83.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 79 and the light chain variable region comprises the sequence of SEQ ID NO: 83.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 87 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 91.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 87 and the light chain variable region comprises the sequence of SEQ ID NO: 91.
- the present disclosure provides an isolated anti-CD161 antibody thereof comprising a light chain variable region; and a heavy chain variable region comprising CDR-H1, CDR-H2, and CDR-H3 sequences, wherein: (a) the CDR-H1 sequence is FTFX1X2YYMS (SEQ ID NO: 95); (b) the CDR-H2 sequence is YISPSGX3TIX4YADSVKG (SEQ ID NO: 96); and (c) the CDR-H3 sequence is ARSLMX 5 TGTHLYFDL (SEQ ID NO: 97); wherein: X1 is G, A, P, or S; X2 is N, Q, or D; X3 is A or S; X4 is Y or A; and X5 is A or S.
- the light chain variable region comprises CDR-L1, CDR-L2 and CDR-L3 sequences, wherein (a) the CDR-L1 sequence is RASX6X7ISX8WLA (SEQ ID NO: 98); (b) the CDR-L2 sequence is AAX 9 X 10 LQS (SEQ ID NO: 99); and (c) the CDR-L3 sequence is QQX11TSX12X13PYT (SEQ ID NO: 100); wherein: X6 is Q or S; X7 is D or G; X8 is D or S; X9 is E or S; X 10 is S, A, G, V, or E; X 11 is A, S, or V; X 12 is F, T, V, Q, or A; and X 13 is L or P.
- the CDR-L1 sequence is RASX6X7ISX8WLA (SEQ ID NO: 98); (b) the CDR-L2 sequence is AAX 9 X 10 LQ
- the CDR-H1 sequence is SEQ ID NO: 102;
- the CDR-H2 sequence is SEQ ID NO: 103; and
- the CDR-H3 sequence is SEQ ID NO: 104.
- the CDR-L1 sequence is SEQ ID NO: 106;
- the CDR-L2 sequence is SEQ ID NO: 107; and
- the CDR-L3 sequence is SEQ ID NO: 108.
- the CDR-H1 sequence is SEQ ID NO: 110;
- the CDR- H2 sequence is SEQ ID NO: 111; and
- the CDR-H3 sequence is SEQ ID NO: 112.
- the CDR-L1 sequence is SEQ ID NO: 114;
- the CDR-L2 sequence is SEQ ID NO: 115; and
- the CDR-L3 sequence is SEQ ID NO: 116.
- the CDR-H1 sequence is SEQ ID NO: 118; (b) the CDR- H2 sequence is SEQ ID NO: 119; and (c) the CDR-H3 sequence is SEQ ID NO: 120.
- the CDR-L1 sequence is SEQ ID NO: 122; (e) the CDR-L2 sequence is SEQ ID NO: 123; and (f) the CDR-L3 sequence is SEQ ID NO: 124.
- the CDR-H1 sequence is SEQ ID NO: 126;
- the CDR- H2 sequence is SEQ ID NO: 127; and
- the CDR-H3 sequence is SEQ ID NO: 128.
- the CDR-L1 sequence is SEQ ID NO: 130;
- the CDR-L2 sequence is SEQ ID NO: 131; and
- the CDR-L3 sequence is SEQ ID NO: 132.
- the CDR-H1 sequence is SEQ ID NO: 134;
- the CDR- H2 sequence is SEQ ID NO: 135; and
- the CDR-H3 sequence is SEQ ID NO: 136.
- the CDR-L1 sequence is SEQ ID NO: 138;
- the CDR-L2 sequence is SEQ ID NO: 139; and
- the CDR-L3 sequence is SEQ ID NO: 140.
- the CDR-H1 sequence is SEQ ID NO: 142;
- the CDR- H2 sequence is SEQ ID NO: 143; and
- the CDR-H3 sequence is SEQ ID NO: 144.
- the CDR-L1 sequence is SEQ ID NO: 146;
- the CDR-L2 sequence is SEQ ID NO: 147; and
- the CDR-L3 sequence is SEQ ID NO: 148.
- the CDR-H1 sequence is SEQ ID NO: 150;
- the CDR- H2 sequence is SEQ ID NO: 151; and
- the CDR-H3 sequence is SEQ ID NO: 152.
- the CDR-L1 sequence is SEQ ID NO: 154;
- the CDR-L2 sequence is SEQ ID NO: 155; and
- the CDR-L3 sequence is SEQ ID NO: 156.
- the CDR-H1 sequence is SEQ ID NO: 158;
- the CDR- H2 sequence is SEQ ID NO: 159; and
- the CDR-H3 sequence is SEQ ID NO: 160.
- the CDR-L1 sequence is SEQ ID NO: 162;
- the CDR-L2 sequence is SEQ ID NO: 163;
- the CDR-L3 sequence is SEQ ID NO: 164.
- the CDR-H1 sequence is SEQ ID NO: 166;
- the CDR- H2 sequence is SEQ ID NO: 167; and
- the CDR-H3 sequence is SEQ ID NO: 168.
- the CDR-L1 sequence is SEQ ID NO: 170;
- the CDR-L2 sequence is SEQ ID NO: 171; and
- the CDR-L3 sequence is SEQ ID NO: 172.
- the heavy chain variable region comprises the amino acid sequence: QVQLVESGGGLVXaPGGSLRLSCAASGFTFX1X2YYMSWIRQAPGKGLEWVSYISPSGX3 TIX4YADSVKGRFTISRDNXbKNXcLYLQMNSLRAEDTAVYYCARSLMX5TGTHLYFDLW GRGTLVTVSS (SEQ ID NO: 190), wherein: X 1 is G, A, P, or S; X 2 is N, Q, or D; X 3 is A or S; X4 is Y or A; X5 is A or S; Xa is K or Q; Xb is A or S; and Xc is S or T.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to a selected from the group consisting of: SEQ ID NO: 101, SEQ ID NO: 109, SEQ ID NO: 117, SEQ ID NO: 125, SEQ ID NO: 133, SEQ ID NO: 141, SEQ ID NO: 149, SEQ ID NO: 157, and SEQ ID NO: 165.
- the heavy chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 101, SEQ ID NO: 109, SEQ ID NO: 117, SEQ ID NO: 125, SEQ ID NO: 133, SEQ ID NO: 141, SEQ ID NO: 149, SEQ ID NO: 157, and SEQ ID NO: 165.
- the light chain variable region comprises the amino acid sequence: DIQLTQSPSSVSASVGDRVTITC RASX6X7ISX8WLAWYQQKPGKAPKLLIYAAX9X10LQS GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQX 11 TSX 12 X 13 PYTFGGGTKVEIK (SEQ ID NO: 191), wherein: X6 is Q or S; X7 is D or G; X8 is D or S; X9 is E or S; X10 is S, A, G, V, or E; X 11 is A, S, or V; X 12 is F, T, V, Q, or A; and X 13 is L or P.
- the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to a sequence selected from the group consisting of: SEQ ID NO: 105, SEQ ID NO: 113, SEQ ID NO: 121, SEQ ID NO: 129, SEQ ID NO: 137, SEQ ID NO: 145, SEQ ID NO: 153, SEQ ID NO: 161, and SEQ ID NO: 169.
- the light chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 105, SEQ ID NO: 113, SEQ ID NO: 121, SEQ ID NO: 129, SEQ ID NO: 137, SEQ ID NO: 145, SEQ ID NO: 153, SEQ ID NO: 161, and SEQ ID NO: 169.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 101 and the light chain variable region comprises an amino acid sequence at least 90% (e.g., at least 95% identical) identical to the sequence of SEQ ID NO: 105.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 101 and the light chain variable region comprises the sequence of SEQ ID NO: 105.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 109 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 113.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 109 and the light chain variable region comprises the sequence of SEQ ID NO: 113.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 117 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 121.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 117 and the light chain variable region comprises the sequence of SEQ ID NO: 121.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 125 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 129.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 125 and the light chain variable region comprises the sequence of SEQ ID NO: 129.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 133 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 137.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 133 and the light chain variable region comprises the sequence of SEQ ID NO: 137.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 141 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 145.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 141 and the light chain variable region comprises the sequence of SEQ ID NO: 145.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 149 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 153.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 149 and the light chain variable region comprises the sequence of SEQ ID NO: 153.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 157 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 161.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 157 and the light chain variable region comprises the sequence of SEQ ID NO: 161.
- the heavy chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 165 and the light chain variable region comprises an amino acid sequence at least 90% identical (e.g., at least 95% identical) to the sequence of SEQ ID NO: 169.
- the heavy chain variable region comprises the sequence of SEQ ID NO: 165 and the light chain variable region comprises the sequence of SEQ ID NO: 169.
- the antibody is a monoclonal antibody. In some embodiments, the antibody is multispecific.
- the antibody is an Fab, Fab′, F(Ab′)2, Fv, scFv, (scFv)2, single chain antibody molecule, dual variable domain antibody, single variable domain antibody, linear antibody, or V domain antibody.
- the antibody comprises a scaffold.
- the scaffold is Fc.
- scaffold is human Fc.
- the antibody comprises a heavy chain constant region of a class selected from the group consisting of: IgG, IgA, IgD, IgE, and IgM.
- the antibody comprises a heavy chain constant region of the class IgG and a subclass selected from the group consisting of: IgG1, IgG2, IgG3, and IgG4.
- the monoclonal antibody is an aglycosylated human IgG1 antibody.
- the monoclonal antibody comprises an IgG 1 Fc region with modification at amino acid position N297 (e.g., N297A) according to EU numbering.
- N297A amino acid position N297
- the present disclosure provides an isolated antibody that competes for binding to CD161 with the anti-CD161 antibody disclosed herein.
- the present disclosure provides an isolated antibody that specifically binds to the CD161 epitope bound by the anti-CD161 antibody disclosed herein. In some embodiments, the antibody competes for binding to CD161 with CLEC2D. [0063] In some embodiments, the antibody reduces CD161 inhibitory signaling due to binding of CLEC2D to CD161. In some embodiments, the CD161 is expressed on the surface of a cell. In some embodiments, the cell is a T cell or an NK cell. In some embodiments, the cell is a human cell or a cynomolgus cell. In some embodiments, the antibody reduces suppression of T cell or NK cell activity by CLEC2D binding to CD161.
- the antibody of the present disclosure increases T cell or NK cell activity in the presence of CLEC2D as compared to such T cell or NK cell activity in the absence of the antibody.
- the T cells or NK cells are disposed within a microenvironment comprising cells expressing CLEC2D.
- the antibody increases T cell or NK cell activity in a tumor microenvironment containing tumor cells that express CLEC2D.
- the increase in T cell activity is determined by an increase in NFAT signaling.
- the antibody has an EC50 value for T cell activation of between 1.5 nM and 4.1 nM.
- the antibody has an EC50 value for T cell activation of about 1.5 nM, about 1.7 nM, about 2.0 nM, about 2.3 nM, about 2.5 nM, about 2.8 nM, about 3.1 nM, about 3.3 nM, about 3.5 nM, about 3.8 nM, about 4.1 nM.
- the antibody reverses CLEC2D-mediated inhibition and restores T cell activity.
- the antibody enhances polyfunctionality of a primary antigen-specific human T cell.
- the antibody of the present disclosure (i) enhances or restores direct T cell mediated cytotoxicity that was affected by CD161-CLEC2D interaction, (ii) increases secretion of TNF ⁇ , (iii) increases secretion of IL-2, (iv) increases secretion of IFN ⁇ , or (v) exhibits any combination of features (i), (ii), (iii) or (iv).
- the increase in NK cell activity is determined by an increase in CD107a expression.
- the antibody has an EC 50 value for NK cell activation of between 0.04 nM and 0.38 nM.
- the antibody has an EC50 value for NK cell activation of about 0.04 nM, about 0.06 nM, about 0.08 nM, about 0.1 nM, about 0.12 nM, about 0.14 nM, about 0.16 nM, about 0.18 nM, about 0.20 nM, about 0.22 nM, about 0.24 nM, about 0.28 nM, about 0.30 nM, about 0.32 nM, about 0.34 nM, about 0.36 nM, about 0.38 nM.
- the increase in NK cell activity is determined by an increase in IFN ⁇ expression.
- the antibody has an EC50 value for NK cell activation of between 0.1 nM and 0.5 nM.
- the antibody has an EC 50 value for NK cell activation of about 0.1 nM, about 0.15 nM, about 0.2 nM, about 0.25 nM, about 0.3 nM, about 0.35 nM, about 0.4 nM, about 0.45 nM, about 0.5 nM.
- the antibody binds to human CD161 with a K d of less than or equal to 10 nM, less than or equal to 0.5 nM, less than or equal to 1 nM, less than or equal to 0.5 nM or less than or equal to 0.1 nM as measured by an Octet QK384 assay. In some embodiments, the antibody binds to human CD161 with a Kd in the range of 1x10 -8 to 1x10 -10 M as measured by an Octet QK384 assay. In some embodiments, the antibody has an EC 50 for HEK293 cells expressing CD161 of less than 5 nM, less than 1 nM, or less than 0.5 nM.
- the antibody has an EC 50 for HEK293 cells expressing CD161 in the range of 0.1 – 0.5 nM. In some embodiments, the antibody reduces CLEC2D binding to CD161 expressed on the surface of a cell with an IC 50 in the range of 0.1 to 10 nM. In some embodiments, the antibody reduces CLEC2D binding to CD161 expressed on the surface of a cell with an IC 50 of less than 10 nM, less than 5 nM, less than 2 nM, less than 1 nM, or less than 0.5 nM.
- the antibody has a Kd of greater than 1,000 nM for hKLRF1, hKLRF2, hCLEC12B, hCLEC2D, or any combination thereof. In some embodiments, the antibody binds to less than 2%, less than 1.5%, less than 1.2%, less than 1.1%, or less than 1% of a population of CD161 homologs as compared to the antibody bound to CD161 under saturating antibody conditions. In some embodiments, the population of CD161 homologs comprise CLEC2D, KLRF1, KLRF2, CLEC12B, or any combination thereof. [0067] In some embodiments, the antibody enhances NK cell killing of a CLEC2D expressing cell.
- the antibody enhances NK cell killing of CLEC2D expressing cell by blocking the interaction of CD161 with CLEC2D.
- the antibody enhances reactivation of antigen-specific effector memory CD4 T cells.
- the antibody enhances reactivation of antigen- specific effector memory CD4 T cells by blocking CD161 interaction with CLEC2D.
- the antibody enhances the cytokine production of a MART-1-specific T cell.
- the antibody enhances the cytotoxicity function of a MART-1-specific T cell.
- the antibody does not cause cytokine release syndrome.
- an antibody provided herein exhibits at least one or more of the following features (a)- (t), including: (a) binds human CD161; (b) binds human CD161 at a human CD161 binding site; (c) binds to the CD161 epitope bound by an anti-CD161 antibody or antigen-binding fragment thereof; (d) binds human CD161 at or near a CLEC2D binding site; (e) competes for binding to CD161 with CLEC2D; (f) reduces CD161 inhibitory signaling due to binding of CLEC2D to CD161; (g) reduces suppression of T cell activity by CLEC2D binding to CD161; (h) reduces suppression of NK cell activity by CLEC2D binding to CD161; (i) increases T cell activity in the presence of CLEC2D as compared to such T cell activity in the absence of the antibody or antigen-binding fragment thereof; (j) increases NK cell activity in the presence of CL
- the antibody binds to human CD161 and cynomolgus CD161, wherein the binding affinity of the antibody for the human CD161 and the cynomolgus CD161 varies by no more than 5x, 10x, 20x, 50x, or 100x. In some embodiments, the antibody binds to human CD161 and cynomolgus CD161, wherein the binding avidity of the antibody for the human CD161 and the cynomolgus CD161 varies by no more than 5x, 10x, 20x, 50x, or 100x. [0071] In another aspect, the present disclosure also provides a pharmaceutical composition comprising the antibody disclosed herein, and a pharmaceutically acceptable carrier.
- the present disclosure also provides an isolated polynucleotide or plurality of polynucleotides encoding the antibody disclosed herein, a V H thereof, a V L thereof, a light chain thereof, a heavy chain thereof, or an antigen-binding portion thereof.
- the present disclosure also provides a vector or plurality of vectors comprising the polynucleotide or plurality of polynucleotides disclosed herein.
- the present disclosure also provides a host cell comprising the polynucleotide, plurality of polynucleotides, or the plurality of vectors disclosed herein.
- the present disclosure also provides a method of producing an antibody comprising expressing the antibody with the host cell and isolating the expressed antibody.
- the present disclosure also provides a kit comprising the antibody disclosed herein, or the pharmaceutical composition disclosed herein and instructions for use.
- the present disclosure also provides a method of treating cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of an immunotherapy (e.g., an anti-CD161 antibody) disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- an immunotherapy e.g., an anti-CD161 antibody
- the present disclosure provides a method of treating cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the cancer is characterized by expression of CLEC2D by cancer cells or other cells in the tumor microenvironment.
- the cancer is characterized by an increased expression of CLEC2D by cancer cells or other cells in the tumor microenvironment.
- the cancer is selected from the group consisting of: melanoma, lung, glioma, colorectal, and liver.
- the present disclosure also provides a method for reducing or inhibiting tumor growth in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the present disclosure also provides a method for inhibiting or blocking the interaction between human CD161 and CLEC2D in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the present disclosure also provides a method for inducing or enhancing immune cell activation in a subject in need thereof, the method comprising administering to the subject, an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the immune cell activation occurs in a tumor microenvironment.
- the immune cell is a T cell or a NK cell.
- the present disclosure provides a method for inducing or enhancing a cytotoxic T cell effector response in a subject in need thereof, the method comprising administering to the subject, an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- FIGs.1A-1D are graphs showing binding of exemplary human anti-CD161 antibodies to HEK 293 cells exogenously expressing human CD161.
- FIGs.2A-2D are graphs showing binding of exemplary human anti-CD161 antibodies to HEK 293 cells exogenously expressing cynomolgus CD161.
- Iso Ctrl denotes an isotype control antibody.
- FIG.3 shows alignment of human CD161 (KLRB1_human) (SEQ ID NO: 179) with its homologs (killer cell lectin-like receptor subfamily F member 1_human (KLRF1_human) (SEQ ID NO: 183), killer cell lectin-like receptor subfamily F member 2_human (KLRF2_human) (SEQ ID NO: 184), and C-type lectin domain family 12 member B_human (CL12B_human) (SEQ ID NO: 185).
- FIG.4 shows alignment of human CD161 (KLRB1_human) (SEQ ID NO: 179) with C-type lectin domain family 2 member D (CLC2D_human) (SEQ ID NO: 186).
- FIGs.5A-5B are graphs showing binding of exemplary human anti-CD161 antibodies to HEK 293 cells exogenously expressing CD161 or CD161 homologs (CLEC2D, KLRF1, KLRF2, and CLEC12B). Iso Ctrl denotes isotype control antibody, and null represents control HEK 293 cells.
- FIGs.6A-6D are graphs illustrating human anti-CD161 antibody-mediated blocking of interaction between CD161 and CLEC2D, using HEK293 cells overexpressing the human CD161 protein and soluble, biotinylated Fc-human CLEC2D (H176C) protein. Iso Ctrl denotes isotype control antibody.
- FIGs.7A-7D are graphs illustrating anti-CD161 antibody-mediated activation of human NK cells as measured by CD107a expression in a dose-dependent manner.
- HP-3G10 denotes mouse anti-human CD161 antibody.
- Iso Ctrl denotes isotype control antibody.
- FIGs.8A-8D are graphs illustrating anti-CD161 antibody-mediated activation of T cells in a co-culture assay with exogenous CLEC2D expression as measured by nuclear factor of activated T cells (NFAT) signaling.
- HP-3G10 denotes mouse anti-human CD161 antibody. Isotype control antibody (Iso Ctrl) was used as a control.
- FIG.9 is a graph showing restoration of NFAT signaling in a dose-dependent manner in the presence of human anti-CD161 antibodies, Ab8, Ab9, Ab13, and Ab15.
- Isotype control antibody Iso Ctrl
- FIGs.10A-10B are graphs showing binding of human anti-CD161 antibodies, Ab8, Ab9, Ab13, and Ab15 to human PBMCs (FIG.10A) and cynomolgus PBMCs (FIG.10B).
- Iso Ctrl denotes an isotype control antibody.
- FIG.11 is a bar graph showing binding of human anti-CD161 antibodies, Ab8, Ab9, Ab13, and Ab15 to immune cell populations in human PBMCs (MAIT T cells, B cells, monocytes, and dendritic cells).
- FIGs.12A-12B shows alignments of antibodies of the first family that were used to generate the consensus sequence of VH and VL, respectively.
- FIG.12A discloses SEQ ID Nos. 188, 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, and 87, respectively, in order of appearance, which correspond to the consensus sequence (Cons) to Ab11, respectively.
- FIG.12B discloses SEQ ID Nos.189, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, and 91, respectively, in order of appearance, which correspond to the consensus sequence (Cons) to Ab11, respectively.
- FIGs.13A-13B shows alignments of antibodies of the second family that were used to generate the consensus sequence of VH and VL, respectively.
- FIG.13A discloses SEQ ID Nos.190, 101, 109, 117, 125, 133, 141, 149, 157, and 165, respectively, in order of appearance, which correspond to the consensus sequence (Cons), and Ab12 to Ab20, respectively.
- FIG.13B discloses SEQ ID Nos.191, 105, 113, 121, 129, 137, 145, 153, 161, and 169, respectively, in order of appearance, which correspond to the consensus sequence (Cons), and Ab12 to Ab20, respectively.
- FIGs.14A-14B illustrate ELISA assay format, which shows soluble receptor binding to Fc ⁇ RI (FIG.14A) and Fc ⁇ RII and Fc ⁇ RIII (FIG.14B). Biotinylated Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII are denoted as “Fc ⁇ RI-bio,” “Fc ⁇ RII-bio,” “Fc ⁇ RIII-bio,” respectively.
- FIGs.15A-15E are ELISA binding curves illustrating binding kinetics of Ab9 or wildtype human IgG1 antibody (“WT”) to Fc ⁇ receptors, Fc ⁇ RI (FIG.15A), Fc ⁇ RIIA (FIG. 15B), Fc ⁇ RIIB/C (FIG.15C), Fc ⁇ RIIIA (FIG.15D), and Fc ⁇ RIIIB (FIG.15E).
- WT human IgG1 antibody
- FIG.16A illustrate the FcRn binding method by Octet.
- FIGs.16B-16C are exemplary binding curves for Ab9 (FIG.16B) and wildtype human IgG1 antibody (“WT”) (FIG. 16C), determined by Octet.
- FIGs.17A-17B are graphs illustrating anti-CD161 antibody-mediated activation of human NK cells isolated from donor RTD165 as measured by CD107a expression in a dose- dependent manner in target K562 cells expressing CLEC2D (FIG.17A) or target K562 cells expressing GFP (FIG.17B).
- FIGs.17C-17D are graphs illustrating anti-CD161 antibody- mediated activation of human NK cells isolated from donor RTD165 as measured by secretion of IFN- ⁇ in a dose-dependent manner in target K562 cells expressing CLEC2D (FIG.17C) or target K562 cells expressing GFP (FIG.17D).
- FIGs.17E-17F are graphs illustrating anti-CD161 antibody-mediated activation of human NK cells isolated from donor MCB117 as measured by CD107a expression in a dose- dependent manner in target K562 cells expressing CLEC2D (FIG.17E) or target K562 cells expressing GFP (FIG.17F) .
- FIGs.17G-17H are graphs illustrating anti-CD161 antibody- mediated activation of human NK cells isolated from donor MCB117 as measured by secretion of IFN- ⁇ in a dose-dependent manner in target K562 cells expressing CLEC2D (FIG.17G) or target K562 cells expressing GFP (FIG.17H).
- FIGs.18A-18B are graphs that illustrate killing of Raji target cells by human NK cells isolated from donor #1 (FIG.18A) or donor #2 (FIG.18B) in the presence of anti-CD161 antibody (Ab9).
- FIG.19A-19B are graphs that illustrate blocking of CD161-CLEC2D interaction by anti-CD161 antibody (Ab9) leads to enhanced cytokine (as measured by IFN ⁇ , FIG.19A) and proliferation (as measured by Ki67, FIG.19B) responses in memory CD4 T cells. T cells exposed to CEFX peptide in the presence of anti-CD161 antibody (Ab9), isotype control (iso.
- FIGs.20A-20B are graphs illustrating that anti-CD161 antibody (Ab9) enhanced IFN ⁇ production in CD161 + MART-1-specific T cells upon reactivation as percentage of cytokine-positive cells (FIG.20A) or as geometric mean fluorescence intensity (MFI) (FIG. 20B).
- FIGs.20C-20D are graphs illustrating that anti-CD161 antibody (Ab9) enhanced IL-2 (FIG.20C) and TNF ⁇ (FIG.20D) production in MART-1-specific T cells upon reactivation. *P ⁇ 0.05 **P ⁇ 0.01, ***P ⁇ 0.001 (two-tailed Student’s t-test).
- FIGs.21A-21B are graphs illustrating that anti-CD161 antibody (Ab9) enhances Granzyme B production in CD161 + MART-1-specific T cells from two donors upon reactivation.
- FIGs.21C-21D are graphs illustrating that Ab9 enhanced antigen specific T cell cytotoxicity of MART-1 specific T cells obtained from two donors. Viable target cells were measured as CD19 + , NEAR-IR negative. *P ⁇ 0.05, **P ⁇ 0.01, (two-tailed Student’s t-test).
- FIGs.22A-22F are graphs illustrating induction of cytokines from unstimulated healthy human PBMCs following incubation with plate bound Ab9. Treatment of 6 donor human PBMCs with plate bound Ab9, isotype control, anti-CD3 muromonab (anti-CD3), and rituximab treatment (*** p ⁇ 0.0001).
- FIGs.23A-23F are graphs illustrating induction of cytokines from unstimulated healthy human PBMCs following incubation with soluble Ab9. Treatment of 6 donor human PBMCs with soluble Ab9, isotype control, anti-CD3 muromonab (anti-CD3), and rituximab treatment (*** p ⁇ 0.0001).
- FIG.24 is a plot of mean Ab9 serum concentrations versus time profiles for each dose group using a semilog scale.
- FIGs.25A-25B are plots of mean Ab9 serum concentrations versus time profiles by treatment and sex using a semilog scale.
- the invention is based, in part, upon the discovery of high affinity anti-CD161 antibodies that disrupt the CLEC2D-CD161 axis that can be used, among other things, to prevent certain cancers from evading the immune system of a subject.
- the present application further relates to pharmaceutical compositions and therapeutic methods using such antibodies and/or pharmaceutical compositions for the treatment of indications, such as cancer.
- indications such as cancer.
- Various features and aspects of the invention, including the antibodies described in the present application, are discussed in detail below. Definitions [00111] To facilitate an understanding of the present application, a number of terms and phrases are defined below. [00112]
- the terms “a” and “an” as used herein mean “one or more” and include the plural unless the context is inappropriate.
- immunoglobulin refers to a class of structurally related antibody proteins typically comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy (H) chains. In an “intact immunoglobulin,” all four of these chains are interconnected by disulfide bonds. The structure of immunoglobulins has been well characterized. See, e.g., Paul (2013) FUNDAMENTAL IMMUNOLOGY 7TH ED., Ch.5 Lippincott Williams & Wilkins, Philadelphia, PA. Briefly, each heavy chain typically comprises a heavy chain variable region (VH) and a heavy chain constant region (CH).
- VH heavy chain variable region
- CH heavy chain constant region
- the heavy chain constant region typically comprises three domains, abbreviated C H1 , C H2 , and C H3 .
- Each light chain typically comprises a light chain variable region (VL) and a light chain constant region.
- the light chain constant region typically comprises one domain, abbreviated C L .
- antibody is understood to mean an intact antibody (e.g., an intact monoclonal antibody), or a fragment thereof, such as a Fc fragment of an antibody (e.g., an Fc fragment of a monoclonal antibody), or an antigen-binding fragment of an antibody (e.g., an antigen-binding fragment of a monoclonal antibody), including an intact antibody, antigen-binding fragment, or Fc fragment that has been modified, engineered, or chemically conjugated.
- antigen-binding fragments include Fab, Fab’, (Fab’)2, Fv, single chain antibodies (e.g., scFv), minibodies, and diabodies.
- antibodies that have been modified or engineered include chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies).
- An example of a chemically conjugated antibody is an antibody conjugated to a toxin moiety.
- the term “anti-CD161 antibody” refers to an antibody that specifically binds to CD161 (e.g., human CD161). In certain embodiments, the anti-CD161 antibody can reduce or prevent the interaction of CD161 and CLEC2D.
- antigen-binding fragment means the portion of an antibody that is capable of specifically binding to an antigen or epitope.
- antigen-binding fragments include Fab, Fab’, F(ab’)2, fragments or in a recombinant polypeptide such as an single chain antibody binding site (e.g., scFv) in which a heavy chain variable domain (V H ) is connected by a linker (e.g., a polypeptide linker) to the light chain variable domain (VL) in a single polypeptide, a minibody, or a nanobody (V HH ).
- Antigen-binding fragments can be found in various contexts including antibodies and chimeric antigen receptors (CARs), for example CARs derived from antibodies or antibody fragments such as scFvs.
- CARs chimeric antigen receptors
- the terms “intact antibody,” “full length antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a naturally occurring antibody structure and having heavy chains that comprise an Fc region.
- a “full length antibody” is an antibody that comprises two heavy chains and two light chains.
- Fc region means the C-terminal region of an immunoglobulin heavy chain that, in naturally occurring antibodies, interacts with Fc receptors and certain proteins of the complement system. The structures of the Fc regions of various immunoglobulins, and the glycosylation sites contained therein, are known in the art. See Schroeder and Cavacini (2010) J.
- the Fc region may be a naturally occurring Fc region, or an Fc region modified as described in the art or elsewhere in this disclosure.
- the VH and VL regions may be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called “complementarity determining regions” (CDRs)) interspersed with regions that are more conserved. The more conserved regions are called framework regions (FRs).
- HVRs hypervariable regions
- CDRs complementarity determining regions
- Each V H and V L generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4.
- the CDRs are involved in antigen binding, and influence antigen specificity and binding affinity of the antibody. See Kabat et al. (1991) SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST 5TH ED., Public Health Service, National Institutes of Health, Bethesda, MD, incorporated by reference in its entirety.
- a “Complementarity Determining Region (CDR)” refers to one of three hypervariable regions (e.g., CDR-H1, CDR-H2 or CDR-H3) within the non-framework region of the immunoglobulin (Ig or antibody) VH E-sheet framework, or one of three hypervariable regions (e.g., CDR-L1, CDR-L2 or CDR-L3) within the non-framework region of the antibody VL E-sheet framework.
- CDRs are variable region sequences interspersed within the framework region sequences. CDRs are well recognized in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains. See Kabat et al.
- CDRs have also been defined structurally by Chothia as those residues that are not part of the conserved E-sheet framework, and thus are able to adapt different conformations. See Chothia and Lesk (1987) J. MOL. BIOL., 196: 901-917, incorporated by reference in its entirety. Both the Kabat and Chothia nomenclatures are well known in the art.
- AbM, Contact and IMGT also defined CDRs. CDR positions within a canonical antibody variable domain have been determined by comparison of numerous structures.
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular’s AbM antibody modeling software.
- the Contact hypervariable regions are based on an analysis of the available complex crystal structures.
- IMGT ImMunoGeneTics
- IG immunoglobulins
- TR T cell receptors
- MHC major histocompatibility complex
- the IMGT CDRs are referred to in terms of both the amino acid sequence and the location within the light or heavy chain.
- location of the CDRs within the structure of the immunoglobulin variable domain is conserved between species and present in structures called loops, by using numbering systems that align variable domain sequences according to structural features, CDR and framework residues are readily identified.
- Correspondence between the Kabat, Chothia and IMGT numbering is also well known in the art (Lefranc et al., supra).
- the light chain from any vertebrate species can be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the sequence of its constant domain.
- the heavy chain from any vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- the IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgG 1 , IgG 2 , IgG3, IgG4, IgA1, and IgA2.
- the term “constant region” or “constant domain” refers to a carboxy terminal portion of the light and heavy chain which is not directly involved in binding of the antibody to antigen but exhibits various effector function, such as interaction with the Fc receptor.
- the terms refer to the portion of an immunoglobulin molecule having a more conserved amino acid sequence relative to the other portion of the immunoglobulin, the variable domain, which contains the antigen-binding site.
- the constant domain contains the C H1 , C H2 and C H3 domains of the heavy chain and the CL domain of the light chain.
- the “EU numbering scheme” is generally used when referring to a residue in an antibody heavy chain constant region (e.g., as reported in Kabat et al., supra).
- Fv fragments comprise a non-covalently-linked dimer of one heavy chain variable domain and one light chain variable domain.
- Fab fragments comprise, in addition to the heavy and light chain variable domains, the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments may be generated, for example, by recombinant methods or by papain digestion of a full-length antibody.
- F(ab’)2 fragments contain two Fab’ fragments joined, near the hinge region, by disulfide bonds.
- F(ab’) 2 fragments may be generated, for example, by recombinant methods or by pepsin digestion of an intact antibody.
- the F(ab’) fragments can be dissociated, for example, by treatment with ⁇ -mercaptoethanol.
- “Single-chain Fv” or “sFv” or “scFv” antibody fragments comprise a V H domain and a VL domain in a single polypeptide chain.
- the VH and VL are generally linked by a peptide linker. Any suitable linker may be used.
- scFv-Fc fragments comprise an scFv attached to an Fc domain.
- an Fc domain may be attached to the C-terminal of the scFv.
- the Fc domain may follow the V H or V L , depending on the orientation of the variable domains in the scFv (i.e., VH -VL or VL -VH). Any suitable Fc domain known in the art or described herein may be used.
- the term “single domain antibody” refers to a molecule in which one variable domain of an antibody specifically binds to an antigen without the presence of the other variable domain. Single domain antibodies, and fragments thereof, are described in Arabi Ghahroudi et al.
- a “multispecific antibody” is an antibody that comprises two or more different antigen-binding domains that collectively specifically bind two or more different epitopes.
- the two or more different epitopes may be epitopes on the same antigen (e.g., a single CD161 molecule expressed by a cell) or on different antigens (e.g., a CD161 molecule and a non-CD161 molecule).
- a multi-specific antibody binds two different epitopes (i.e., a “bispecific antibody”). In some aspects, a multi-specific antibody binds three different epitopes (i.e., a “trispecific antibody”). In some aspects, a multi-specific antibody binds four different epitopes (i.e., a “quadspecific antibody”). In some aspects, a multi-specific antibody binds five different epitopes (i.e., a “quintspecific antibody”). In some aspects, a multi-specific antibody binds 6, 7, 8, or more different epitopes. Each binding specificity may be present in any suitable valency. Examples of multispecific antibodies are provided elsewhere in this disclosure.
- a “monospecific antibody” is an antibody that comprises one or more binding sites that specifically bind to a single epitope.
- An example of a monospecific antibody is a naturally occurring IgG molecule which, while divalent (i.e., having two antigen-binding domains), recognizes the same epitope at each of the two antigen-binding domains. The binding specificity may be present in any suitable valency.
- the term “monoclonal antibody” refers to an antibody from a population of substantially homogeneous antibodies. A population of substantially homogeneous antibodies comprises antibodies that are substantially similar and that bind the same epitope(s), except for variants that may normally arise during production of the monoclonal antibody.
- a monoclonal antibody is typically obtained by a process that includes the selection of a single antibody from a plurality of antibodies.
- the selection process can be the selection of a unique clone from a plurality of clones, such as a pool of hybridoma clones, phage clones, yeast clones, bacterial clones, or other recombinant DNA clones.
- the selected antibody can be further altered, for example, to improve affinity for the target (“affinity maturation”), to humanize the antibody, to improve its production in cell culture, and/or to reduce its immunogenicity in a subject.
- chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- “Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
- a humanized antibody is generally a human antibody (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody).
- the donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non- human primate antibody having a desired specificity, affinity, or biological effect.
- selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody.
- Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications may be made to further refine antibody function. For further details, see Jones et al. (1986) NATURE, 321: 522-525; Riechmann et al. (1988) NATURE, 332: 323-329; and Presta (1992) CURR. OP. STRUCT. BIOL., 2: 593-596, each of which is incorporated by reference in its entirety.
- a “human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g., obtained from human sources or designed de novo). Human antibodies do not include humanized antibodies.
- An “isolated antibody” or “isolated nucleic acid” is an antibody or nucleic acid that has been separated and/or recovered from a component of its natural environment. Components of the natural environment may include enzymes, hormones, and other proteinaceous or nonproteinaceous materials.
- an isolated antibody is purified to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence, for example by use of a spinning cup sequenator.
- an isolated antibody is purified to homogeneity by gel electrophoresis (e.g., SDS-PAGE) under reducing or nonreducing conditions, with detection by Coomassie blue or silver stain.
- an isolated antibody may include an antibody in situ within recombinant cells, since at least one component of the antibody’s natural environment is not present.
- an isolated antibody or isolated nucleic acid is prepared by at least one purification step.
- an isolated antibody or isolated nucleic acid is purified to at least 80%, 85%, 90%, 95%, or 99% by weight. In some embodiments, an isolated antibody or isolated nucleic acid is purified to at least 80%, 85%, 90%, 95%, or 99% by volume. In some embodiments, an isolated antibody or isolated nucleic acid is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% antibody or nucleic acid by weight. In some embodiments, an isolated antibody or isolated nucleic acid is provided as a solution comprising at least 85%, 90%, 95%, 98%, 99% to 100% antibody or nucleic acid by volume.
- affinity refers to the strength of the sum total of non-covalent interactions between a binding site (e.g., a single binding site) of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen or epitope).
- affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen or epitope).
- the affinity of a molecule X for its partner Y can be represented by the dissociation equilibrium constant (K D ). The kinetic components that contribute to the dissociation equilibrium constant are described in more detail below.
- Affinity can be measured by common methods known in the art, including those described herein, such as surface plasmon resonance (SPR) technology (e.g., BIACORE ® ) or biolayer interferometry (e.g., FORTEBIO ® , using, for example, the Octet QK384 system).
- SPR surface plasmon resonance
- BIACORE ® BIACORE ®
- biolayer interferometry e.g., FORTEBIO ® , using, for example, the Octet QK384 system.
- the terms “bind,” “specific binding,” “specifically binds to,” “specific for,” “selectively binds,” and “selective for” a particular antigen (e.g., a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non-selective interaction (e.g., with a non-target molecule).
- Specific binding can be measured, for example, by measuring binding to a target molecule and comparing it to binding to a non-target molecule.
- Specific binding can also be determined by competition with a control molecule that mimics the epitope recognized on the target molecule.
- the affinity of a CD161 antibody for a non-target molecule is less than about 40% of the affinity for CD161. In some aspects, the affinity of a CD161 antibody for a non-target molecule is less than about 30% of the affinity for CD161. In some aspects, the affinity of a CD161 antibody for a non-target molecule is less than about 20% of the affinity for CD161. In some aspects, the affinity of a CD161 antibody for a non-target molecule is less than about 10% of the affinity for CD161.
- the affinity of a CD161 antibody for a non-target molecule is less than about 1% of the affinity for CD161. In some aspects, the affinity of a CD161 antibody for a non-target molecule is less than about 0.1% of the affinity for CD161.
- the term “kd” (sec -1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. This value is also referred to as the k off value.
- k a (M -1 ⁇ sec -1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. This value is also referred to as the kon value.
- KD KD
- M dissociation equilibrium constant of a particular antibody-antigen interaction.
- K D k d /k a .
- the affinity of an antibody is described in terms of the KD for an interaction between such antibody and its antigen.
- K D K D -1
- K A K a /k d .
- an “affinity matured” antibody is an antibody with one or more alterations (e.g., in one or more CDRs or FRs) relative to a parent antibody (i.e., an antibody from which the altered antibody is derived or designed) that result in an improvement in the affinity of the antibody for its antigen, compared to the parent antibody which does not possess the alteration(s).
- a parent antibody i.e., an antibody from which the altered antibody is derived or designed
- an affinity matured antibody has nanomolar or picomolar affinity for the target antigen.
- Affinity matured antibodies may be produced using a variety of methods known in the art. For example, Marks et al. (1992) BIO/TECHNOLOGY, 10: 779-783, incorporated by reference in its entirety) describes affinity maturation by VH and VL domain shuffling.
- Random mutagenesis of CDR and/or framework residues is described by, for example, Barbas et al. (1994) PROC. NAT. ACAD. SCI. USA, 91: 3809-3813; Schier et al. (1995) GENE, 169: 147-155; Yelton et al. (1995) J. IMMUNOL., 155: 1994-2004; Jackson et al. (1995) J. IMMUNOL., 154: 3310-33199; and Hawkins et al. (1992) J. MOL. BIOL., 226: 889-896; each of which is incorporated by reference in its entirety.
- Fc effector functions refer to those biological activities mediated by the Fc region of an antibody, which activities may vary depending on the antibody isotype. Examples of antibody effector functions include C1q binding to activate complement dependent cytotoxicity (CDC), Fc receptor binding to activate antibody-dependent cellular cytotoxicity (ADCC), and antibody dependent cellular phagocytosis (ADCP). [00148] When used herein in the context of two or more antibodies, the term “competes with” or “cross-competes with” indicates that the two or more antibodies compete for binding to an antigen (e.g., CD161). In one exemplary assay, CD161 is coated on a surface and contacted with a first CD161 antibody, after which a second CD161 antibody is added.
- an antigen e.g., CD161
- CD161 is coated on a surface and contacted with a first CD161 antibody, after which a second CD161 antibody is added.
- first a CD161 antibody is coated on a surface and contacted with CD161, and then a second CD161 antibody is added. If the presence of the first CD161 antibody reduces binding of the second CD161 antibody, in either assay, then the antibodies compete with each other.
- the term “competes with” also includes combinations of antibodies where one antibody reduces binding of another antibody, but where no competition is observed when the antibodies are added in the reverse order. However, in some embodiments, the first and second antibodies inhibit binding of each other, regardless of the order in which they are added.
- one antibody reduces binding of another antibody to its antigen by at least 25%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, or at least 95%.
- concentrations of the antibodies used in the competition assays based on the affinities of the antibodies for CD161 and the valency of the antibodies.
- the assays described in this definition are illustrative, and a skilled artisan can utilize any suitable assay to determine if antibodies compete with each other.
- Suitable assays are described, for example, in Cox et al., “Immunoassay Methods,” in ASSAY GUIDANCE MANUAL [INTERNET], Updated December 24, 2014 (www.ncbi.nlm.nih.gov/books/NBK92434/; accessed September 29, 2015); Silman et al. (2001) CYTOMETRY, 44: 30-37; and Finco et al. (2011) J. PHARM. BIOMED. ANAL., 54: 351-358; each of which is incorporated by reference in its entirety.
- an antibody that binds specifically to a human antigen is considered to specifically bind the same antigen of mouse origin when a KD value can be measured on a ForteBio Octet with the mouse antigen.
- an antibody can be considered cross- reactive to a non-human species when the KD (as measured by ForteBio Octet) of that species is not more than 10-fold weaker (i.e., K D value 10-fold higher) than that of the human species.
- An antibody that binds specifically to a human antigen is considered to be “cross-reactive” with the same antigen of mouse origin when the K D value for the mouse antigen is no greater than 20 times the corresponding KD value for the respective human antigen.
- an antibody that binds specifically to a human antigen is considered to be “cross-reactive” with the same antigen of cynomolgus monkey origin when the K D value for the cynomolgus monkey antigen is no greater than 20 times the corresponding KD value for the respective human antigen.
- epitope means a portion of an antigen that is specifically bound by an antibody. Epitopes frequently include surface-accessible amino acid residues and/or sugar side chains and may have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter may be lost in the presence of denaturing solvents.
- An epitope may comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding.
- the epitope to which an antibody binds can be determined using known techniques for epitope determination such as, for example, testing for antibody binding to CD161 variants with different point- mutations, or to chimeric CD161 variants.
- Percent “identity” between a polypeptide sequence and a reference sequence is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, CLUSTAL OMEGA, or MUSCLE software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- a “conservative substitution” or a “conservative amino acid substitution,” refers to the substitution of an amino acid with a chemically or functionally similar amino acid. Conservative substitution tables providing similar amino acids are well known in the art.
- the groups of amino acids provided in TABLES 1-3 are, in some embodiments, considered conservative substitutions for one another.
- Selected groups of amino acids that are considered conservative substitutions for one another are shown in TABLE 1.
- TABLE 1 [00154] Additional selected groups of amino acids that are considered conservative substitutions for one another, in certain embodiments, are shown in TABLE 2.
- TABLE 2 [00155] Further selected groups of amino acids that are considered conservative substitutions for one another, in certain embodiments, are shown in TABLE 3.
- TABLE 3 [00156] Additional conservative substitutions may be found, for example, in Creighton (1993) PROTEINS: STRUCTURES AND MOLECULAR PROPERTIES 2ND ED. W. H.
- amino acid refers to the twenty common naturally occurring amino acids.
- Naturally occurring amino acids include alanine (Ala; A), arginine (Arg; R), asparagine (Asn; N), aspartic acid (Asp; D), cysteine (Cys; C); glutamic acid (Glu; E), glutamine (Gln; Q), Glycine (Gly; G); histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
- the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors.”
- expression vectors are referred to herein as “expression vectors.”
- host cell “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which an exogenous nucleic acid has been introduced, and the progeny of such cells.
- Host cells include “transformants” (or “transformed cells”) and “transfectants” (or “transfected cells”), which each include the primary transformed or transfected cell and progeny derived therefrom. Such progeny may not be completely identical in nucleic acid content to a parent cell, and may contain mutations.
- the term “treating” (and variations thereof such as “treat” or “treatment”) refers to clinical intervention in an attempt to alter the natural course of a disease or condition in a subject in need thereof. Treatment can be performed both for prophylaxis and during the course of clinical pathology.
- Desirable effects of treatment include preventing occurrence or recurrence of disease, ameliorating one or more symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- therapeutically effective amount or “effective amount” refers to an amount of an antibody or pharmaceutical composition provided herein that, when administered to a subject, is sufficient to effect a beneficial or desired result, such as the antibody or pharmaceutical composition, when administered to a subject, is effective to treat a disease or disorder or is effective in ameliorating one or more symptoms of a disease or disorder.
- an effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route.
- the term “subject” means a mammalian subject. Exemplary subjects include humans, monkeys, dogs, cats, mice, rats, cows, horses, camels, goats, rabbits, pigs and sheep. In certain embodiments, the subject is a human subject. In some embodiments the subject has a disease or condition that can be treated with an antibody provided herein. For example, the disease or condition is a cancer.
- kits are used to refer to instructions customarily included in commercial packages of therapeutic or diagnostic products (e.g., kits) that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic or diagnostic products.
- a “chemotherapeutic agent” refers to a chemical compound useful in the treatment of cancer. Chemotherapeutic agents include “anti-hormonal agents” or “endocrine therapeutics” which act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer.
- composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective in treating a subject, and which contains no additional components which are unacceptably toxic to the subject in the amounts provided in the pharmaceutical composition.
- modulate and “modulation” refer to reducing or inhibiting or, alternatively, activating or increasing, a recited variable.
- the terms “increase” and “activate” refer to an increase of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 100%, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20- fold, 50-fold, 100-fold, or greater in a recited variable.
- the terms “reduce” and “inhibit” refer to a decrease of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, or greater in a recited variable.
- the term “agonize” refers to the activation of receptor signaling to induce a biological response associated with activation of the receptor.
- An “agonist” is an entity that binds to and agonizes a receptor.
- the term “antagonize” refers to the inhibition of receptor signaling to inhibit a biological response associated with activation of the receptor.
- An “antagonist” is an entity that binds to and antagonizes a receptor.
- the terms “subject” and “patient” refer to an organism to be treated by the methods and compositions described herein.
- Such organisms preferably include, but are not limited to, mammals (e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably include humans.
- mammals e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like
- humans preferably include humans.
- compositions are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
- an element or component is said to be included in and/or selected from a list of recited elements or components, it should be understood that the element or component can be any one of the recited elements or components, or the element or component can be selected from a group consisting of two or more of the recited elements or components.
- CD161 also called NK receptor-P1A (NKR-P1A), killer cell lectin-like receptor subfamily B member 1 (KLRB1), or C-type lectin domain family 5 member B (CLEC5B)
- NKR-P1A NK receptor-P1A
- KLRB1 killer cell lectin-like receptor subfamily B member 1
- CLEC5B C-type lectin domain family 5 member B
- CD161 belongs to the killer cell lectin-like receptor (KLR) family, and its members contain one C-type lectin-like domain in the extracellular region responsible for the ligand recognition.
- mice have several CD161 molecules, which are both activating and inhibitory receptors and known as the NKR-P1 family, humans have only one CD161 molecule, which is an inhibitory receptor.
- the CD161 receptor binds to a ligand known as C-type Lectin Domain Family 2 Member D (CLEC2D) (see Aldemir et al. (2005) J. IMMUNOL., 175(12): 7791-5, Rosen et al. (2005) J. IMMUNOL., 175(12): 7796-9.).
- CLEC2D is also known as human lectin-like transcript- 1 molecule (LLT1).
- the CD161 family molecules are type II transmembrane glycoproteins, which form disulfide-linked homodimers. Inhibiting interaction between CD161 and CLEC2D promotes activation of T cells in response to tumor cells. All orthologs and isoforms of CLEC2D and CD161 are considered to be within the scope of the present disclosure.
- An amino acid sequence of human CD161 is represented by SEQ ID NO: 179. Amino acid residues 1-45, 46-66, and 67-225 of SEQ ID NO: 179 comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain, respectively.
- An amino acid sequence of cynomolgus CD161, mouse CD161, and rat CD161 is represented by SEQ ID NO: 180, 181, and 182, respectively.
- An amino acid sequence of human CLEC2D is represented by SEQ ID NO: 186.
- Amino acid residues 1-38, 39-59, and 60-191 of SEQ ID NO: 186 comprise a cytoplasmic domain, a transmembrane domain, and an extracellular domain, respectively.
- an antibody provided herein comprises a VH sequence selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165. [00184] In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 7. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 15. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 23. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 31.
- an antibody provided herein comprises a VH sequence of SEQ ID NO: 39. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 47. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 55. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 63. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 71. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 79. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 87.
- an antibody provided herein comprises a VH sequence of SEQ ID NO: 101. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 109. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 117. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 125. I n some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 133. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 141. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 149.
- an antibody provided herein comprises a VH sequence of SEQ ID NO: 157. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 165. [00185] In some embodiments, an antibody provided herein comprises a VH sequence having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity to an illustrative VH sequence provided in SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165.
- an antibody provided herein comprises a VH sequence provided in SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein. I n some embodiments, such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a VL sequence selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169. [00187] In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 11. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 19. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 27. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 35.
- an antibody provided herein comprises a V L sequence of SEQ ID NO: 43. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 51. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 59. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 67. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 75. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 83. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 91.
- an antibody provided herein comprises a VL sequence of SEQ ID NO: 105. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 113. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 121. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 129. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 137. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 145. In some embodiments, an antibody provided herein comprises a VL sequence of SEQ ID NO: 153.
- an antibody provided herein comprises a V L sequence of SEQ ID NO: 161. In some embodiments, an antibody provided herein comprises a V L sequence of SEQ ID NO: 169. [00188] In some embodiments, an antibody provided herein comprises a V L sequence having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity to an illustrative V L sequence provided in SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises a V L sequence provided in SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169, with up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a VH sequence selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165 and a VL sequence selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises a V H sequence of SEQ ID NO: 7 and a VL sequence of SEQ ID NO: 11.
- an antibody provided herein comprises a V H sequence of SEQ ID NO: 15 and a V L sequence of SEQ ID NO: 19. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 23 and a V L sequence of SEQ ID NO: 27. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 31 and a VL sequence of SEQ ID NO: 35. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 39 and a VL sequence of SEQ ID NO: 43. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 47 and a V L sequence of SEQ ID NO: 51.
- an antibody provided herein comprises a VH sequence of SEQ ID NO: 55 and a VL sequence of SEQ ID NO: 59. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 63 and a VL sequence of SEQ ID NO: 67. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 71 and a V L sequence of SEQ ID NO: 75. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 79 and a V L sequence of SEQ ID NO: 83.
- an antibody provided herein comprises a VH sequence of SEQ ID NO: 87 and a VL sequence of SEQ ID NO: 91. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 101 and a VL sequence of SEQ ID NO: 105. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 109 and a V L sequence of SEQ ID NO: 113. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 117 and a VL sequence of SEQ ID NO: 121.
- an antibody provided herein comprises a V H sequence of SEQ ID NO: 125 and a V L sequence of SEQ ID NO: 129. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 133 and a V L sequence of SEQ ID NO: 137. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 141 and a VL sequence of SEQ ID NO: 145. In some embodiments, an antibody provided herein comprises a V H sequence of SEQ ID NO: 149 and a VL sequence of SEQ ID NO: 153.
- an antibody provided herein comprises a V H sequence of SEQ ID NO: 157 and a V L sequence of SEQ ID NO: 161. In some embodiments, an antibody provided herein comprises a VH sequence of SEQ ID NO: 165 and a V L sequence of SEQ ID NO: 169.
- an antibody provided herein comprises a V H sequence having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity to an illustrative V H sequence provided in SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, and a V L sequence having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity to an illustrative VL sequence provided in SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and
- an antibody provided herein comprises a VH sequence provided in SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acid substitutions, and a V L sequence provided in SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169, with up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 7, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 11.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 15, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 19.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 23, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 27.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 31, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 35.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 39, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 43.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 47, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 51.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 55, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 59.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 63, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 67.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 71, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 75.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 79, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 83.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 87, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 91.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 101, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 105.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 109, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 113.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 117, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to SEQ ID NO: 121.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 125, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 129.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 133, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 137.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 141, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 145.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 149, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 153.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 157, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 161.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 165, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 169.
- a heavy chain variable region sequence for example, the VH sequence of SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, or 165, or the amino acid variants thereof, may be covalently linked to a variety of heavy chain constant region sequences known in the art.
- a light chain variable region sequence for example, the V L of SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, or 169, or the amino acid variants thereof, may be covalently linked to a variety of light chain constant region sequences known in the art.
- the antibody molecule may have a heavy chain constant region chosen from, e.g., the heavy chain constant regions of IgG 1 , IgG 2 , IgG 3 , IgG 4 , IgM, IgA 1 , IgA 2 , IgD, and IgE; particularly, chosen from, e.g., the (e.g., human) heavy chain constant regions of IgG1, IgG2, IgG3, and IgG4.
- the antibody molecule has a light chain constant region chosen from, e.g., the (e.g., human) light chain constant regions of kappa or lambda.
- the constant region can be altered, e.g., mutated, to modify the properties of the antibody (e.g., to increase or decrease one or more of: Fc receptor binding, antibody glycosylation, the number of cysteine residues, effector cell function, and/or complement function).
- the antibody has effector function and can fix complement.
- the antibody does not recruit effector cells or fix complement.
- the antibody has reduced or no ability to bind an Fc receptor. For example, it is an isotype or subtype, fragment or other mutant, which does not support binding to an Fc receptor, e.g., it has a mutagenized or deleted Fc receptor binding region.
- an antibody provided herein comprises one to three CDRs of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165. In some embodiments, an antibody provided herein comprises two to three CDRs of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165.
- an antibody provided herein comprises three CDRs of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165.
- the CDRs are annotated using Kabat numbering system.
- the CDRs are annotated using Chothia numbering system.
- the CDRs are annotated using AbM numbering system.
- the CDRs are annotated using Contact numbering system.
- the CDRs are annotated using IMGT numbering system.
- the CDRs are annotated using an exemplary numbering system, wherein amino acid residues at positions 27-35, 50-65, and 93-102 denote CDR-H1, CDR-H2, and CDR-H3, respectively.
- the CDRs are CDRs having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H1, CDR-H2, or CDR-H3 of SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165.
- the CDR-H1 is a CDR-H1 of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, or 5 amino acid substitutions.
- the CDR-H2 is a CDR-H2 of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the CDR-H3 is a CDR-H3 of a V H domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises one to three CDRs of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises two to three CDRs of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises three CDRs of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- the CDRs are annotated using Kabat numbering system.
- the CDRs are annotated using Chothia numbering system. In some aspects, the CDRs are annotated using AbM numbering system. In some aspects, the CDRs are annotated using Contact numbering system. In some aspects, the CDRs are annotated using IMGT numbering system. In some aspects, the CDRs are annotated using an exemplary numbering system, wherein amino acid residues at positions 24-34, 50-56, and 89-97 denote CDR-L1, CDR-L2, and CDR-L3, respectively.
- the CDRs are CDRs having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L1, CDR-L2, or CDR-L3 of SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- the CDR-L1 is a CDR-L1 of a V L domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169, with up to 1, 2, 3, 4, or 5 amino acid substitutions.
- the CDR-L2 is a CDR-L2 of a V L domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the CDR-L3 is a CDR-L3 of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169, and 760, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises one to three CDRs of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165 and one to three CDRs of a V L domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises two to three CDRs of a V H domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165 and two to three CDRs of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- an antibody provided herein comprises three CDRs of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165 and three CDRs of a VL domain selected from SEQ ID NOs: 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 91, 105, 113, 121, 129, 137, 145, 153, 161, and 169.
- the CDRs are Kabat CDRs.
- the CDRs are Chothia CDRs.
- the CDRs are AbM CDRs.
- the CDRs are Contact CDRs. In some aspects, the CDRs are IMGT CDRs. In some aspects, the CDRs are exemplary CDRs. [00219] In some embodiments, the CDRs are CDRs having at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H1, CDR-H2, or CDR-H3 of SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165 and at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L1, CDR-L2, or CDR-L3 of SEQ ID NOs
- the CDR-H1 is a CDR-H1 of a V H domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, or 5 amino acid substitutions
- the CDR-H2 is a CDR-H2 of a V H domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141, 149, 157, and 165, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions
- the CDR-H3 is a CDR-H3 of a VH domain selected from SEQ ID NOs: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79, 87, 101, 109, 117, 125, 133, 141,
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, as determined by the exemplary numbering system wherein amino acid residues at position 93-102 denote CDR-H3.
- the CDR-H3 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H3 of SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168.
- the CDR-H3 is a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, as determined by the exemplary numbering system wherein amino acid residues at position 50-65 denote CDR-H2.
- the CDR-H2 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H2 of SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167.
- the CDR-H2 is a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166, as determined by the exemplary numbering system wherein amino acid residues at position 27-35 denote CDR-H1.
- the CDR-H1 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H1 of SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166.
- the CDR-H1 is a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168 and a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167.
- an antibody provided herein comprises a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, and a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166.
- the CDR-H3 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H3 of SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168
- the CDR-H2 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H2 of SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167
- the CDR-H1 has at least about 50%, about 60%, about 70%
- the CDR-H3 is a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions
- the CDR-H2 is a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions
- the CDR-H1 is a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166, with up to 1, 2, 3,
- the amino acid substitutions are conservative amino acid substitutions.
- the antibody described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172, as determined by the exemplary numbering system wherein amino acid residues at position 89-97 denote CDR-L3.
- the CDR-L3 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L3 of SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172.
- the CDR-L3 is a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-L2 selected from SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171, as determined by the exemplary numbering system wherein amino acid residues at position 50-56 denote CDR-L2.
- the CDR-L2 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L2 of SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171.
- the CDR-L2 is a CDR-L2 selected from SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-L1 selected from SEQ ID NOs: 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 92, 106, 114, 122, 130, 138, 146, 154, 162, and 170, as determined by the exemplary numbering system wherein amino acid residues at position 24-34 denote CDR-L1.
- the CDR-L1 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L1 of SEQ ID NOs: 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 92, 106, 114, 122, 130, 138, 146, 154, 162, and 170.
- the CDR-L1 is a CDR-L1 selected from SEQ ID NOs: 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 92, 106, 114, 122, 130, 138, 146, 154, 162, and 170, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions.
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.” In some embodiments, such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- an antibody provided herein comprises a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172 and a CDR-L2 selected from SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171.
- an antibody provided herein comprises a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172, a CDR-L2 selected from SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171, and a CDR-L1 selected from SEQ ID NOs: 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 92, 106, 114, 122, 130, 138, 146, 154, 162, and 170.
- the CDR-L3 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L3 of SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172
- the CDR-L2 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-L2 of SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171, and the CDR-L1 has at least about 50%,
- the CDR-L3 is a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140, 148, 156, 164, and 172, with up to 1, 2, 3, 4, or 5 amino acid substitutions;
- the CDR-L2 is a CDR-L2 selected from SEQ ID NOs: 13, 21, 29, 37, 45, 53, 61, 69, 77, 85, 93, 107, 115, 123, 131, 139, 147, 155, 163, and 171, with up to 1, 2, 3, or 4 amino acid substitutions;
- the CDR-L1 is a CDR-L1 selected from SEQ ID NOs: 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 92, 106, 114, 122, 130, 138, 146, 154, 162, and 170, with up to 1, 2, 3, 4, 5,
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, a CDR-H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166, a CDR-L3 selected from SEQ ID NOs: 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 94, 108, 116, 124, 132, 140
- the CDR-H3 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H3 of SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168
- the CDR-H2 has at least about 50%, about 60%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, or about 99% identity with a CDR-H2 of SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167
- the CDR-H1 has at least about 50%, about 60%, about 70%
- the CDR-H3 is a CDR-H3 selected from SEQ ID NOs: 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 104, 112, 120, 128, 136, 144, 152, 160, and 168, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions
- the CDR-H2 is a CDR- H2 selected from SEQ ID NOs: 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 103, 111, 119, 127, 135, 143, 151, 159, and 167, with up to 1, 2, 3, 4, 5, 6, 7, or 8 amino acid substitutions
- the CDR-H1 is a CDR-H1 selected from SEQ ID NOs: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 102, 110, 118, 126, 134, 142, 150, 158, and 166, with up to 1, 2, 3, 4,
- the amino acid substitutions are conservative amino acid substitutions.
- the antibodies described in this paragraph are referred to herein as “variants.”
- such variants are derived from a sequence provided herein, for example, by affinity maturation, site directed mutagenesis, random mutagenesis, or any other method known in the art or described herein.
- such variants are not derived from a sequence provided herein and may, for example, be isolated de novo according to the methods provided herein for obtaining antibodies.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 8, a CDR-H2 of SEQ ID NO: 9, a CDR-H3 of SEQ ID NO: 10, a CDR-L1 of SEQ ID NO: 12, a CDR-L2 of SEQ ID NO: 13, and a CDR-L3 of SEQ ID NO: 14, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 16, a CDR-H2 of SEQ ID NO: 17, a CDR-H3 of SEQ ID NO: 18, a CDR-L1 of SEQ ID NO: 20, a CDR-L2 of SEQ ID NO: 21, and a CDR-L3 of SEQ ID NO: 22, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 24, a CDR-H2 of SEQ ID NO: 25, a CDR-H3 of SEQ ID NO: 26, a CDR-L1 of SEQ ID NO: 28, a CDR-L2 of SEQ ID NO: 29, and a CDR-L3 of SEQ ID NO: 30, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 32, a CDR-H2 of SEQ ID NO: 33, a CDR-H3 of SEQ ID NO: 34, a CDR-L1 of SEQ ID NO: 36, a CDR-L2 of SEQ ID NO: 37, and a CDR-L3 of SEQ ID NO: 38, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 40, a CDR-H2 of SEQ ID NO: 41, a CDR-H3 of SEQ ID NO: 42, a CDR-L1 of SEQ ID NO: 44, a CDR-L2 of SEQ ID NO: 45, and a CDR-L3 of SEQ ID NO: 46, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 48, a CDR-H2 of SEQ ID NO: 49, a CDR-H3 of SEQ ID NO: 50, a CDR-L1 of SEQ ID NO: 52, a CDR-L2 of SEQ ID NO: 53, and a CDR-L3 of SEQ ID NO: 54, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 56, a CDR-H2 of SEQ ID NO: 57, a CDR-H3 of SEQ ID NO: 58, a CDR-L1 of SEQ ID NO: 60, a CDR-L2 of SEQ ID NO: 61, and a CDR-L3 of SEQ ID NO: 62, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 64, a CDR-H2 of SEQ ID NO: 65, a CDR-H3 of SEQ ID NO: 66, a CDR-L1 of SEQ ID NO: 68, a CDR-L2 of SEQ ID NO: 69, and a CDR-L3 of SEQ ID NO: 70, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 72, a CDR-H2 of SEQ ID NO: 73, a CDR-H3 of SEQ ID NO: 74, a CDR-L1 of SEQ ID NO: 76, a CDR-L2 of SEQ ID NO: 77, and a CDR-L3 of SEQ ID NO: 78, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 80, a CDR-H2 of SEQ ID NO: 81, a CDR-H3 of SEQ ID NO: 82, a CDR-L1 of SEQ ID NO: 84, a CDR-L2 of SEQ ID NO: 85, and a CDR-L3 of SEQ ID NO: 86, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 88, a CDR-H2 of SEQ ID NO: 89, a CDR-H3 of SEQ ID NO: 90, a CDR-L1 of SEQ ID NO: 92, a CDR-L2 of SEQ ID NO: 93, and a CDR-L3 of SEQ ID NO: 94, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 102, a CDR-H2 of SEQ ID NO: 103, a CDR-H3 of SEQ ID NO: 104, a CDR-L1 of SEQ ID NO: 106, a CDR-L2 of SEQ ID NO: 107, and a CDR-L3 of SEQ ID NO: 108, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 110, a CDR-H2 of SEQ ID NO: 111, a CDR-H3 of SEQ ID NO: 112, a CDR-L1 of SEQ ID NO: 114, a CDR-L2 of SEQ ID NO: 115, and a CDR-L3 of SEQ ID NO: 116, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 118, a CDR-H2 of SEQ ID NO: 119, a CDR-H3 of SEQ ID NO: 120, a CDR-L1 of SEQ ID NO: 122, a CDR-L2 of SEQ ID NO: 123, and a CDR-L3 of SEQ ID NO: 124, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 126, a CDR-H2 of SEQ ID NO: 127, a CDR-H3 of SEQ ID NO: 128, a CDR-L1 of SEQ ID NO: 130, a CDR-L2 of SEQ ID NO: 131, and a CDR-L3 of SEQ ID NO: 132, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 134, a CDR-H2 of SEQ ID NO: 135, a CDR-H3 of SEQ ID NO: 136, a CDR-L1 of SEQ ID NO: 138, a CDR-L2 of SEQ ID NO: 139, and a CDR-L3 of SEQ ID NO: 140, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 142, a CDR-H2 of SEQ ID NO: 143, a CDR-H3 of SEQ ID NO: 144, a CDR-L1 of SEQ ID NO: 146, a CDR-L2 of SEQ ID NO: 147, and a CDR-L3 of SEQ ID NO: 148, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 150, a CDR-H2 of SEQ ID NO: 151, a CDR-H3 of SEQ ID NO: 152, a CDR-L1 of SEQ ID NO: 154, a CDR-L2 of SEQ ID NO: 155, and a CDR-L3 of SEQ ID NO: 156, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 158, a CDR-H2 of SEQ ID NO: 159, a CDR-H3 of SEQ ID NO: 160, a CDR-L1 of SEQ ID NO: 162, a CDR-L2 of SEQ ID NO: 163, and a CDR-L3 of SEQ ID NO: 164, as determined by the exemplary numbering system.
- an antibody provided herein comprises a CDR-H1 of SEQ ID NO: 166, a CDR-H2 of SEQ ID NO: 167, a CDR-H3 of SEQ ID NO: 168, a CDR-L1 of SEQ ID NO: 170, a CDR-L2 of SEQ ID NO: 171, and a CDR-L3 of SEQ ID NO: 172, as determined by the exemplary numbering system.
- Consensus Sequences [00249] Consensus sequences were developed representing the V H and V L sequences of the representative antibodies of each family, as well as their corresponding CDR sequences.
- Positions where the amino acid varies within a position of each CDR are represented by X 1, X 2, X3... Positions where the amino acid varies within a framework region of the VH and VL sequences are represented by X a, X b, X c ... Possible amino acids representing the consensus sequence at each X position are identified herein. [00250] In some embodiments, provided herein is a first family of antibodies (see, FIGs.
- an antibody of such family comprises the following six CDR sequences: (a) a CDR-H1 having the sequence FX1FX2X3X4AMS (SEQ ID NO: 1), wherein X1 is T or A, X2 is G, S, or E, X 3 is Q, T, P, or R, and X 4 is Y or F; (b) a CDR-H2 having the sequence AISX5X6GGX7TX8YADSVKG (SEQ ID NO: 2), wherein X5 is A or G, X6 is A, V, or S, X7 is T or S, and X 8 is K, A, or Y; (c) a CDR-H3 having the sequence AKPLDSSX 9 WADFX 10 X 11 (SEQ ID NO: 3), wherein X9 is Q, F, or L, X10 is D or Q, and X11 is L or A; (d) a CDR-L1 having the sequence R
- an antibody of such family comprises a VH sequence of SEQ ID NO: 188 and a V L sequence of SEQ ID NO: 189.
- an antibody within such first family FIGs.12A-12B shows alignment of antibodies of first family that were used to generate the consensus sequence of each V H and V L , respectively.
- a second family of antibodies see, FIGs.
- an antibody of such family comprises the following six CDR sequences: (a) a CDR-H1 having the sequence FTFX 1 X 2 YYMS (SEQ ID NO: 95), wherein X 1 is G, A, P, or S and X2 is N, Q, or D; (b) a CDR-H2 having the sequence YISPSGX3TIX4YADSVKG (SEQ ID NO: 96), wherein X 3 is A or S and X 4 is Y or A; (c) a CDR-H3 having the sequence ARSLMX5TGTHLYFDL (SEQ ID NO: 97), wherein X5 is A or S; (d) a CDR-L1 having the sequence RASX 6 X 7 ISX 8 WLA (SEQ ID NO: 98), wherein X 6 is Q or S, X 7 is D or G, and X 8 is D or S; (e) a CDR-L2 having the sequence AAX9X
- an antibody of such family comprises a VH sequence of SEQ ID NO: 190 and a V L sequence of SEQ ID NO: 191.
- provided herein is an antibody within such second family.
- FIGs.13A-13B shows alignment of antibodies of second family that were used to generate the consensus sequence of each V H and V L , respectively.
- the CD161 antibodies bind (e.g., specifically bind) CD161.
- the human CD161 is represented by SEQ ID NO: 179.
- the CD161 antibodies bind to human CD161 and induce or promote activation of human NK cells.
- the CD161 antibodies bind to human CD161 and induce or promote activation of human T cells.
- the CD161 antibodies bind to human CD161 with a K D lower than or equal to (i.e., binding stronger than or equal to) 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 20 pM, or 10 pM, as measured using standard binding assays, for example, surface plasmon resonance, bio- layer interfer
- the antibody binds human CD161 with a KD in the range of about 10 pM – about 1 nM, about 10 pM – about 0.9 nM, about 10 pM – about 0.8 nM, about 10 pM – about 0.7 nM, about 10 pM – about 0.6 nM, about 10 pM – about 0.5 nM, about 10 pM – about 0.4 nM, about 10 pM – about 0.3 nM, about 10 pM – about 0.2 nM, about 10 pM – about 0.1 nM, about 10 pM – about 50 pM, about 0.1 nM – about 10 nM, about 0.1 nM – about 9 nM, about 0.1 nM – about 8 nM, about 0.1 nM – about 7 nM, about 0.1 nM – about 6 nM, about 0.1 nM
- a disclosed antibody in addition to binding human CD161, a disclosed antibody also binds to Macaca fascicularis (cynomolgus) CD161.
- the cynomolgus CD161 is represented by SEQ ID NO: 180.
- the CD161 antibodies bind to cynomolgus CD161 and induce or promote activation of cynomolgus NK cells.
- the CD161 antibodies bind to cynomolgus CD161 and induce or promote activation of cynomolgus T cells.
- the antibody binds cynomolgus CD161 with a KD lower than or equal to (i.e., binding stronger than or equal to) 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.9 nM, 0.8 nM, 0.7 nM, 0.6 nM, 0.5 nM, 0.4 nM, 0.3 nM, 0.2 nM, 0.1 nM, 90 pM, 80 pM, 70 pM, 60 pM, 50 pM, 40 pM, 30 pM, 20 pM, or 10 pM, as measured using standard binding assays, for example, surface plasmon resonance, bio- layer interferometry, or an Octet QK384 assay.
- standard binding assays for example, surface plasmon resonance, bio
- the antibody binds cynomolgus CD161 with a KD in the range of about 10 pM – about 1 nM, about 10 pM – about 0.9 nM, about 10 pM – about 0.8 nM, about 10 pM – about 0.7 nM, about 10 pM – about 0.6 nM, about 10 pM – about 0.5 nM, about 10 pM – about 0.4 nM, about 10 pM – about 0.3 nM, about 10 pM – about 0.2 nM, about 10 pM – about 0.1 nM, about 10 pM – about 50 pM, 0.1 nM – about 10 nM, about 0.1 nM – about 9 nM, about 0.1 nM – about 8 nM, about 0.1 nM – about 7 nM, about 0.1 nM – about 6 nM, about 0.1
- the affinity of an antibody disclosed herein for human CD161 as indicated by EC50 measured with HEK293 expressing CD161 cells is 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.75 nM, 0.5 nM, 0.1 nM, 0.075 nM, or 0.05 nM or lower.
- the affinity of an antibody disclosed herein for human CD161 as indicated by EC 50 measured with HEK293 expressing CD161 cells is from about 20 nM to about 0.05 nM, from about 20 nM to about 0.075 nM, from about 20 nM to about 0.1 nM, from about 20 nM to about 0.5 nM, from about 20 nM to about 1 nM, from about 10 nM to about 0.05 nM, from about 10 nM to about 0.075 nM, from about 10 nM to about 0.1 nM, from about 10 nM to about 0.5 nM, from about 10 nM to about 1 nM, from about 5 nM to about 0.05 nM, from about 5 nM to about 0.075 nM, from about 5 nM to about 0.1 nM, from about 5 nM to about 0.5 nM, from about 5 nM to about 1 nM, from about 3 nM to
- the affinity of an antibody disclosed herein for human CD161 as indicated by EC50 measured with HEK293 expressing CD161 cells is about 0.5 nM to about 0.1 nM (e.g., about 0.45 nM, about 0.4 nM, about 0.35 nM, about 0.3 nM, about 0.25 nM, about 0.2 nM, about 0.15 nM, or about 0.05 nM).
- the present disclosure provides antibodies that bind to the same epitope present in CD161 as that bound by a disclosed antibody.
- the present disclosure provides antibodies that compete for binding to CD161 with a disclosed antibody.
- Competition assays for determining whether an antibody binds to the same epitope as, or competes for binding with a disclosed antibody are known in the art.
- Exemplary competition assays include immunoassays (e.g., ELISA assays, RIA assays), surface plasmon resonance, (e.g., BIAcore analysis), bio-layer interferometry, and flow cytometry.
- a competition assay involves the use of an antigen (e.g., a human CD161 protein or fragment thereof) bound to a solid surface or expressed on a cell surface, a test CD161-binding antibody and a reference antibody. The reference antibody is labeled and the test antibody is unlabeled.
- Competitive inhibition is measured by determining the amount of labeled reference antibody bound to the solid surface or cells in the presence of the test antibody. Usually the test antibody is present in excess (e.g., 1x, 5x, 10x, 20x or 100x).
- Antibodies identified by competition assay include antibodies binding to the same epitope, or similar (e.g., overlapping) epitopes, as the reference antibody, and antibodies binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antibody for steric hindrance to occur.
- a competition assay can be conducted in both directions to ensure that the presence of the label does not interfere or otherwise inhibit binding.
- test antibody competes with the reference antibody for specific binding to the antigen if an excess of one antibody (e.g., 1x, 5x, 10x, 20x or 100x) inhibits binding of the other antibody, e.g., by at least 50%, 75%, 90%, 95% or 99% as measured in a competitive binding assay.
- an excess of one antibody e.g., 1x, 5x, 10x, 20x or 100x
- Two antibodies may be determined to bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
- CD161 antibodies that bind to CD161 and have the ability to inhibit the interaction of CD161 with CLEC2D.
- the CD161 antibodies of the present disclosure block, inhibit, or antagonize binding of CLEC2D.
- the CD161 antibodies of the present disclosure compete for binding to CD161 with CLEC2D.
- the CD161 antibodies of the present disclosure reduce CD161 inhibitory signaling due to binding of CLEC2D to CD161.
- CD161 is expressed on the surface of a cell.
- the present disclosure provides antibodies that compete for binding to CD161 with CLEC2D.
- the CD161 antibodies binds to a region of CD161 that overlaps with a ligand-binding region of CD161.
- the CD161 antibodies binds at or near the ligand-binding region of CD161.
- the ligand-binding region of CD161 is a CLEC2D-binding region.
- binding of CD161 antibody or antigen-binding fragment thereof to CD161 prevents binding of CLEC2D to CD161.
- the blocking of CD161 is measured by determining the concentrations of cytokines produced by CD161-expressing immune cells.
- the immune cell is a NK cell or a T cell.
- the blocking of CD161 is measured by determining concentration of cytokines produced by CD161-expressing T cells in response to a target cell (e.g., tumor cell).
- an increase in cytokine production by immune cells indicates blocking of CD161.
- blocking of CD161 is measured by analyzing proliferation of CD161-expressing immune cells.
- an increase in immune cell proliferation indicates blocking of CD161.
- blocking of CD161 is measured by measuring the level of cell signaling either by quantification of phosphorylation or expression of a gene reporter induced by relevant transcription factor.
- increased cell signaling indicates blocking of CD161.
- the CD161 antibodies of the present disclosure reduces CLEC2D binding to CD161 expressed on the surface of a cell with an IC50 of 20 nM, 15 nM, 10 nM, 9 nM, 8 nM, 7 nM, 6 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.75 nM, 0.5 nM, 0.1 nM, 0.075 nM, or 0.05 nM or lower.
- the antibody reduces CLEC2D binding with an IC50 from about 20 nM to about 0.05 nM, from about 20 nM to about 0.075 nM, from about 20 nM to about 0.1 nM, from about 20 nM to about 0.5 nM, from about 20 nM to about 1 nM, from about 10 nM to about 0.05 nM, from about 10 nM to about 0.075 nM, from about 10 nM to about 0.1 nM, from about 10 nM to about 0.5 nM, from about 10 nM to about 1 nM, from about 5 nM to about 0.05 nM, from about 5 nM to about 0.075 nM, from about 5 nM to about 0.1 nM, from about 5 nM to about 0.5 nM, from about 5 nM to about 1 nM, from about 3 nM to about 0.05 nM, from about 3 nM to about 0.075 nM, from
- the antibody reduces CLEC2D binding with an IC50 of about 0.1 nM to about 10 nM (e.g., about 0.15 nM, about 0.2 nM, about 0.25 nM, about 0.3 nM, about 0.35 nM, about 0.4 nM, about 0.45 nM, about 0.5 nM, about 0.55 nM, about 0.6 nM, about 0.65 nM, about 0.7 nM, about 0.75 nM, about 0.8 nM, about 0.85 nM, about 0.9 nM, about 0.95 nM, about 1 nM, about 1.5 nM, about 2 nM, about 2.5 nM, about 3 nM, about 3.5 nM, about 4 nM, about 4.5 nM, about 5 nM, about 5.5 nM, about 6 nM, about 6.5 nM, about 7 nM, about 7.5 nM, about 8 nM, about 8.5
- the CD161 antibodies bind to hKLRF1, hKLRF2, hCLEC12B, hCLEC2D, or any combination thereof with a KD of 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1,000 nM, 1,500 nM, 2,000 nM, 3,000 nM, 4,000 nM, 5,000 nM, 10,000 nM, or 20,000 nM or greater.
- the CD161 antibodies do not bind to human KLRF1.
- the CD161 antibodies do not bind to human KLRF2.
- the CD161 antibodies do not bind to human CLEC12B.
- the CD161 antibodies do not bind to human CLEC2D.
- the CD161 antibodies bind to human CD161 and cynomolgus CD161.
- the binding affinity, KD (as measured by a monovalent affinity assay) for human CD161 is within about 1.5-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 60-fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold, the affinity for cynomolgus CD161.
- the CD161 antibodies of the present disclosure reduce suppression of T cell or NK cell activity by CLEC2D binding to CD161.
- the suppression of T cell or NK cell activity by CLEC2D binding to CD161 is at least reduced by about 1.5-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7- fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 60-fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold compared to a control antibody (e.g., an antibody that does not bind CD161).
- a control antibody e.g., an antibody that does not bind CD161.
- the CD161 antibodies increase T cell or NK cell activity in the presence of CLEC2D as compared to such T cell or NK cell activity in the absence of the antibody or antigen binding fragment.
- the T cell or NK cell activity is increased by about 1.5-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 30-fold, about 40- fold, about 50-fold, about 60-fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold compared to a control antibody (e.g., an antibody that does not bind CD161).
- a control antibody e.g., an antibody that does not bind CD161.
- the T cells or NK cells are disposed within a microenvironment comprising cells expressing CLEC2D.
- the CD161 antibodies increase T cell or NK cell activity in a tumor microenvironment containing tumor cells that express CLEC2D.
- the increase in T cell activity is determined by an increase in NFAT signaling.
- the increase in NK cell activity is determined by an increase in CD107a expression.
- the T cell or NK cell activity in a tumor microenvironment is increased by about 1.5-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 60-fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold compared to a control antibody (e.g., an antibody that does not bind CD161).
- a control antibody e.g., an antibody that does not bind CD161
- an antibody or antigen-binding fragment thereof provided herein reduces CD161 inhibitory signaling, as measured by one or more assays or biological effects described herein.
- the CD161 antibodies of the present disclosure reduces CD161 inhibitory signaling due to binding of CLEC2D to CD161.
- CD161 inhibitory signaling is reduced by about 1.5-fold, about 2-fold, about 3- fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10- fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 60-fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold compared to a control antibody (e.g., an antibody that does not bind CD161).
- a control antibody e.g., an antibody that does not bind CD161.
- the CD161 antibodies of the present disclosure promote activation and cytokine production of CD8+ T cells within the tumor microenvironment.
- an antibody or antigen-binding fragment thereof activates and increases cytokine production of CD8+ T cells within the tumor microenvironment by about 1.5-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 7-fold, about 8-fold, about 9-fold, about 10-fold, about 20-fold, about 30-fold, about 40-fold, about 50-fold, about 60- fold, about 70-fold, about 80-fold, about 90-fold, or about 100-fold compared to a control antibody (e.g., an antibody that does not bind CD161).
- a control antibody e.g., an antibody that does not bind CD161.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 7, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 11, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 7, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 11.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 15, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 19, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 15, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 19.
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 23, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 27, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 23, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 27
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 31, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 35, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 31, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO: 35
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 39, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 43, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 39, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID NO:
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 47, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 51, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 47, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ ID
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 55, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 59, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 55, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 63, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 67, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 63, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 71, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 75, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 71, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 79, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 83, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 79, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 87, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 91, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 87, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 101, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 105, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 101, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 109, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 113, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 109, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 117, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 121, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 117, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 125, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 129, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 125, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 133, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 137, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 133, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 141, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 145, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 141, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 149, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 153, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 149, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- an antibody provided herein comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 157, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 161, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 157, and an immunoglobulin light chain variable region comprising the amino acid sequence of SEQ
- an antibody provided herein (i) comprises an immunoglobulin heavy chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 165, and an immunoglobulin light chain variable region comprising an amino acid sequence that is at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 169, and (ii) competes for binding to human CD161 with and/or binds to same epitope on human CD161 as an antibody comprising an immunoglobulin heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 165, and an immunoglobulin light chain variable region comprising the amino acid sequence of
- the antibodies disclosed herein may be further optimized (e.g., affinity-matured) to improve biochemical characteristics including affinity and/or specificity, improve biophysical properties including aggregation, stability, precipitation and/or non-specific interactions, and/or to reduce immunogenicity.
- diversity can be introduced into an immunoglobulin heavy chain and/or an immunoglobulin light chain by DNA shuffling, chain shuffling, CDR shuffling, random mutagenesis and/or site-specific mutagenesis.
- isolated human antibodies contain one or more somatic mutations. In these cases, antibodies can be modified to a human germline sequence to optimize the antibody (i.e., a process referred to as germlining).
- an optimized antibody has at least the same, or substantially the same, affinity for the antigen as the non-optimized (or parental) antibody from which it was derived. Preferably, an optimized antibody has a higher affinity for the antigen when compared to the parental antibody.
- An antibody disclosed herein can be conjugated to an effector agent such as a small molecule toxin or a radionuclide using standard in vitro conjugation chemistries. If the effector agent is a polypeptide, the antibody can be chemically conjugated to the effector or joined to the effector as a fusion protein. Construction of fusion proteins is within ordinary skill in the art.
- an antibody or an antigen-binding fragment thereof provided herein has one or more of the characteristics listed in the following (a)- (t): (a) binds human CD161; (b) binds human CD161 at a human CD161 binding site; (c) binds to the CD161 epitope bound by an anti-CD161 antibody or antigen-binding fragment thereof; (d) binds human CD161 at or near a CLEC2D binding site; (e) competes for binding to CD161 with CLEC2D; (f) reduces CD161 inhibitory signaling due to binding of CLEC2D to CD161; (g) reduces suppression of T cell activity by CLEC2D binding to CD161; (h) reduces suppression of NK cell activity by CLEC2D binding to CD161; (i) increases T cell activity in the presence of CLEC2D as compared to such T cell activity in the absence of the antibody or antigen-binding fragment thereof; (j) increases
- the antibodies provided herein are monospecific antibodies.
- the antibodies provided herein are multispecific antibodies.
- a multispecific antibody can bind more than one antigen, e.g., two antigens, three antigens, for antigens or five antigens.
- a multispecific antibody can bind more than one epitope on a CD161 antigen, e.g., two epitopes on a CD161 antigen or three epitopes on a CD161 antigen.
- the multispecific antibody comprises an immunoglobulin comprising at least two different heavy chain variable regions each paired with a common light chain variable region (i.e., a “common light chain antibody”).
- the common light chain variable region forms a distinct antigen-binding domain with each of the two different heavy chain variable regions (see Merchant et al. (1998) NATURE BIOTECHNOL., 16: 677-681, incorporated by reference in its entirety).
- the multispecific antibody comprises an immunoglobulin comprising an antibody attached to one or more of the N- or C-termini of the heavy or light chains of such immunoglobulin (see Coloma and Morrison (1997) NATURE BIOTECHNOL., 15: 159-163, incorporated by reference in its entirety).
- such antibody comprises a tetravalent bispecific antibody.
- the multispecific antibody comprises a hybrid immunoglobulin comprising at least two different heavy chain variable regions and at least two different light chain variable regions (see Milstein and Cuello (1983) NATURE, 305: 537-540; and Staerz and Bevan (1986) PROC. NATL. ACAD. SCI.
- the multispecific antibody comprises immunoglobulin chains with alterations to reduce the formation of side products that do not have multi-specificity.
- the antibodies comprise one or more “knobs-into-holes” modifications as described in U.S. Patent No.5,731,168, incorporated by reference in its entirety.
- the multispecific antibody comprises immunoglobulin chains with one or more electrostatic modifications to promote the assembly of Fc hetero-multimers (see WO2009/089004, incorporated by reference in its entirety).
- the multispecific antibody comprises a bispecific single chain molecule (see Traunecker et al.
- the multispecific antibody comprises a heavy chain variable domain and a light chain variable domain connected by a polypeptide linker, where the length of the linker is selected to promote assembly of multispecific antibodies with the desired multispecificity.
- monospecific scFvs generally form when a heavy chain variable domain and light chain variable domain are connected by a polypeptide linker of more than 12 amino acid residues (see U.S.
- reduction of the polypeptide linker length to less than 12 amino acid residues prevents pairing of heavy and light chain variable domains on the same polypeptide chain, thereby allowing pairing of heavy and light chain variable domains from one chain with the complementary domains on another chain.
- the resulting antibodies therefore have multi-specificity, with the specificity of each binding site contributed by more than one polypeptide chain.
- Polypeptide chains comprising heavy and light chain variable domains that are joined by linkers between 3 and 12 amino acid residues form predominantly dimers (termed diabodies).
- the multispecific antibody comprises a diabody (see Hollinger et al. (1993) PROC. NATL. ACAD. SCI.
- the multispecific antibody comprises a trispecific F(ab’) 3 derivative (see Tutt et al. (1991) J. IMMUNOL., 147: 60-69, incorporated by reference in its entirety).
- the multispecific antibody comprises a cross-linked antibody (see U.S.
- the multispecific antibody comprises antigen-binding domains assembled by leucine zippers (see Kostelny et al. (1992) J. IMMUNOL., 148: 1547-1553, incorporated by reference in its entirety).
- the multispecific antibody comprises a DuoBody ® , for example, as in Labrijn et al. (2013) PROC. NATL. ACAD. SCI.
- an antibody provided herein may be altered to increase, decrease or eliminate the extent to which it is glycosylated.
- Glycosylation of polypeptides is typically either “N-linked” or “O-linked.” “N-linked” glycosylation refers to the attachment of a carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- X is any amino acid except proline
- glycosylation site refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- Addition or deletion of N-linked glycosylation sites to or from an antibody provided herein may be accomplished by altering the amino acid sequence such that one or more of the above-described tripeptide sequences is created or removed.
- Addition or deletion of O-linked glycosylation sites may be accomplished by addition, deletion, or substitution of one or more serine or threonine residues in or to (as the case may be) the sequence of an antibody.
- an antibody provided herein comprises a glycosylation motif that is different from a naturally occurring antibody. Any suitable naturally occurring glycosylation motif can be modified in the antibodies provided herein.
- an antibody provided herein comprises an IgG 1 Fc region with modification to the oligosaccharide attached to asparagine 297 (Asn 297).
- Naturally occurring IgG 1 antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn 297 of the C H2 domain of the Fc region (see Wright et al.
- the oligosaccharide attached to Asn 297 may include various carbohydrates such as mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the “stem” of the biantennary oligosaccharide structure.
- the oligosaccharide attached to Asn 297 is modified to create antibodies having altered ADCC.
- the oligosaccharide is altered to improve ADCC.
- the oligosaccharide is altered to reduce ADCC.
- an antibody provided herein comprises an IgG1 domain with reduced fucose content at position Asn 297 compared to a naturally occurring IgG1 domain.
- Such Fc domains are known to have improved ADCC (see Shields et al. (2002) J. BIOL. CHEM., 277: 26733-26740, incorporated by reference in its entirety).
- such antibodies do not comprise any fucose at position Asn 297.
- the amount of fucose may be determined using any suitable method, for example as described in WO2008/077546, incorporated by reference in its entirety.
- an antibody provided herein comprises a bisected oligosaccharide, such as a biantennary oligosaccharide attached to the Fc region of the antibody that is bisected by GlcNAc.
- a bisected oligosaccharide such as a biantennary oligosaccharide attached to the Fc region of the antibody that is bisected by GlcNAc.
- Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, for example, in WO 2003/011878; and U.S. Patent No.6,602,684; each of which is incorporated by reference in its entirety.
- an antibody provided herein comprises an Fc region with at least one galactose residue in the oligosaccharide attached to the Fc region.
- Such antibody variants may have improved CDC function.
- Examples of such antibody variants are described, for example, in WO1997/30087; WO1998/58964; and WO1999/22764; each of which is incorporated by reference in its entirety.
- Examples of cell lines capable of producing defucosylated antibodies include Lec13 CHO cells, which are deficient in protein fucosylation (see Ripka et al. (1986) ARCH. BIOCHEM. BIOPHYS., 249: 533-545; U.S.
- an antibody provided herein is an aglycosylated antibody.
- An aglycosylated antibody can be produced using any method known in the art or described herein.
- an aglycosylated antibody is produced by modifying the antibody to remove all glycosylation sites. In some aspects, the glycosylation sites are removed only from the Fc region of the antibody. In some aspects, an aglycosylated antibody is produced by expressing the antibody in an organism that is not capable of glycosylation, such as E. coli, or by expressing the antibody in a cell-free reaction mixture. [00316] In some embodiments, an antibody provided herein has a constant region with reduced effector function compared to a native IgG1 antibody. In some embodiments, the affinity of a constant region of an Fc region of an antibody provided herein for Fc receptor is less than the affinity of a native IgG1 constant region for such Fc receptor. 5.
- the anti-CD161 antibody of the present disclosure is an IgG type antibody.
- each of the anti-CD161 antibodies disclosed in TABLE 4 is fused to an Immunoglobulin Fc domain (e.g., an Immunoglobulin Fc domain derived from a human IgG 1 , a human IgG2, a human IgG3, a human IgG4, a human IgA1, a human IgA2, a human IgD, a human IgE, or a human IgM Fc domain).
- each of the anti-CD161 antibodies disclosed in TABLE 4 is fused to an Immunoglobulin Fc domain derived from a human IgG1.
- an antibody provided herein comprises an Fc region with one or more amino acid substitutions, insertions, or deletions in comparison to a naturally occurring Fc region.
- substitutions, insertions, or deletions yield antibodies with altered stability, glycosylation, or other characteristics.
- substitutions, insertions, or deletions yield aglycosylated antibodies.
- the immunoglobulin Fc domain is derived from a human IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgD, IgE, and IgM Fc domain.
- a single amino acid substitution (S228P according to Kabat numbering; designated IgG4Pro) may be introduced to abolish the heterogeneity observed in recombinant IgG4 antibody (see Angal, S. et al. (1993) MOL. IMMUNOL., 30:105-108).
- the Fc region of an antibody provided herein is modified to yield an antibody with altered affinity for an Fc receptor, or an antibody that is more immunologically inert.
- the antibody variants provided herein possess some, but not all, effector functions.
- the Fc region of an antibody provided herein is a human IgG4 Fc region comprising one or more of the hinge stabilizing mutations S228P and L235E (see Aalberse et al. (2002) IMMUNOLOGY, 105: 9-19, incorporated by reference in its entirety).
- the IgG4 Fc region comprises one or more of the following mutations: E233P, F234V, and L235A (see Armour et al. (2003) MOL.
- the IgG4 Fc region comprises a deletion at position G236.
- the Fc region of an antibody provided herein is a human IgG1 Fc region comprising one or more mutations to reduce Fc receptor binding.
- the Fc domain comprises one or more mutation such as those described in U.S. Patent No.8,394,925, which is hereby incorporated by reference in its entirety.
- the Fc region is a variant Fc region comprising amino acid substitutions at positions 428 and 434, wherein the amino acid substitutions are a leucine that is not the wild- type amino acid at position 428 and a serine that is not the wild-type amino acid at position 434, wherein the polypeptide is an antibody and wherein numbering is according to the EU Index in Kabat et al.
- the Fc region comprises a S228P, L235E, M428L, or N434S substitution.
- the Fc region comprises a M428L substitution.
- the Fc region comprises a N434S substitution.
- the Fc region comprises a M428L and a N434S substitution. In some embodiments, the Fc region comprises a M252Y, S254T, and/or T256E substitution.
- the antibody comprises a PVA236 mutation.
- PVA236 means that the amino acid sequence ELLG (SEQ ID NO: 195), from amino acid position 233 to 236 of IgG1 or EFLG (SEQ ID NO: 196) of IgG4, is replaced by PVA (see U.S. Patent. No.9,150,641, incorporated by reference in its entirety).
- the Fc region of an antibody provided herein is a human IgG 2 Fc region comprising one or more of mutations A330S and P331S.
- the Fc region of an antibody provided herein has an amino acid substitution at one or more positions selected from 238, 265, 269, 270, 297, 327 and 329 (see U.S. Patent No.6,737,056, incorporated by reference in its entirety).
- Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called “DANA” Fc mutant with substitution of residues 265 and 297 with alanine (see U.S.
- the antibody comprises an alanine at amino acid position 265. In some embodiments, the antibody comprises an alanine at amino acid position 297. In certain embodiments, the human IgG1 constant region is modified at amino acid Asn297 to prevent to glycosylation of the antibody, for example Asn297Ala (N297A). In certain embodiments, the mutation is effective in eliminating the binding of the anti-CD161 antibody disclosed herein to the Fc ⁇ receptor (e.g. RI, RIIA, RIIB/C, RIIA, and RIIIB).
- the Fc ⁇ receptor e.g. RI, RIIA, RIIB/C, RIIA, and RIIIB.
- the mutation is effective in significantly reducing the binding of the anti-CD161 antibody disclosed herein to the Fc ⁇ receptor (e.g. RI, RIIA, RIIB/C, RIIA, and RIIIB).
- each of the anti-CD161 antibodies disclosed in TABLE 4 is fused to human IgG1 constant region modified at amino acid Asn297.
- an antibody provided herein comprises an Fc region with one or more amino acid substitutions which improve ADCC, such as a substitution at one or more of positions 298, 333, and 334 of the Fc region.
- an antibody provided herein comprises an Fc region with one or more amino acid substitutions at positions 239, 332, and 330, as described in Lazar et al. (2006) PROC. NATL. ACAD. SCI. USA, 103: 4005- 4010, incorporated by reference in its entirety. [00326] In some embodiments, an antibody provided herein comprises one or more alterations to increase half-life. In some embodiments, the Fc domain comprises a mutation such as those described in U.S. Patent No.7,670,600, which is hereby incorporated by reference in its entirety.
- the constant region comprises a mutation at position at amino acid residue 428 relative to a wild-type human IgG constant domain, numbered according to the EU numbering index of Kabat.
- an antibody comprising a mutation that corresponds to residue 428 can have an increased half-life compared to the half-life of an IgG having the wild-type human IgG constant domain.
- the mutation is a substitution of the native residue with a threonine, leucine, phenylalanine or serine.
- the antibody further comprises one or more amino acid substitutions relative to the corresponding wild-type human IgG constant domain at one or more of amino acid residues 251-256, 285-290, 308-314, 385-389, and 429-436, numbered according to the Kabat EU numbering index.
- the specific mutations or substitutions at these positions are described in U.S. Patent No.7,670,600, which is hereby incorporated by reference in its entirety. 6.
- the antibodies preferably are human antibodies or are engineered to reduce or eliminate antigenicity in humans.
- each humanized antibody has the same or substantially the same affinity for the antigen as the non-humanized mouse antibody from which it was derived.
- chimeric proteins are created in which mouse immunoglobulin constant regions are replaced with human immunoglobulin constant regions. See, e.g., Morrison et al., 1984, PROC. NAT. ACAD. SCI.81:6851-6855, Neuberger et al., 1984, NATURE 312:604-608; U.S. Patent Nos.6,893,625 (Robinson); 5,500,362 (Robinson); and 4,816,567 (Cabilly).
- CDR grafting In an approach known as CDR grafting, the CDRs of the light and heavy chain variable regions are grafted into frameworks from another species.
- murine CDRs can be grafted into human framework regions (FRs).
- the CDRs of the light and heavy chain variable regions of an antibody are grafted into human FRs or consensus human FRs.
- consensus human FRs FRs from several human heavy chain or light chain amino acid sequences are aligned to identify a consensus amino acid sequence. CDR grafting is described in U.S.
- human CDR sequences are chosen from human germline genes, based on the structural similarity of the human CDRs to those of the mouse antibody to be humanized. See, e.g., U.S. Patent No.6,881,557 (Foote); and Tan et al., 2002, J. IMMUNOL.169:1119-1125.
- Patent No.5,639,641 (Pedersen).
- ACTIVMAB TM technology Vaccinex, Inc., Rochester, NY
- a vaccinia virus-based vector to express antibodies in mammalian cells.
- High levels of combinatorial diversity of IgG heavy and light chains can be produced. See, e.g., U.S. Patent Nos.6,706,477 (Zauderer); 6,800,442 (Zauderer); and 6,872,518 (Zauderer).
- Another approach for converting a mouse antibody into a form suitable for use in humans is technology practiced commercially by KaloBios Pharmaceuticals, Inc.
- any suitable approach can be used to reduce or eliminate human immunogenicity of an antibody.
- Fully human mAbs lacking any non-human sequences can be prepared from human immunoglobulin transgenic mice by techniques referenced in, e.g., Lonberg et al., NATURE 368:856-859, 1994; Fishwild et al., NATURE BIOTECHNOLOGY 14:845-851, 1996; and Mendez et al., NATURE GENETICS 15:146-156, 1997.
- Fully human monoclonal antibodies can also be prepared and optimized from phage display libraries by techniques referenced in, e.g., Knappik et al., J. MOL. BIOL.296:57- 86, 2000; and Krebs et al., J. IMMUNOL. METH.254:67-842001).
- Anti-CD161 Antibody-Drug Conjugates [00335] The present disclosure further provides antibody conjugates containing one or more of the antibodies disclosed herein.
- the term “antibody conjugate” is understood to refer to an antibody, or a functional fragment thereof, that comprises antigen-binding activity (e.g., anti-CD161 antigen-binding activity) and/or Fc receptor-binding activity, conjugated (e.g., covalently coupled) to an additional functional moiety.
- the antibody conjugates are antibody-drug conjugates (ADCs) that comprise an antibody that binds specifically to CD161 and a cytotoxic agent.
- the cytotoxic agent can be linked directly or indirectly to the anti-CD161 antibody.
- the ADCs further comprise a linker that covalently links the cytotoxic agent to the anti-CD161 antibody.
- Exemplary cytotoxic agents useful in created ADCs include, for example, certain anti-tumor or anti-cancer agents known in the art.
- the cytotoxic agents cause destruction of cancer cells.
- the cytotoxic agents inhibit the growth or proliferation of cancer cells.
- Exemplary cytotoxic agents include anti-angiogenic agents, pro- apoptotic agents, anti-mitotic agents, anti-kinase agents, alkylating agents, hormones, hormone agonists, hormone antagonists, chemokines, drugs, prodrugs, toxins, enzymes, antimetabolites, antibiotics, alkaloids, and radioactive isotopes.
- the cytotoxic agent is coupled to the anti-CD161 antibody via a linker.
- an linker used to create the ADC comprises two reactive termini: an antibody conjugation reactive termini and an cytotoxic agent conjugation reactive termini.
- the antibody conjugation reactive terminus of the linker can be conjugated to the antibody through a cysteine thiol or lysine amine group on the antibody, for example, via a thiol- reactive group such as a double bond, a leaving group such as a chloro, bromo or iodo, an R- sulfanyl group or sulfonyl group, or an amine-reactive group such as a carboxyl group.
- the cytotoxic agent conjugation reactive terminus of the linker can be conjugated to the cytotoxic agent, for example, through formation of an amide bond with a basic amine or carboxyl group on the cytotoxin, typically a carboxyl or basic amine group.
- the linker can be a non-cleavable linker or a cleavable linker. 8. Methods of Making CD161 Antibodies 8.1 CD161 Antigen Preparation [00340]
- the CD161 antigen used for isolation of the antibodies provided herein may be intact CD161 or a fragment of CD161.
- the CD161 antigen may be, for example, in the form of an isolated protein or a protein expressed on the surface of a cell.
- the CD161 antigen is a non-naturally occurring variant of CD161, such as a CD161 protein having an amino acid sequence or post-translational modification that does not occur in nature.
- the CD161 antigen is truncated by removal of, for example, intracellular or membrane-spanning sequences, or signal sequences.
- the CD161 antigen is fused at its C-terminus to a human IgG1 Fc domain or a polyhistidine tag.
- Monoclonal antibodies may be obtained, for example, using the hybridoma method first described by Kohler et al. (1975) NATURE, 256: 495-497 (incorporated by reference in its entirety), and/or by recombinant DNA methods (see e.g., U.S. Patent No.4,816,567, incorporated by reference in its entirety). Monoclonal antibodies may also be obtained, for example, using phage-display libraries (see e.g., U.S. Patent No.8,258,082, which is incorporated by reference in its entirety) or, alternatively, using yeast-based libraries (see e.g., U.S.
- a mouse or other appropriate host animal is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
- lymphocytes may be immunized in vitro. Lymphocytes are then fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (see Goding J.W.
- the hybridoma cells are seeded and grown in a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- a suitable culture medium that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
- Useful myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive media conditions, such as the presence or absence of HAT medium.
- preferred myeloma cell lines are murine myeloma lines, such as those derived from MOP-21 and MC-11 mouse tumors (available from the Salk Institute Cell Distribution Center, San Diego, CA), and SP-2 or X63-Ag8-653 cells (available from the American Type Culture Collection, Rockville, MD).
- Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (see e.g., Kozbor (1984) J.
- hybridoma cells that produce antibodies of the desired specificity, affinity, and/or biological activity
- selected clones may be subcloned by limiting dilution procedures and grown by standard methods (see Goding, supra). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium.
- the hybridoma cells may be grown in vivo as ascites tumors in an animal.
- DNA encoding the monoclonal antibodies may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells can serve as a useful source of DNA encoding antibodies with the desired properties.
- the DNA may be placed into expression vectors, which are then transfected into host cells such as bacteria (e.g., E. coli), yeast (e.g., Saccharomyces or Pichia sp.), COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody, to produce the monoclonal antibodies.
- Humanized antibodies may be generated by replacing most, or all, of the structural portions of a non-human monoclonal antibody with corresponding human antibody sequences. Consequently, a hybrid molecule is generated in which only the antigen-specific variable, or CDR, is composed of non-human sequence.
- Methods to obtain humanized antibodies include those described in, for example, Winter and Milstein (1991) NATURE, 349: 293-299; Rader et al. (1998) PROC. NAT. ACAD. SCI. USA, 95: 8910-8915; Steinberger et al. (2000) J. BIOL. CHEM., 275: 36073-36078; Queen et al. (1989) PROC.
- Human antibodies can be generated by a variety of techniques known in the art, for example by using transgenic animals (e.g., humanized mice). See, e.g., Jakobovits et al. (1993) PROC. NATL. ACAD. SCI. USA, 90: 2551; Jakobovits et al. (1993) NATURE, 362: 255-258; Bruggermann et al.
- Human antibodies can also be derived from phage-display libraries (see e.g., Hoogenboom et al. (1991) J. MOL. BIOL., 227: 381-388; Marks et al. (1991) J. MOL. BIOL., 222: 581-597; and U.S. Patent Nos.5,565,332 and 5,573,905; each of which is incorporated by reference in its entirety). Human antibodies may also be generated by in vitro activated B cells (see e.g., U.S.
- Patent. Nos.5,567,610 and 5,229,275 each of which is incorporated by reference in its entirety.
- Human antibodies may also be derived from yeast-based libraries (see e.g., U.S. Patent Nos.8,691,730 and 9,354,228, incorporated by reference in its entirety).
- yeast-based libraries see e.g., U.S. Patent Nos.8,691,730 and 9,354,228, incorporated by reference in its entirety.
- Illustrative methods of making chimeric antibodies are described, for example, in U.S. Patent No.4,816,567; and Morrison et al. (1984) PROC. NATL. ACAD. SCI. USA, 81: 6851- 6855; each of which is incorporated by reference in its entirety.
- a chimeric antibody is made by using recombinant techniques to combine a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) with a human constant region.
- a non-human variable region e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey
- the antibody fragments provided herein may be made by any suitable method, including the illustrative methods described herein or those known in the art. Suitable methods include recombinant techniques and proteolytic digestion of whole antibodies. Illustrative methods of making antibody fragments are described, for example, in Hudson et al. (2003) NAT. MED., 9: 129-134, incorporated by reference in its entirety.
- scFv antibodies are described, for example, in Plückthun (1994) THE PHARMACOLOGY OF MONOCLONAL ANTIBODIES, VOL.113, Rosenburg and Moore eds., Springer-Verlag, New York, pp.269-315; WO93/16185; and U.S. Patent Nos.5,571,894 and 5,587,458; each of which is incorporated by reference in its entirety.
- the multispecific antibodies provided herein may be made by any suitable method, including the illustrative methods described herein or those known in the art. Methods of making common light chain antibodies are described in Merchant et al.
- an antibody provided herein is an affinity matured variant of a parent antibody, which may be generated, for example, using phage display-based affinity maturation techniques. Briefly, one or more CDR residues may be mutated and the variant antibodies, or portions thereof, displayed on phage and screened for affinity. Such alterations may be made in CDR “hotspots,” or residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see Chowdhury (2008) METHODS MOL.
- Any suitable method can be used to introduce variability into a polynucleotide sequence(s) encoding an antibody, including error-prone PCR, chain shuffling, and oligonucleotide-directed mutagenesis such as trinucleotide-directed mutagenesis (TRIM).
- TAM trinucleotide-directed mutagenesis
- CDR residues e.g., 4-6 residues at a time
- CDR residues involved in antigen binding may be specifically identified, for example, using alanine scanning mutagenesis or modeling.
- CDR-H3 and CDR-L3 in particular are often targeted for mutation.
- the introduction of diversity into the variable regions and/or CDRs can be used to produce a secondary library.
- the secondary library is then screened to identify antibody variants with improved affinity.
- Affinity maturation by constructing and reselecting from secondary libraries has been described, for example, in Hoogenboom et al. (2001) METHODS MOL. BIOL., 178: 1-37, incorporated by reference in its entirety.
- 8.7 Vectors, Host Cells, and Recombinant Methods [00356] Also provided are isolated nucleic acids encoding CD161 antibodies, vectors comprising the nucleic acids, and host cells comprising the vectors and nucleic acids, as well as recombinant techniques for the production of the antibodies.
- the nucleic acid(s) encoding it may be isolated and inserted into a replicable vector for further cloning (i.e., amplification of the DNA) or expression.
- the nucleic acid may be produced by homologous recombination, for example as described in U.S. Patent No.5,204,244, incorporated by reference in its entirety.
- Many different vectors are known in the art.
- the vector components generally include one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence, for example as described in U.S.
- suitable host cells include any suitable prokaryotic (e.g., bacterial), lower eukaryotic (e.g., yeast), or higher eukaryotic (e.g., mammalian) cells.
- suitable prokaryotes include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia (E. coli), Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella (S. typhimurium), Serratia (S. marcescans), Shigella, Bacilli (B. subtilis and B.
- E. coli 294 One useful E. coli cloning host is E. coli 294, although other strains such as E. coli B, E. coli X1776, and E. coli W3110 are also suitable.
- eukaryotic microbes such as filamentous fungi or yeast are also suitable cloning or expression hosts for CD161 antibody-encoding vectors. Saccharomyces cerevisiae, or common baker’s yeast, is a commonly used lower eukaryotic host microorganism.
- Schizosaccharomyces pombe Kluyveromyces (K. lactis, K. fragilis, K. bulgaricus K. wickeramii, K. waltii, K. drosophilarum, K. thermotolerans, and K. marxianus), Yarrowia, Pichia pastoris, Candida (C. albicans), Trichoderma reesia, Neurospora crassa, Schwanniomyces (S. occidentalis), and filamentous fungi such as, for example Penicillium, Tolypocladium, and Aspergillus (A. nidulans and A.
- Useful mammalian host cells include COS-7 cells, HEK293 cells, baby hamster kidney (BHK) cells, Chinese hamster ovary (CHO), mouse sertoli cells, African green monkey kidney cells (VERO-76), and the like.
- the host cells used to produce the CD161 antibody of this invention may be cultured in a variety of media.
- Commercially available media such as, for example, Ham’s F10, Minimal Essential Medium (MEM), RPMI-1640, and Dulbecco’s Modified Eagle’s Medium (DMEM) are suitable for culturing the host cells.
- any of the media described in Ham et al. (1979) METH any of the media described in Ham et al. (1979) METH.
- any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics, trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
- the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration.
- the particulate debris either host cells or lysed fragments.
- the antibody is produced in a cell-free system.
- the cell-free system is an in vitro transcription and translation system as described in Yin et al. (2012) MABS, 4: 217-225, incorporated by reference in its entirety.
- the cell-free system utilizes a cell-free extract from a eukaryotic cell or from a prokaryotic cell.
- the prokaryotic cell is E. coli.
- Cell-free expression of the antibody may be useful, for example, where the antibody accumulates in a cell as an insoluble aggregate, or where yields from periplasmic expression are low.
- supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon ® or Millipore ® Pellcon ® ultrafiltration unit.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being a particularly useful purification technique.
- affinity chromatography is a particularly useful purification technique.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
- Protein A can be used to purify antibodies that comprise human ⁇ 1, ⁇ 2, or ⁇ 4 heavy chains (Lindmark et al. (1983) J. IMMUNOL. METH., 62: 1-13, incorporated by reference in its entirety).
- Protein G is useful for all mouse isotypes and for human ⁇ 3 (Guss et al.
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose. Where the antibody comprises a CH3 domain, the BakerBond ABX ® resin is useful for purification.
- the antigen-binding activity is determined using an antigen- binding assay.
- the antigen-binding assay determines a binding affinity (KD) of the antibodies disclosed herein.
- the antigen-binding assay determines kinetic rate constants (e.g., k on , k off ) for the binding interaction of an anti-CD161 antibody for a CD161 polypeptide.
- kinetic characteristics of the binding interaction of a CD161 antibody to a target molecule are determined using an Octet QK384 assay.
- specific antigen-binding activity of the CD161 antibodies provided herein may also be evaluated by any suitable method, including using surface plasmon resonance (SPR), biolayer interferometry (BLI), enzyme-linked immunosorbent assay (ELISA), kinetic exclusion assay (KinExA), gel- shift assays, pull-down assays, quantitative immunoblot, equilibrium dialysis, analytical ultracentrifugation, fluorescence anisotropy, solution equilibrium titration, kinetic exclusion assay, and isothermal titration calorimetry.
- the antigen-binding assay comprises measuring binding affinity of a labeled anti-CD161 antibody for a CD161 polypeptide expressed on a cell surface.
- the anti-CD161 antibody is labeled with a fluorescent molecule (e.g., a fluorescent dye).
- binding is detected using a method of fluorescence detection (e.g., flow cytometry).
- binding of an anti-CD161 antibody disclosed herein to a cell expressing the antigen is compared relative to a reference cell lacking expression of the antigen.
- the antigen binding assay is surface plasmon resonance.
- “Surface plasmon resonance” includes an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example using the BIAcore system (Pharmacia Biosensor AB, Uppsala, Sweden and Piscataway, NJ).
- BIAcore Phharmacia Biosensor AB, Uppsala, Sweden and Piscataway, NJ.
- the antigen binding assay is biolayer interferometry (BLI).
- biolayer interferometry or “BLI” includes an optical phenomenon that allows for the measurement of sub-nanometer changes in the thickness of its optical layer detection surface.
- biomolecules binds at a sensor surface and change the optical layer thickness. The magnitude of the optical layer thickness change is proportional to the mass or molecular weight of the binding molecule.
- CD161 is immobilized to the sensor surface to measure binding by an antibody, wherein binding creates a changes in the molecular weight to produce a corresponding change in the optical layer thickness.
- samples of the anti- CD161 antibody are prepared by serial dilution and injected, and KD values are calculated from modeling of the curve of binding relative to antibody concentration.
- BLI is performed with an Octet QK384 system (ForteBio), i.e., the antigen-binding assay is an Octet QK384 assay.
- an anti-CD161 antibody described herein binds human CD161 and blocks or inhibits binding by CLEC2D as determined by a ligand binding assay.
- a ligand binding assay is an assay that provides a measure of the interactions and/or degree of affinity that occur between a receptor and ligand.
- a ligand binding assay is used to determine the extent of binding of a ligand molecule (e.g., CLEC2D) to a receptor (e.g., CD161).
- a ligand binding assay comprises detecting the formation of a complex between a ligand and a receptor.
- a ligand binding assay comprises determining the dissociation of a ligand : receptor complex.
- the formation and/or dissociation of a ligand : receptor complex is determined by detection of a fluorescently-labeled ligand in complex with a receptor. In some embodiments, the formation and/or dissociation of a ligand : receptor complex is determined by detection and/or quantification of an amount of fluorescently-labeled receptor in complex with a ligand. In some embodiments, the formation and/or dissociation of a ligand : receptor complex is determined by detection and/or quantification of an amount of a fluorescently-labeled antibody that specifically binds to the ligand : receptor complex.
- Methods of detecting and quantifying fluorescence include, but are not limited to, fluorescence polarization (FP), fluorescence anisotropy (FA), flow cytometry and microscopy.
- FP fluorescence polarization
- FA fluorescence anisotropy
- the formation and/or dissociation of a ligand : receptor complex is determined by detection and/or quantification of an amount of a radioactively-labeled ligand in complex with a receptor.
- the formation and/or dissociation of a ligand : receptor complex is determined by detection and/or quantification of an amount of radioactively-labeled receptor in complex with a ligand.
- the formation and/or dissociation of a ligand : receptor complex is determined by detection and/or quantification of an amount of a radioactively-labeled antibody that specifically binds to the ligand : receptor complex.
- an antibody of the present disclosure e.g., an anti-CD161 antibody
- binds to a receptor e.g., CD161
- disrupts, inhibits, or blocks the formation of ligand : receptor complex e.g., a CD161:CLEC2D complex.
- CD161 antibodies described herein are characterized by epitope binding on CD161.
- the binding epitope of each CD161 antibody on CD161 ligand is determined by sufrace plasmon resonance, e.g., using a Biacore 8K instrument.
- the epitope is determined by peptide competition. In some embodiments, the epitope is determined by mass spectrometry. In some embodiments, the epitope is determined by crystallography (e.g., x-ray crystallography).
- a crystal structure of a bonded antibody-antigen pair enables very accurate determination of key interactions between individual amino acids from both side chains and main chain atoms in both the epitope of the antigen and the paratope of the antibody.
- Amino acids that are within 4 angstroms ( ⁇ ) of each other are generally considered to be contacting residues.
- the methodology typically involves purification of antibody and antigen, formation and purification of the complex, followed by successive rounds of crystallization screens and optimization to obtain diffraction-quality crystals.
- Structural solution is obtained following x-ray crystallography frequently at a synchrotron source.
- the anti-CD161 antibodies or antigen-binding portions thereof provided by the disclosure may be assessed through x-ray crystallographic analysis of a crystal structure comprising an antibody bound to human CD161, or a fragment or portion thereof.
- the epitopes that are bound by the antibodies provided by the disclosure are identified by determining the residues on the human CD161 antigen that reside or are located within 4 angstroms ( ⁇ ) of an antibody paratope residue.
- Other structural methods for epitope mapping include, but are not limited to, hydrogen-deuterium exchange coupled to mass spectrometry, crosslinking-coupled mass spectrometry, and nuclear magnetic resonance (NMR) (see, e.g., Morris (1996), supra; Abbott et al.
- Functional methods for epitope mapping are well known in the art and typically involve an assessment or quantification of antibody binding to whole proteins, protein fragments or peptides. Functional methods for epitope mapping can be used, for example, to identify linear or conformational epitopes and/or can be used to infer when two or more distinct antibodies bind to the same or similar epitopes. Functional methods for epitope mapping include, for example, immunoblotting assays, immunoprecipitation assays, and fluorescence-based labeling assays, wherein overlapping or contiguous peptides from CD161 are tested for reactivity with an anti- CD161 antibody (e.g., HP-3G10).
- an anti- CD161 antibody e.g., HP-3G10
- epitope mapping examples include array- based oligopeptide scanning (alternatively known as “overlapping peptide scanning” or “pepscan analysis”), site-directed mutagenesis (e.g., alanine-scanning mutagenesis), and high-throughput mutagenesis mapping (e.g., shotgun mutagenesis mapping).
- the epitope bound by an anti-CD161 antibody described herein is determined using site-directed mutagenesis or alanine scanning mutagenesis.
- the site- directed mutagenesis method involves targeted site-directed mutagenesis where critical amino acids are identified by systematically introducing substitutions along the protein sequence and then determining the effects of each substitution on antibody binding.
- alanine scanning mutagenesis is a technique that involves the substitution of an alanine residue for a wild- type residue in a polypeptide, followed by an assessment of the stability or function(s) (e.g., binding affinity) of the alanine-substituted derivative or mutant polypeptide and comparison to the wild-type polypeptide.
- two or more antibodies have the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of the first antibody reduce or eliminate binding of the second or more antibodies.
- the epitope bound by an anti-CD161 antibody described herein is determined using shotgun mutagenesis. Shotgun mutagenesis mapping utilizes a comprehensive plasmid- mutation library for the target gene, with each clone in the library bearing a unique amino acid mutation and the entire library covering every amino acid in the target protein. The clones that constitute the mutation library are individually arranged in microplates, expressed within living mammalian cells, and tested for immunoreactivity with antibodies of interest.
- the epitope bound by an anti-CD161 antibody described herein is determined using peptide scanning methods.
- peptide scanning libraries of short peptide sequences from overlapping segments of the target protein (e.g., CD161) are tested for their ability to bind antibodies of interest.
- the peptides are synthesized and screened for binding, e.g. using ELISA or BIACORE, or on a chip, by any of the multiple methods for solid- phase screening (Reineke et al. (2001) CURR. OPIN. BIOTECHNOL., 12: 59-64, ) as in the “pepscan” methodology (WO1984/03564; WO1993/09872, each of which is incorporated by reference in its entirety).
- Conformation epitopes may be identified via chemical linkage of peptides onto scaffolds (CLIPS).
- the loose ends of the peptides are affixed onto synthetic scaffolds, so that the scaffolded peptide may be able to adopt the same spatial structure as the corresponding sequence in the intact protein.
- CLIPS technology is used to fix linear peptides into cyclic structures (‘single-loop’ format), and to bring together different parts of a protein binding site (‘double- loop’, ‘triple-loop’, etc. format), so as to create conformational epitopes that may be assayed for antibody binding. (US Patent No.7,972,993).
- the epitopes bound by antibodies provided by the disclosure may also be mapped using computational methods. In these methods, for example, libraries of peptide fragments are displayed on the surface of the phage or cell.
- Epitopes are then mapped by screening antibodies against these fragments using selective binding assays.
- a number of computational tools have been developed which allow the prediction of conformational epitopes based upon linear affinity-selected peptides obtained using phage display (Mayrose et al. (2007) BIOINFORMATICS, 23: 3244-3246). Methods are also available for the detection of conformational epitopes by phage display. Microbial display systems may also be used to express properly folded antigenic fragments on the cell surface for identification of conformational epitopes (Cochran et al. (2004) J. IMMUNOL. METH., 287: 147- 158; Rockberg et al. (2008) NATURE METHODS, 5: 1039-1045).
- proteolysis and mass spectroscopy may also be used to determine antibody epitopes (Baerga-Ortiz et al. (2002) PROTEIN SCI., 11(6): 1300-1308).
- the antigen is cleaved by different proteases, in the presence and in the absence of the antibody, and the fragments are identified by mass spectrometry.
- the epitope is the region of the antigen that becomes protected from proteolysis upon binding of the antibody (Suckau et al. (1990) PROC. NATL. ACAD. SCI. USA, 87: 9848-9852).
- Additional proteolysis based methods include, for example, selective chemical modification (Fiedler et al.
- BIOCONJUGATE CHEMISTRY, 9(2): 236-234 epitope excision
- epitope excision Van de Water et al. (1997) CLIN. IMMUNOL. IMMUNOPATHOL., 85(3): 229-235)
- H/D hydrogen-deuterium
- an anti-CD161 antibody as described herein binds to CD161 and induces or promotes activation of immune cell effector function, wherein the immune cell is any CD161-expressing immune cell, or wherein the immune cell is a CD161-expressing T cell, a CD161-expressing NK cell, or a combination thereof.
- an anti-CD161 antibody as described herein binds to CD161 and induces or promotes activation, proliferation, cytokine production, cytolytic function or any combination thereof of a CD161-expressing T cell or a CD161-expressing NK cell.
- an anti-CD161 antibody as described herein activates a mucosal-associated invariant T cell (MAIT cell).
- the anti-CD161 antibody of the present disclosure activates a MAIT cell by CD161 blockade.
- an anti-CD161 antibody as described herein binds to CD161 and induces or promotes T cell activation, a cytotoxic T lymphocyte (CTL) response, T cell proliferation, cytokine production, or a combination thereof.
- CTL cytotoxic T lymphocyte
- an anti-CD161 antibody as described herein binds to and competes with or blocks CD161 binding to CLEC2D.
- blocking of CD161 is measured by determining ligand (e.g., CLEC2D) binding.
- an anti-CD161 antibody as described herein binds to CD161 on a CD161-expressing T cell or a CD161-expressing NK cell and induces or promotes activation of the T cell or NK cell immune cell effector function in the presence of CLEC2D.
- activation of a CD161-expressing NK cell is determined by adding an anti-CD161 antibody to a culture of CD161-expressing NK cells in the presence of CLEC2D.
- the CLEC2D ligand is expressed in human cancer cells co- cultured with the NK cells.
- Activation of human NK cells can be measured by CD107a expression of NK cells after exposure to an anti-CD161 antibody, e.g., in a dose-dependent manner.
- Activation of human NK cells can be measured by IFN ⁇ secretion after exposure to an anti-CD161 antibody, e.g., in a dose-dependent manner.
- the CD161 antibody effectiveness to block inhibitory signaling in human NK cells in the presence of CLEC2D is provided as an EC50 (nM) value, for example, as determined in Example 7.
- the EC 50 value for CD161 antibody activation or blocking of human NK cells in the presence of CLEC2D is between 0.04 nM and 0.38 nM.
- activation of a CD161-expressing T cell is determined by adding an anti-CD161 antibody to a culture of CD161-expressing T cells in the presence of CLEC2D.
- the CLEC2D ligand is expressed in human cancer cells co- cultured with the T cells.
- T cell activation is measured using an NFAT- Luciferase reporter gene system (InvivoGen) in engineered T cells.
- the anti-CD161 effectiveness to block inhibitory signaling in T cells in the presence of CLEC2D is provided as described, for example, in Examples 8 and 9.
- the EC50 value for CD161 antibody activation or blocking of human T cells in the presence of CLEC2D is between 1.5 nM and 4.1 nM.
- the antibody of the present disclosure reverses CLEC2D- mediated inhibition and restores primary NK cell and T cell functions, as well as enhanced T cell recall response to antigen and direct T cell mediated cytotoxicity in a TCR-dependent manner.
- the antibody disclosed herein reverses inhibition of NK cell killing by blocking the interaction of CD161 on NK cells with CLEC2D on target cells as described, for example, in Example 13.
- the antibody restores cytotoxic degranulation by NK cells, as well as expression of IFN ⁇ .
- restoration of NK cell activation can be measured by CD107a expression of NK cells after exposure to an anti-CD161 antibody, e.g., in a dose-dependent manner.
- Activation of human NK cells can be measured by IFN ⁇ secretion after exposure to an anti-CD161 antibody, e.g., in a dose-dependent manner.
- the antibody disclosed herein enhances NK cell killing of CLEC2D expressing target cells.
- the antibody disclosed herein enhances NK cell killing of CLEC2D expressing target cells by blocking the interaction of CD161 on NK cells with CLEC2D on target cells as described, for example in Example 14.
- the antibody disclosed herein enhances re-activation of antigen specific effector memory CD4 T cells by blocking CD161 (expressed on T cells) interaction with CLEC2D (expressed on monocyte-derived DCs) as described, for example in Example 15.
- the antibody results in enhanced cytokine production and increased proliferation (e.g., as measured by Ki-67 expression) by antigen-specific effector memory T (EM cells).
- the antibody disclosed herein enhances the cytokine production of MART-1-specific T cells as described, for example in Example 16.
- the antibody disclosed herein enhances the production of interferon gamma (IFN ⁇ ), interleukin-2 (IL-2) and tumor necrosis factor alpha (TNF ⁇ ) from CD8+ T cells, e.g., in a concentration-dependent manner.
- IFN ⁇ interferon gamma
- IL-2 interleukin-2
- TNF ⁇ tumor necrosis factor alpha
- the antibody of the present disclosure enhances cytotoxicity function of MART-1 specific T cells as described, for example in Example 17.
- the antibody of the present disclosure increases the frequency of Granzyme B producing T cells, e.g., in a concentration-dependent manner.
- antibody of the present disclosure did not induce cytokine release in unstimulated human PBMCs from healthy donors (e.g., cytokine release syndrome).
- compositions for therapeutic use, an antibody or antigen binding fragment thereof or antibody conjugate preferably is combined with a pharmaceutically acceptable carrier.
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- pharmaceutically acceptable carrier refers to buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable carriers include any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g., such as an oil/water or water/oil emulsions), and various types of wetting agents.
- the compositions also can include stabilizers and preservatives.
- Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art.
- a pharmaceutical composition may contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolarity, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen-sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta- cyclodextrin or hydroxypropyl-beta-cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents
- amino acids
- a pharmaceutical composition may contain nanoparticles, e.g., polymeric nanoparticles, liposomes, or micelles (see Anselmo et al. (2016) BIOENG. TRANSL. MED., 1: 10-29).
- a pharmaceutical composition may contain a sustained- or controlled-delivery formulation. Techniques for formulating sustained- or controlled-delivery means, such as liposome carriers, bio-erodible microparticles or porous beads and depot injections, are also known to those skilled in the art.
- Sustained-release preparations may include, e.g., porous polymeric microparticles or semipermeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules.
- Sustained release matrices may include polyesters, hydrogels, polylactides, copolymers of L-glutamic acid and gamma ethyl-L-glutamate, poly (2- hydroxyethyl-methacrylate), ethylene vinyl acetate, or poly-D( ⁇ )-3-hydroxybutyric acid.
- Sustained release compositions may also include liposomes that can be prepared by any of several methods known in the art.
- compositions containing an antibody or antigen binding fragment thereof, or an antibody conjugate disclosed herein can be presented in a dosage unit form and can be prepared by any suitable method.
- a pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, intrathecal and rectal administration.
- IV intravenous
- an antibody, or antigen binding fragment thereof, or an antibody conjugate disclosed herein is administered by IV infusion.
- an antibody or antigen binding fragment thereof, or an antibody conjugate disclosed herein is administered by intratumoral injection.
- Useful formulations can be prepared by methods known in the pharmaceutical art (see, e.g., REMINGTON’S PHARMACEUTICAL SCIENCES, 18th ed. (Mack Publishing Company, 1990) and Adeboye Adejare, REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY (23d ed.2020)).
- Formulation components suitable for parenteral administration include a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as EDTA; buffers such as acetates, citrates or phosphates; and agents for the adjustment of tonicity such as sodium chloride or dextrose.
- a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents
- antibacterial agents such as benzyl alcohol or methyl parabens
- antioxidants such as ascorbic acid or sodium bisulfite
- chelating agents such as EDTA
- buffers such as acetates, citrates or phosphates
- suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, NJ) or phosphate buffered saline (PBS).
- the carrier should be stable under the conditions of manufacture and storage, and should be preserved against microorganisms.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol), and suitable mixtures thereof.
- a pharmaceutical composition may contain a stabilizing agent.
- the stabilizing agent is a cation, such as a divalent cation.
- the cation is calcium or magnesium.
- the cation can be in the form of a salt, such as calcium chloride (CaCl2) or magnesium chloride (MgCl2).
- the stabilizing agent is present in an amount from about 0.05 mM to about 5 mM.
- the stabilizing agent may be present in an amount of from about 0.05 mM to about 4 mM, from about 0.05 mM to about 3 mM, from about 0.05 mM to about 2 mM, from about 0.05 mM to about 1 mM, from about 0.05 mM to about 0.5 mM, from about 0.5 mM to about 4 mM, from about 0.5 mM to about 3 mM, from about 0.5 mM to about 2 mM, from about 0.5 mM to about 1 mM, from about 1 mM to about 4 mM, from about 1 mM to about 3 mM, of from about 1 mM to about 2 mM.
- compositions preferably are sterile. Sterilization can be accomplished by any suitable method, e.g., filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.
- the compositions described herein may be administered locally or systemically. Administration will generally be parenteral administration. In a preferred embodiment, the pharmaceutical composition is administered subcutaneously and in an even more preferred embodiment intravenously. Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
- a therapeutically effective amount of active component for example, an antibody
- the amount administered will depend on variables such as the weight of the patient, the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody, the pharmaceutical formulation, and the route of administration.
- the initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue-level. Alternatively, the initial dosage can be smaller than the optimum, and the daily dosage may be progressively increased during the course of treatment.
- Human dosage can be optimized, e.g., in a conventional Phase I dose escalation study designed to run from about 0.1 mg/kg to about 20 mg/kg.
- Dosing frequency can vary depending on factors such as route of administration, dosage amount, serum half-life of the antibody, and the disease being treated. Exemplary dosing frequencies are once per day, once per week, once every two weeks, once every three weeks.
- a preferred route of administration is parenteral, e.g., intravenous infusion.
- an antibody is lyophilized, and then reconstituted in buffered saline, at the time of administration.
- a starting dose of 6 mg (0.1 mg/kg based on a 60 kg patient weight) of the anti-CD161 antibody is administered (e.g., via IV) once every three weeks.
- Dosage and Unit Dosage Forms [00406] In human therapeutics, the doctor will determine the posology which he or she considers most appropriate according to a preventive or curative treatment and according to the age, weight, condition and other factors specific to the subject to be treated.
- a composition provided herein is a pharmaceutical composition or a single unit dosage form. Pharmaceutical compositions and single unit dosage forms provided herein comprise a therapeutically effective amount of one or more therapeutic antibodies.
- the amount of the antibody which will be effective in the prevention or treatment of a disorder or one or more symptoms thereof can vary with the nature and severity of the disease or condition, and the route by which the antibody is administered.
- the frequency and dosage can also vary according to factors specific for each subject depending on the specific therapy (e.g., a therapeutic or prophylactic) administered, the severity of the disorder, disease, or condition, the route of administration, as well as age, body, weight, response, and the past medical history of the subject.
- Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
- Different therapeutically effective amounts may be applicable for different diseases and conditions, as will be readily known by those of ordinary skill in the art.
- amounts sufficient to prevent, manage, treat or ameliorate such disorders, but insufficient to cause, or sufficient to reduce, adverse effects associated with the antibodies or ADCs provided herein are also encompassed by the dosage amounts and dose frequency schedules provided herein.
- the dosage administered to the subject may be increased to improve the prophylactic or therapeutic effect of the composition or it may be decreased to reduce one or more side effects that a particular subject is experiencing.
- an antibody provided herein may optionally be administered with one or more additional agents useful to prevent or treat a disease or disorder.
- an antibody disclosed herein can be administered to a mammal, generally a human, in a pharmaceutically acceptable dosage form via one or more of the administrations approaches described herein.
- Any antibody described herein may be used to treat any disease or condition associated with CD161. It is contemplated that the agents described herein can be used in the treatment of cancer which may be achieved by administering to the subject an effective amount of an immunotherapy (e.g., an anti-CD161 antibody) disclosed herein.
- the agents described herein can be used to treat an autoimmune disorder, which may be achieved by administering to the subject an effective amount of an anti-CD161 antibody disclosed herein.
- the present disclosure provides a method of treating cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of an immunotherapy (e.g., an anti-CD161 antibody) disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- an immunotherapy e.g., an anti-CD161 antibody
- the present disclosure provides a method of treating cancer in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the cancer is characterized by expression of CLEC2D by cancer cells or other cells in the tumor microenvironment. In some embodiments, the cancer is characterized by an increased expression of CLEC2D by cancer cells or other cells in the tumor microenvironment.
- Any suitable cancer may be treated with the agents disclosed herein. Examples of cancers include solid tumors, soft tissue tumors, hematopoietic tumors and metastatic lesions.
- hematopoietic tumors include, leukemia, acute leukemia, acute lymphoblastic leukemia (ALL), B-cell, T cell or FAB ALL, acute myeloid leukemia (AML), chronic myelocytic leukemia (CML), chronic lymphocytic leukemia (CLL), e.g., transformed CLL, diffuse large B-cell lymphomas (DLBCL), follicular lymphoma, hairy cell leukemia, myelodysplastic syndrome (MDS), a lymphoma, Hodgkin’s disease, a malignant lymphoma, non-Hodgkin’s lymphoma, Burkitt’s lymphoma, multiple myeloma, or Richter’s Syndrome (Richter’s Transformation).
- ALL acute lymphoblastic leukemia
- B-cell T cell or FAB ALL
- AML acute myeloid leukemia
- CML chronic myelocytic leukemia
- CLL chronic lymphocytic le
- solid tumors include malignancies, e.g., sarcomas, adenocarcinomas, and carcinomas, of the various organ systems, such as those affecting head and neck (including pharynx), thyroid, lung (small cell or non-small cell lung cancer (NSCLC)), breast, lymphoid, gastrointestinal (e.g., oral, esophageal, stomach, liver, pancreas, small intestine, colon and rectum, anal canal), genitals and genitourinary tract (e.g., renal, urothelial, bladder, ovarian, uterine, cervical, endometrial, prostate, testicular), CNS (e.g., neural or glial cells, e.g., neuroblastoma or glioma), or skin (e.g., melanoma and metastatic Merkel cell carcinoma (MCC)).
- malignancies e.g., sarcomas, adenocarcinomas,
- the cancer is lymphoma.
- the cancer is head and neck squamous cell carcinoma (HNSCC).
- the cancer is non-small cell lung cancer (NSCLC).
- the cancer is hepatocellular carcinoma (HCC).
- the cancer is triple-negative breast cancer (TNBC).
- the cancer is melanoma.
- the cancer is glioblastoma.
- the cancer is colorectal cancer.
- the cancer is liver cancer.
- the cancer is cervical cancer.
- the cancer is prostate cancer.
- the cancer is renal cancer.
- the cancer is lung adenocarcinoma. In certain embodiments, the cancer is glioma. In certain some embodiments, the cancer is lung cancer. In certain embodiments, the cancer is bladder cancer. In certain embodiments, the cancer is colon adenocarcinoma. In certain embodiments, the cancer is kidney cancer. [00415] In certain embodiments, the cancers that can benefit from CD161 blockade immunotherapy are cancers with high density of CLEC2D + and CD161 + cells, as identified using immunofluorescence data. In certain embodiments, the cancer is a cancer with high density of CLEC2D + and CD161 + cells.
- the cancer is diffuse large B cell lymphoma (DLBCL), follicular lymphoma, Hodgkin’s lymphoma, and T cell lymphomas including peripheral T cell lymphoma-not otherwise specified (PTCL-NOS), NK/T cell lymphoma, anaplastic large cell lymphoma (ALCL).
- the cancer is a non-small cell lung cancer (NSCLC) e.g., NSCLC-squamous cell carcinoma or NSCLC- adenocarcinoma, head and neck squamous cell carcinoma (HNSCC), triple negative breast cancer (TNBC), or cutaneous squamous cell carcinoma.
- NSCLC non-small cell lung cancer
- HNSCC head and neck squamous cell carcinoma
- TNBC triple negative breast cancer
- the cancer is selected from the group consisting of: melanoma, lung, glioma, colorectal, and liver.
- the present disclosure provides a method for reducing or inhibiting tumor growth in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the present disclosure also provides a method for inhibiting or blocking the interaction between human CD161 and CLEC2D in a subject in need thereof, the method comprising administering to the subject an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the present disclosure also provides a method for inducing or enhancing immune cell activation in a subject in need thereof, the method comprising administering to the subject, an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the immune cell activation occurs in a tumor microenvironment.
- the immune cell is a T cell or a NK cell.
- the present disclosure provides a method for inducing or enhancing a cytotoxic T cell effector response in a subject in need thereof, the method comprising administering to the subject, an effective amount of the anti-CD161 antibody disclosed herein or an effective amount of the pharmaceutical composition disclosed herein.
- the T cell effector response (i) is in a tumor microenvironment, (ii) is cytokine production (such as IL-2, TNF ⁇ , IFN ⁇ , or a combination thereof), (iii) is secretion of granzyme B, or (iv) a combination of two or more of (i), (ii) and (iii).
- cytokine production such as IL-2, TNF ⁇ , IFN ⁇ , or a combination thereof
- iii) is secretion of granzyme B, or (iv) a combination of two or more of (i), (ii) and (iii).
- the present disclosure provides a method for reducing CD161 inhibitory signaling caused due to binding of CLEC2D to CD161.
- the present disclosure provides a method for reducing suppression of T cell activity caused due to CLEC2D binding to CD161.
- the present disclosure provides a method for reducing suppression of NK cell activity caused due to CLEC2D binding to CD161. In some embodiments, the present disclosure provides a method for increasing T cell activity in the presence of CLEC2D as compared to such T cell activity in the absence of the antibody or antigen-binding fragment thereof disclosed herein. In some embodiments, the present disclosure provides a method for increasing NK cell activity in the presence of CLEC2D as compared to such NK cell activity in the absence of the antibody or antigen-binding fragment thereof disclosed herein. In some embodiments, the present disclosure provides a method for increasing T cell activity disposed within a microenvironment comprising cells expressing CLEC2D.
- the present disclosure provides a method for increasing NK cell activity disposed within a microenvironment comprising cells expressing CLEC2D. In some embodiments, the present disclosure provides a method for increasing T cell activity in a tumor microenvironment comprising tumor cells that express CLEC2D. In some embodiments, the present disclosure provides a method for increasing NK cell activity in a tumor microenvironment comprising tumor cells that express CLEC2D. In some embodiments, the present disclosure provides a method for inhibiting human T cell exhaustion. In some embodiments, the present disclosure provides a method for inducing or increasing activation of a CD161-expressing human T cell in response to an antigen-expressing target cell.
- the present disclosure provides a method for inducing or increasing cytokine production by a CD161-expressing human T cell in response to an antigen-expressing target cell. In some embodiments, the present disclosure provides a method for inducing or increasing granzyme B expression by a CD161-expressing human T cell in response to an antigen- expressing target cell. In some embodiments, the present disclosure provides a method for reducing exhaustion of CD161-expressing human T cells in response to antigen-expressing target cells.
- provided herein is a method of delaying the onset of a cancer in a subject in need thereof by administering to a subject an effective amount of an immunotherapy (e.g., an immunotherapeutic agent) disclosed herein (e.g., an anti-CD161 antibody or an antigen binding fragment thereof or an antibody conjugate).
- an immunotherapy e.g., an immunotherapeutic agent
- provided herein is a method of preventing the onset of a cancer in a subject in need thereof by administering to the subject an effective amount of an agent disclosed herein.
- provided herein is a method of reducing the size of a tumor in a subject in need thereof by administering to the subject an effective amount of an agent disclosed herein.
- provided herein is a method of reducing the number of metastases in a subject in need thereof by administering to the subject an effective amount of an of an agent disclosed herein. In certain embodiments, provided herein is a method for extending the period of overall survival, median survival time, or progression-free survival in a subject in need thereof by administering to the subject of an agent disclosed herein. In certain embodiments, provided herein is a method for treating a subject who has become resistant to a standard of care therapeutic by administering to subject an effective amount of an of an agent disclosed herein. 13. Combination Therapies [00423] The methods and compositions described herein can be used alone or in combination with other therapeutic agents and/or modalities.
- the term administered “in combination,” as used herein, is understood to mean that two (or more) different treatments are delivered to the subject during the course of the subject’s affliction with the disorder, such that the effects of the treatments on the patient overlap at a point in time.
- the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as “simultaneous” or “concurrent delivery.”
- the delivery of one treatment ends before the delivery of the other treatment begins. In certain embodiments of either case, the treatment is more effective because of combined administration.
- the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment.
- delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other.
- the effect of the two treatments can be partially additive, wholly additive, or greater than additive.
- the delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered.
- a method or composition described herein is administered in combination with one or more additional therapies, e.g., surgery, radiation therapy, or administration of another therapeutic preparation.
- the additional therapy may include chemotherapy, e.g., a cytotoxic agent.
- the additional therapy may include a targeted therapy, e.g. a tyrosine kinase inhibitor, a proteasome inhibitor, or a protease inhibitor.
- the additional therapy may include an anti-inflammatory, anti-angiogenic, anti-fibrotic, or anti-proliferative compound, e.g., a steroid, a biologic immunomodulator, a monoclonal antibody, an antibody fragment, an aptamer, an siRNA, an antisense molecule, a fusion protein, a cytokine, a cytokine receptor, a bronchodilator, a statin, an anti-inflammatory agent (e.g. methotrexate), or an NSAID.
- the additional therapy may include a combination of therapeutics of different classes.
- a method or composition described herein is administered in combination with a second checkpoint inhibitor.
- the checkpoint inhibitor may, for example, be selected from a PD-1 antagonist, a second PD-L1 antagonist, CTLA-4 antagonist, adenosine A2A receptor antagonist, B7-H3 antagonist, B7-H4 antagonist, BTLA antagonist, KIR antagonist, LAG3 antagonist, TIM-3 antagonist, VISTA antagonist or TIGIT antagonist.
- the checkpoint inhibitor is a PD-1 or a second PD-L1 inhibitor.
- PD-1 is a receptor present on the surface of T cells that serves as an immune system checkpoint that inhibits or otherwise modulates T cell activity at the appropriate time to prevent an overactive immune response.
- Cancer cells can take advantage of this checkpoint by expressing ligands, for example, PD-L1, that interact with PD-1 on the surface of T cells to shut down or modulate T cell activity.
- ligands for example, PD-L1
- Exemplary PD-1/PD-L1 based immune checkpoint inhibitors include antibody based therapeutics.
- Exemplary treatment methods that employ PD- 1/PD-L1 based immune checkpoint inhibition are described in U.S. Patent Nos.8,728,474 and 9,073,994, and EP Patent No.1537878B1, and, for example, include the use of anti-PD-1 antibodies.
- Exemplary anti-PD-1 antibodies are described, for example, in U.S. Patent Nos.
- Exemplary anti-PD-1 antibodies include, for example, nivolumab (Opdivo®, Bristol-Myers Squibb Co.), pembrolizumab (Keytruda®, Merck Sharp & Dohme Corp.), PDR001 (Novartis Pharmaceuticals), and pidilizumab (CT-011, Cure Tech).
- Exemplary anti-PD-L1 antibodies are described, for example, in U.S.
- Exemplary anti-PD-L1 antibodies include, atezolizumab (Tecentriq®, Genentech), durvalumab (AstraZeneca), MEDI4736, avelumab, and BMS 936559 (Bristol Myers Squibb Co.).
- a method or composition described herein is administered in combination with a CTLA-4 inhibitor.
- CTLA-4 In the CTLA-4 pathway, the interaction of CTLA-4 on a T cell with its ligands (e.g., CD80, also known as B7-1, and CD86) on the surface of an antigen presenting cells (rather than cancer cells) leads to T cell inhibition.
- ligands e.g., CD80, also known as B7-1, and CD86
- Exemplary CTLA-4 based immune checkpoint inhibition methods are described in U.S. Patent Nos.5,811,097, 5,855,887, 6,051,227.
- Exemplary anti-CTLA-4 antibodies are described in U.S.
- CTLA-4 antibodies include ipilimumab or tremelimumab.
- a method or composition described herein is administered in combination with a CTLA-4 inhibitor, e.g., a CTLA-4 inhibitor disclosed herein.
- a method or composition described herein is administered in combination with an IDO inhibitor.
- IDO inhibitors include 1-methyl-D-tryptophan (known as indoximod), epacadostat (INCB24360), navoximod (GDC-0919), and BMS-986205.
- cytotoxic agents that can be administered in combination with a method or composition described herein include, for example, antimicrotubule agents, topoisomerase inhibitors, antimetabolites, protein synthesis and degradation inhibitors, mitotic inhibitors, alkylating agents, platinating agents, inhibitors of nucleic acid synthesis, histone deacetylase inhibitors (HDAC inhibitors, e.g., vorinostat (SAHA, MK0683), entinostat (MS-275), panobinostat (LBH589), trichostatin A (TSA), mocetinostat (MGCD0103), belinostat (PXD101), romidepsin (FK228, depsipeptide)), DNA methyltransferase inhibitors, nitrogen mustards, nitrosoureas, ethylenimines, alkyl sulfonates, triazenes, folate analogs, nucleoside analogs, ribonucleotide
- the cytotoxic agent that can be administered with a method or composition described herein is a platinum-based agent (such as cisplatin), cyclophosphamide, dacarbazine, methotrexate, fluorouracil, gemcitabine, capecitabine, hydroxyurea, topotecan, irinotecan, azacytidine, vorinostat, ixabepilone, bortezomib, taxanes (e.g., paclitaxel or docetaxel), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, vinorelbine, colchicin, anthracyclines (e.g., doxorubicin or epirubicin) daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithra
- the invention also provides a method of increasing the expression of HLA-DR, CD86, CD83, IFN ⁇ , IL-1b, IL-6, TNF ⁇ , IL-17A, IL-2, or IL-6 in a cell, tissue, or subject.
- the method comprises contacting the cell, tissue, or subject with an effective amount of an antibody, fusion protein, and/or antibody conjugate, e.g., an antibody, fusion protein, or antibody conjugate disclosed herein.
- the cell is selected from a dendritic cell and a peripheral blood mononuclear cell (PBMC).
- PBMC peripheral blood mononuclear cell
- expression of HLA-DR, CD86, CD83, IFN ⁇ , IL-1b, IL-6, TNF ⁇ , IL-17A, IL-2, or IL-6 in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with the antibody, fusion protein, or antibody conjugate.
- the invention also provides a method of promoting infiltration of immune cells into a tumor in a subject in need thereof.
- the method comprises administering to the subject an effective amount of an antibody disclosed herein.
- the immune cells are T cells, e.g., CD4 + and/or CD8 + T cells, e.g., CD69 + CD8 + and/or GzmB + CD8 + T cells.
- the immune cells are natural killer (NK) cells.
- the infiltration of immune cells into the tumor in the subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical tumor and/or subject that has not received the agent.
- Infiltration of immune cells into a tumor may be measured by any suitable method known in the art, for example, antibody staining.
- the invention also provides a method of increasing expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcd1, Lag3, Il6, Il1b, Il2, Ifng, Ifna1, Mx1, Gzmb, Cxcl9, Cxcl12, and/or Ccl5 in a cell, tissue, or subject.
- the method comprises contacting the cell, tissue, or subject with an effective amount of an antibody disclosed herein, so as to increase the expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcd1, Lag3, Il6, Il1b, Il2, Ifng, Ifna1, Mx1, Gzmb, Cxcl9, Cxcl12, and/or Ccl5 relative to the cell, tissue or subject prior to contact with such an agent.
- expression of Cd3, Cd4, Cd8, Cd274, Ctla4, Icos, Pdcd1, Lag3, Il6, Il1b, Il2, Ifng, Ifna1, Mx1, Gzmb, Cxcl9, Cxcl12, and/or Ccl5 in the cell, tissue, or subject is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell, tissue, or subject that has not been contacted with such an agent.
- Gene expression may be measured by any suitable method known in the art, for example, by ELISA, Luminex multiplex assays, or Nanostring technology.
- the cell effected by the treatment is tumor cell, dendritic cell (DC) or monocyte.
- the cell is a monocyte, and the method results in increased expression of an MHC-II molecule (e.g., HLA-DR) on the monocyte.
- an MHC-II molecule e.g., HLA-DR
- expression of an MHC-II molecule in the cell or tissue is increased by at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 100%, at least about 150%, at least about 200%, at least about 250%, at least about 300%, at least about 400%, at least about 500%, at least about 600%, at least about 700%, at least about 800%, at least about 900%, or at least about 1,000%, relative to a similar or otherwise identical cell or tissue that has not been contacted with such an agent.
- Gene expression may be measured by any suitable method known in the art, for example, by ELISA, by Luminex multiplex assays, or by flow cytometry. 14.
- the method can be used to detect CD161 in a subject having or suspected of having a disease or condition.
- the methods comprise (a) receiving a sample from the subject; and (b) detecting the presence or the level of CD161 in the sample by contacting the sample with an antibody disclosed herein.
- the disease or condition is a cancer.
- the antibody provided herein can be labeled with a detectable label, for example, a fluorescent label, radiolabel, or enzyme label.
- Example 1 – Generation of CD161 Antibodies This example describes the generation of CD161 antibodies by Adimab TM yeast- based antibody presentation using the biotinylated recombinant CD161 proteins as screening antigens, as described below.
- Recombinant Protein Production [00442] Several recombinant proteins were produced to support antibody discovery and subsequent screening and characterization, comprising different forms of the extracellular domains (ECDs) of human and cynomolgus CD161 target and CLEC2D ligand. All proteins were produced by transient transfection of HEK293 cells (ThermoFisher Scientific).
- Proteins were produced with either a C-terminal or an N-terminal human IgG1 Fc fusion domain to create a bivalent antigen.
- These proteins include: [00443] (1) hCD161 ECD (Q67-S225)-hFc or hKLRB1 ECD (Q67-S225)-hFc- a human CD161 ECD (amino acid residues Q67-S225, Uniprot # Q12918) with a C-terminal human IgG1 Fc domain; represented by SEQ ID NO: 173; [00444] (2) cCD161 ECD (Q67-L227)-hFc or cKLRB1 ECD (Q67-L227)-hFc- a cynomolgus CD161 ECD (amino acid residues Q67-L227, Uniprot # A0A2K5WYI1) with a C- terminal human IgG1 Fc domain; represented by SEQ ID NO:
- the mutation H176C introduced an additional disulfide bridge to increase the stability and homogeneity of the expressed protein.
- the following monovalent ECD proteins were produced: [00449] (1) hCD161 ECD (Q67-S225)-6xHis- a human CD161 ECD (amino acid residues Q67-S225, Uniprot # Q12918) with a C-terminal 6xHis tag (SEQ ID NO: 197); represented by SEQ ID NO: 174; [00450] (2) hFc-cyCD161 ECD (K68-C74A-S225) monomer- a cyno CD161 ECD comprising a C74A mutation (amino acid residues K68-C74A-S225) with an N-terminal Fc heterodimer fusion partner.
- This construct was created by co-transfecting HEK293 cells with two chains, one which consisted an N-terminal FLAG tag followed by the human IgG1 Fc (represented by SEQ ID NO: 178) and the other chain contained N-terminal human IgG1 Fc followed by cyno CD161 ECD (represented by SEQ ID NO: 177); and [00451] (3) cCD161-IHM or cKLRB1-IHM- This is an antigen format in which monomeric cyno KLRB1 Fc fusion protein was expressed as a murine IgG1 fusion by pairing FLAG-murine IgG1 Fc with cyno KLRB1 IgG1 Fc.
- Antigens (hKLRB1 ECD (Q67-S225)-hFc; cKLRB1 ECD (Q67-L227)-hFc; hFc- hKLRB1 ECD (Q67-S225); hLLT1 ECD (L71-V191)-hFc; cKLRB1-IHM; and hFc-hLLT1 ECD(L71-H176C-V191) were biotinylated using the EZ-Link Sulfo-NHS-Biotinylation Kit (Thermo Scientific, Cat #21425).
- yeast cells ( ⁇ 10 10 cells/library) were incubated with biotinylated dimeric human CD161-Fc for 30 min at 24 °C in wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)). After washing once with 40 mL ice-cold wash buffer, the cell pellet was resuspended in 20 mL wash buffer, and Streptavidin MicroBeads (500 ⁇ L) were added to the yeast and incubated for 15 min at 4 °C. Next the yeast were pelleted, resuspended in 5 mL wash buffer, and loaded onto a Miltenyi LS column.
- wash buffer phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)
- PBS phosphate-buffered saline
- BSA bovine serum albumin
- Yeast were pelleted, washed three times with wash buffer, and incubated at 24 °C with decreasing concentrations of biotinylated dimeric human CD161 (10 nM), monomeric human CD161 (500nM to 4 nM) under equilibrium conditions, biotinylated dimeric cyno CD161 (5 nM), monomeric cyno CD161 (500 nM to 4 nM—in order to obtain species cross-reactivity), biotinylated dimeric human CLEC2DH176C (10 nM—to counter-select against this highly structurally similar CD161 ligand to obtain CD161-specificity), or with a polyspecificity reagent (PSR) to remove non-specific antibodies from the selection.
- biotinylated dimeric human CD161 (10 nM
- monomeric human CD161 500nM to 4 nM
- biotinylated dimeric cyno CD161 5 nM
- the libraries were incubated with a 1:10 dilution of biotinylated PSR reagent as previously described (see, e.g., Xu et al. (2013) PROTEIN ENG. DES.
- Yeast were then washed twice with wash buffer and stained with goat F(ab’) 2 anti-human kappa-FITC (LC-FITC) diluted 1:100 (Southern Biotech, Cat # 2062-02) and either Streptavidin-AF633 (SA-633) diluted 1:500 (Life Technologies, Cat # S21375) or Extravidin-phycoerthyrin (EA-PE) diluted 1:50 (Sigma-Aldrich, Cat # E4011), secondary reagents for 15 min at 4 °C.
- LC-FITC goat F(ab’) 2 anti-human kappa-FITC
- SA-633 Streptavidin-AF633
- EA-PE Extravidin-phycoerthyrin
- the libraries were evaluated for, e.g., PSR binding, species cross-reactivity, and affinity pressure by antigen titration, and epitopic coverage using high affinity antibodies with diverse bins identified during the na ⁇ ve selection. Sorting was performed to obtain populations with the desired characteristics. Individual colonies from each terminal FACS selection round were picked for sequencing and characterization. Affinity Maturation [00459] Optimization of parent clones was carried out utilizing three maturation strategies: light chain diversification; diversification of CDRH1 and CDRH2; and diversification of CDRH3, CDRL1, CDRL2, and CDRL3.
- Light Chain Diversification The heavy chain from clones selected from the na ⁇ ve selection procedure were transformed into a light chain library with a diversity of 1 x 10 6 . Selections were performed as described above with one round of MACS sorting and four rounds of FACS sorting using biotinylated dimeric or monomeric cyno CD161 antigen for respective rounds. [00461] CDRH1 and CDRH2 Selection: The CDRH3s from clones selected from the light chain diversification procedure were recombined into a premade library with CDRH1 and CDRH2 variants of a diversity of 1 x 10 8 and selections were performed using monomeric human and cyno CD161 antigens.
- Affinity pressures were applied by using decreasing concentrations of biotinylated monomeric CD161 antigen (50 nM to 1 nM) under equilibrium conditions at room temperature and by preincubating the biotinylated antigen with parental Fab for 30 minutes and then applying that precomplexed mixture to the yeast library for lengths of time which would either allow the selection mixture to reach an equilibrium or favor increased associate rates. The higher affinity antibodies were then able to be sorted. [00462] CDRH3, CDRL1, CDRL2, and CDRL3 selection: Oligonucleotides were purchased from IDT which encoded the CDRH3 and the CDRL3 as well as a flanking region on either side of the CDR3.
- the CDRH3 oligonucleotides were recombined with heavy chain FR1-FR3 variable regions containing selected variants from the CDRH1 and CDRH2 selections, and the CDRL3 was recombined into a premade library with CDRL1 and CDRL2 variants, for a combined library diversity of ⁇ 10 8 .
- Selections were performed similar to previous cycles using FACS sorting for four rounds. For each FACS round, the libraries were interrogated for PSR binding and affinity pressure, and sorting was performed in order to obtain populations with the desired characteristics.
- IgG and Fab Production and Purification [00463] In order to produce sufficient amounts of selected antibodies (antibody variable domain sequences shown in TABLE 6) for further characterization, the yeast clones were grown to saturation and then induced for 48 hours at 30 °C with shaking. After induction, yeast cells were pelleted and the supernatants were harvested for purification. IgGs were purified using a Protein A column and eluted with acetic acid, pH 2.0. Fab fragments were generated by papain digestion and purified over KappaSelect (GE Healthcare LifeSciences).
- Example 2 Binding Affinities of CD161 Antibodies
- This example describes the kinetics and affinity of various CD161 antibodies created in Example 1.
- ForteBio affinity measurements were performed on an Octet HTX generally as previously described (see, e.g., Estep et al. (2013) MABS, 5(2): 270-8). Briefly, ForteBio affinity measurements were performed by loading IgGs on-line onto AHC sensors. Sensors were equilibrated off-line in assay buffer for 30 min and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded IgGs were exposed to 100 nM antigen for 3 minutes, and afterwards were transferred to assay buffer for 3–10 min for off-rate measurement.
- Avidity (Avid) and monovalent affinity assessment, were performed using dimeric or monovalent antigens, respectively. During optimization, monovalent affinity was also assessed using Fabs.
- Fabs monovalent affinity was also assessed using Fabs.
- the unbiotinylated Fc fusion antigen was loaded on-line onto the AHC sensors. Sensors were equilibrated off-line in assay buffer for 30 min and then monitored on-line for 60 seconds for baseline establishment. Sensors with loaded antigen were exposed to 100 nM Fab for 3 minutes, and afterwards they were transferred to assay buffer for 10 min for off-rate measurement. Kinetic data was analyzed and fitted using the 1:1 binding model and the K D was calculated by dividing the k off by the k on .
- HEK293 cells were engineered to overexpress human (h) or cynomolgus monkey (c) CD161 (amino acid sequence in TABLE 8) by lipid-based transfection, random integration into the genome and antibiotic selection.
- hCD161-HEK293, cCD161-HEK293, and Null- HEK293 cells were washed in phosphate-buffered saline with 0.1% bovine serum albumin (PBSA) and seeded in a 96 well plate at a density of 1 x 10 4 cells per well.
- PBSA bovine serum albumin
- Washed cells were resuspended in antibody titrations diluted in PBSA and incubated at 4 o C for 4 hours.
- Cells were washed in PBSA, resuspended in Alexa Fluor® 647 anti-human IgG (Jackson ImmunoResearch, catalog #109-605-190) diluted 1:1000 in PBSA and incubated at 4 o C for 30 minutes.
- Cells were washed in PBS, resuspended in PBS with 2% formaldehyde, incubated at room temperature for 20 minutes and analyzed by flow cytometry with a BD Symphony flow cytometer.
- Data were analyzed using FlowJo software. MFI at each concentration was calculated and exported into Graphpad Prism.
- FIGs.1A-1D are graphs showing binding of human anti-CD161 antibodies to HEK 293 cells exogenously expressing human CD161. Iso Ctrl denotes isotype control antibody.
- FIGs.2A-2D are graphs showing binding of human anti-CD161 antibodies to HEK 293 cells exogenously expressing cynomolgus CD161. Iso Ctrl denotes isotype control antibody.
- the human anti-CD161 antibodies bind to hCD161-HEK293 and cCD161-HEK293 in a dose dependent manner and have EC50 values measuring between approximately 0.1-0.5 nM. No binding was observed to untransfected (null) cells, indicating the binding was specific to CD161.
- Example 4 On-cell Homolog Binding (FACS KLRF1, KLRF2, CLEC12B, CLEC2D) [00474]
- This example describes the binding of anti-CD161 antibodies to HEK 293 cells exogenously expressing CD161 homologs as a measure of antibody specificity for CD161.
- Homologous proteins of interest in this assay were based on sequence similarity; an alignment of proteins of interest is shown in FIG.3. Specificity was also tested against CLEC2D; an alignment of CD161 and CLEC2D is shown in FIG.4.
- HEK293 cells were engineered to overexpress KLRF1, KLRF2, CLEC12B, or CLEC2D (CD161 homolog sequences in TABLE 10) by lipid-based transfection, transposon mediated integration and antibiotic selection. Stable integration of the construct was validated by qPCR. TABLE 10 [00476] CD161 antibodies were screened for binding against each cell line mentioned above at a single saturating concentration, as detailed below. [00477] For the antibody binding assay, all cell lines were washed in phosphate-buffered saline with 0.1% bovine serum albumin (PBSA) and seeded in a 96 well plate at a density of 4 x 10 4 cells per well.
- PBSA bovine serum albumin
- Washed cells were resuspended in 100 nM of antibody (a saturating concentration to measure maximum binding on cells) and incubated at room temperature for 30 mintues.
- Cells were washed in PBSA, resuspended in Alexa Fluor® 647 anti-human IgG (Jackson ImmunoResearch, catalog #109-605-190) diluted 1:1000 in PBSA and incubated at 4 o C for 30 minutes. Cells were analyzed by flow cytometry with a Thermo Fisher Attune flow cytometer.
- FIGs.5A-5B are graphs showing binding of human anti-CD161 antibodies to HEK 293 cells exogenously expressing CD161 or CD161 homologs (CLEC2D, KLRF1, KLRF2, and CLEC12B). Iso Ctrl denotes isotype control antibody. Null represents control HEK 293 cells. [00479] Data were analyzed using FlowJo software. MFI for each sample was calculated and exported into Graphpad Prism. As shown in FIGs.5A-5B, and TABLE 11, no significant binding was observed to any HEK293 cell lines expressing a CD161 homolog.
- HEK293-hCD161 cells were washed in phosphate-buffered saline with 0.1% bovine serum albumin (PBSA) and seeded in a 96 well plate at a density of 1 x 10 4 cells per well.
- Antibody titrations were diluted in PBSA, biotinylated Fc-H176C CLEC2D was added to each titration of antibody to a final concentration of 100 nM and the antibody/CLEC2D solution was incubated with HEK293- hCD161 cells at 4 o C for 4 hours.
- FIGs.6A-6D are graphs illustrating human anti-CD161 antibody-mediated blocking of interaction between CD161 and CLEC2D, using HEK293 cells overexpressing the human CD161 protein and soluble, biotinylated Fc-human CLEC2D (H176C) protein. Iso Ctrl denotes isotype control antibody.
- Antibody mediated blocking of human Fc-H176C CLEC2D binding to hCD161- HEK293 cells is shown in TABLE 12.
- TABLE 12 [00486] In the absence of antibody, the interaction between hCD161 on the HEK293 cells and biotinylated H176C Fc-CLEC2D was detected by the Streptavidin, Alexa FluorTM 647 conjugate. As shown in TABLE 12 and in FIGs.6A-6D, the presence of anti-CD161 antibody inhibited the interaction between soluble biotinylated Fc-H176C CLEC2D and hCD161-HEK cell in a dose dependent manner. All IC50 values are between 0.3 and 1.7 nM.
- Example 6 CD161-Antibodies Activate NK cells in Co-culture Assay with Exogenous CLEC2D Expression
- This example describes the ability of anti-CD161 antibodies to block inhibitory signaling on human NK cells mediated by target cells overexpressing ligand CLEC2D.
- NK cells CD3- CD56 +
- Isolated NK cells were cultured in media containing 100 ng/mL IL-2 for activation.
- IL-2-activated NK cells were used 24 hours after activation.
- K562 human cancer cells were engineered to overexpress human CLEC2D by transposon engineering. Cells were cultured in IMDM (Iscove’s Modified Dulbecco’s Medium) with selection antibiotics prior to assay setup. [00490] K562 human cancer cells expressing human CLEC2D were harvested and resuspended in culture media at 2 x 10 6 cells/mL. Human anti-CD161 antibodies and mouse anti-human CD161 antibody (HP-3G10) were diluted in culture media. Activated NK cells were harvested, washed, and resuspended at 2 x 10 6 cells/mL in culture media.
- FIGs.7A-7D are graphs illustrating anti-CD161 antibody-mediated activation of human NK cells as measured by CD107a expression in a dose-dependent manner. Iso Ctrl denotes isotype control antibody. [00492] As shown in FIGs.7A-7D, human anti-CD161 antibodies increased NK cell activation as measured by CD107a expression in a dose-dependent manner relative to NK cell activation achieved using mouse anti-human CD161 antibody, while isotype controls had no effect on NK cell function.
- Example 7 Antibody Activation of T cells in Co-culture Assay with Exogenous CLEC2D Expression
- This example describes the ability of anti-CD161 antibodies to block inhibitory signaling on Jurkat T cells mediated by target cells overexpressing ligand.
- Jurkat T cells with an NFAT-Luciferase reporter gene (InvivoGen) were engineered to overexpress both an NY-ESO-1-specific TCR and human CD161 by lentiviral transduction. Cells were cultured in IMDM media with selection antibiotics prior to assay setup.
- K562 human cancer cells were engineered to overexpress MHC-I (HLA-A0201) by lentiviral transduction and human CLEC2D by transposon engineering. Cells were cultured in IMDM media with selection antibiotics prior to assay setup. [00496] On Day 0, engineered K562 cells were seeded at density of 5 x 10 5 cells/mL in media containing 10 ⁇ g/mL NY-ESO-1 peptide antigen, SLLMWITQV (SEQ ID NO: 192) and incubated at 37 °C, 5% CO2 overnight.
- FIGs.8A-8D are graphs illustrating nuclear factor of activated T cells (NFAT) signaling anti-CD161 antibody-mediated activation of T cells in a co-culture assay with exogenous CLEC2D expression as measured by NFAT signaling. Isotype control antibody was used as a control. [00500] In the absence of antibody, the interaction between CD161 on the Jurkat cells and CLEC2D on the K562 cells inhibits NFAT signaling.
- NFAT nuclear factor of activated T cells
- Jurkat T cells with an NFAT-Luciferase reporter gene (InvivoGen) were engineered to overexpress both an NY-ESO-1-specific TCR and human CD161 by lentiviral transduction. Cells were cultured in IMDM media with selection antibiotics prior to assay setup.
- the NALM6 cells were seeded at a density of 5 x 10 5 cells/mL in media containing 1 ⁇ g/mL NY-ESO-1 peptide antigen (SEQ ID NO: 192) and incubated overnight.
- the Jurkat effector cells and the peptide-loaded NALM6 target cells were plated at a ratio of 1:4 in 96-well plates.
- Anti-CD161 antibodies were pre-diluted in assay media and added to the co-culture at a 1:1 volume ratio. Plates were incubated overnight at 37 °C, 5% CO2.
- FIG.9 is a graph showing restoration of NFAT signaling in a dose-dependent manner.
- Example 9 Developability of anti-CD161 Antibodies
- This example assesses manufacturing feasibility, formulatability for a specific administration route, and compatibility with in vivo environment, such as immunogenicity, off- target effect, and half-life of the anti-CD161 antibodies.
- Polyspecificity ELISA [00510] This method was used to establish antibody binding to microtiter plate-immobilized polyspecificity targets (dsDNA, Insulin, baculovirus particles (BVP), HSP70).
- Antibody binding to these targets has correlated with rapid antibody clearance in vivo (Avery el al. (2016) MABS, 10(2): 244-255; Jain et al. (2017) PROC. NATL. ACAD. SCI. USA, 114(5): 944-949; Kelly et al. (2017) MABS, 9(7): 1036-1040).
- the assay was performed using three control antibodies on each ELISA plate. The controls were selected based on their low (AdalimumAb, Lapadula et al. (2014) INT. J. IMMUNOPATHOL.
- a typical ELISA was performed by coating, overnight at 4 ° C, test wells of a high binding half-well plate (Corning, cat#3690) with 3 ⁇ g/mL/25 ⁇ l per well of a polyspecificity reagent (dsDNA (Millipore, cat# 11691112001), human insulin (MP Biomedicals, cat# 193900), BVP (LakePharma, cat#25690), human HSP70 (R&D Systems, cat#AP-100)) in PBS, pH 7.4. Background control wells on the plate were left uncoated.
- dsDNA Micropore, cat# 11691112001
- human insulin MP Biomedicals, cat# 193900
- BVP LongkePharma, cat#25690
- human HSP70 R&D Systems, cat#AP-100
- Antibody that was bound to plate-immobilized target was determined using HRP substrate (3,3’,5,5’-tetramethylbenzidine (TMB; SeraCare, cat# 5120-0077) with absorbance at 450 nm. For each antibody, duplicate values were averaged, and average assay background subtracted. [00512] TABLE 15 shows that all 20 anti-CD161 antibodies (11 antibodies generated from parental monoclonal antibody from first family (F1) and 9 antibodies generated from parental monoclonal antibody for second family (F2)) had low binding to the plate-immobilized polyspecificity targets.
- Test antibody binding was 0.92-fold to 2.8-fold that of the control low polyreactive antibody AdalimumAb, and 1.0-fold to 2.14-fold for insulin, 0.46-fold to 1.92-fold for BVP and 0.64-fold to 4.07-fold for HSP70.
- the highly polyreactive control antibody, Briakinumab bound much tighter to the plate-immobilized targets than AdalimumAb with binding ⁇ 5-fold greater against dsDNA, ⁇ 17-fold against insulin, ⁇ 8-fold with BVP, and ⁇ 10-fold more against HSP70.
- Retention time was measured and compared to the developability flags: a retention time of under 10.5 min was considered to be of no concern; between 10.5-11.5 min was of low concern; and >11.5 min was of high concern.
- the retention times for the IgGs are listed in TABLE 16. [00515] As shown in TABLE 16, retention time for all tested antibody candidates was under 10.5 mins. TABLE 16
- Example 10 Profiling of Anti-CD161 Antibodies Binding to Human and Cynomolgus PBMCs
- This example characterizes the binding of anti-CD161 antibodies to primary immune cells from human or cynomolgus monkey in order to assess the affinity and specificity of the antibodies to cells with endogenous target expression. Binding to human and cynomolgus monkey NK cells in a PBMC population.
- the ability of the anti-CD161 antibodies to bind to NK cells, which are known to express CD161, in a human and cynomolgus monkey PBMC population was measured.
- Human PBMCs (Hemacare, catalog # 20062234) were washed in PBSA and seeded in a 96 well plate at a density of 2 x 10 5 cells per well then incubated with Live/Dead Aqua stain (Thermo Fisher, catalog # L34957) diluted 1:1000 in PBS at room temperature for 20 minutes. Cells were washed in PBSA, then resuspended in Fc block diluted 1:200 in PBSA at 4 °C for 20 minutes.
- Live/Dead Aqua stain Thermo Fisher, catalog # L34957
- Cells were washed in PBSA, then resuspended in an antibody cocktail containing APC conjugated antibody titrations, anti-human CD3 Alexa Fluor® 700 (Biolegend, catalog #300424), anti-human CD56 BB700 (BD, catalog #566573), anti-human CD16 V450 (BD, catalog #644489) diluted in PBSA and incubated at 4 °C for 2 hours. Cells were washed in PBSA and analyzed by flow cytometry with a BD Symphony flow cytometer.
- Cynomolgus PBMCs (Worldwide Primates, catalog # bc347H) were washed in PBSA and seeded in a 96 well plate at a density of 2 x 10 5 cells per well then incubated with Live/Dead Aqua stain (Thermo Fisher, catalog # L34957) diluted 1:1000 in PBS at room temperature for 20 minutes. Cells were washed in PBSA, then resuspended in Fc block diluted 1:200 in PBSA at 4 °C for 20 minutes.
- NK cells were washed in PBSA, then resuspended in an antibody cocktail containing APC conjugated antibody titrations, anti-human CD3 APC-CyTM7 (Biolegend, catalog # 557757), anti-human NKp80 PE (Biolegend, catalog # 346706), anti- human CD16 V450 (BD, catalog # 644489) diluted in PBSA and incubated at 4 °C for 2 hours. Cells were washed in PBSA and analyzed by flow cytometry with a BD Symphony flow cytometer. [00520] Data were analyzed using FlowJo software. Human NK cells were identified by CD3 negative/ CD16 positive/ CD56 positive markers.
- FIGs.10A-10B are graphs showing binding of anti-CD161 antibodies to human PBMCs (FIG.10A) and cynomolgus PBMCs (FIG.10B).
- Anti-CD161 binding to hPBMCs and cPBMCs is shown in TABLE 17.
- MAIT mucosa-associated invariant T
- Human PBMCs Hemacare, catalog # 20062234
- FIG.11 is a bar graph showing binding of anti-CD161 antibodies to immune cell populations in human PBMCs (MAIT T cells, B cells, monocytes, dendritic cells.
- Example 12 An N297A Amino Acid Substitution in the Fc Region of Ab9 Reduced Binding to Fc ⁇ RII and Eliminated Binding to Fc ⁇ RI and Fc ⁇ RIII
- This example tested the binding affinity of Ab9, a monoclonal, aglycosylated human IgG1 antibody directed against CD161, to Fc ⁇ Rs and FcRn, when compared to the wild type human IgG1 antibody (“WT”).
- WT wild type human IgG1 antibody
- the Fc portion of IgG antibodies has various regions associated with specific immune functions when engaged with the Fc receptors found on immune cells.
- Fc ⁇ R Three distinct Fc receptors for IgG (Fc ⁇ R), Fc ⁇ RI, Fc ⁇ RII, and Fc ⁇ RIII are known to be associated with human myeloid cells, including monocytes, lymphocytes, polymorphonuclear cells (PMNs). Engagement of the Fc portion of the IgG with one of these Fc ⁇ R can lead to cytolysis of a cell that expresses the antigen specific to the Fab portion of the IgG.
- Ab9 a human IgG1, blocks the binding of CD161 to its ligand, CLEC2D.
- Ab9 was engineered with an alanine (A) to asparagine (N) substitution (N297A) in the Fc region, in order to abrogate binding to Fc ⁇ receptors, and eliminate any undesirable cytolysis.
- A alanine
- N asparagine
- the experiments described in this example demonstrate that the engineered amino acid switch of alanine-to-asparagine is effective in either eliminating or significantly reducing the binding of Ab9 to the Fc ⁇ receptors RI, RIIA, RIIB/C, RIIIA, and RIIIB.
- the mutation did not significantly alter binding to FcRn, which binds to IgG1’s in a different location from the Fc ⁇ Rs.
- Fc ⁇ Receptor Binding by ELISA The binding of antibody Ab9 to Briefly, streptavidin coated clear 96-well plate with blocking buffer was washed three times with wash buffer. 100 ⁇ L/well of biotinylated Fc ⁇ R at 0.25 ⁇ g/mL in PBSA was added to the plate according to plate map. The plate was incubated for 1 hour at room temperature. During incubation, Ab9 and WT, were preincubated with a mouse antibody to Kappa light chain (Abcam anti-kappa) at a 2:1 ratio for 1 hour at room temperature.
- the plate was then washed three times with wash buffer.
- 100 ⁇ L/well of 3-fold, 7 point, titrated IgG complex or IgG alone in PBSA was added according to the plate map (top concentration of 25,000 ng/mL for IgG complex, top concentration of 500 ng/mL for IgG alone).
- the plate was incubated for 2 hours at room temperature and then washed three times with wash buffer.
- 100 uL/well of HRP conjugated Fab-anti-human Fab fragment specific, diluted 1:5000 in PBSA was added to the plate followed by incubation for 1 hour at room temperature.
- the plate was then washed three times with wash buffer followed by addition of HRP substrate (TMB (TMB or equivalent, i.e.
- FIGs.14A-14B illustrate ELISA assay format, which shows soluble receptor binding to Fc ⁇ RI (FIG.14A) and Fc ⁇ RII and Fc ⁇ RIII (FIG.14B).
- FIGs.15A-15E are ELISA binding curves illustrating binding kinetics of Ab9 to Fc ⁇ receptors, Fc ⁇ RI (FIG.15A), Fc ⁇ RIIA (FIG.15B), Fc ⁇ RIIB/C (FIG.15C), Fc ⁇ RIIIA (FIG. 15D), and Fc ⁇ RIIIB (FIG.15E).
- the alanine (A) to asparagine (N) substitution (N297A) in the Fc region of Ab9 reduced binding to Fc ⁇ RII and eliminated binding to Fc ⁇ RI and Fc ⁇ RIII compared to wild-type human IgG1.
- Fc ⁇ RIIA (R167) and Fc ⁇ RIIA (H167) represent two allelic variants of Fc ⁇ RIIA that differ in their ability to ligate human IgG2.
- Fc ⁇ RIIIa alleles F176 and V176, which differ in one amino acid at position 176 in the extracellular domain and differ in their ability to bind human IgG1 and IgG3; F176 is the low-binding allele, V176 is high binding.
- TABLE 21 EC50 values as determined by ELISA. Abbreviations used in the table: n.b.- no binding.
- Fc ⁇ Receptor Binding by Octet [00538] The binding kinetics of Ab9 to Fc ⁇ receptors was also assessed via biolayer interferometry on an Octet system (FortéBio).
- FIG.16A illustrate the FcRn binding method by Octet.
- NK cells were isolated from human PBMCs (RTD165 and PBMC-030 (MCB-117)) and stimulated with IL-2 overnight using NK isolation kit.
- An eight-color flow cytometry antibody panel was designed to study the isolated CD56 + NK cells (effectors) for phenotype and function within the assay.
- the IL-2 stimulated NK cells (effector cells) were added to wells of a microtiter plate per predefined plate maps.
- Test articles (Ab9 or isotype control (D1.3_hIgG1_N297A was used as a negative control)) were added to the effector cells starting at 300 nM to 0.018 nM as a 4-fold dilution and incubated for 30 minutes on ice.
- Target cells were incubated with Cell Trace Violet (CTV) for 20 minutes at room temperature protected from light.
- CTV Cell Trace Violet
- the target cells were incubated for 5 minutes with HI-FBS and then centrifuged.
- the appropriate target cell control (K562 -GFP cells) or CLEC2D + (K562- CLEC2D)
- Phenotyping antibodies (CD3-APC-Cy7, LIVE/DEAD TM Fixable Near-IR, TCR ⁇ ⁇ -APC- Vio770, CD19-APC-Cy7, CD56-BB700, CD107a-PE, IFN ⁇ -FITC) were added and incubated briefly before cells were washed and resuspended in Fix/Perm buffer for 20 minutes. Cells were washed again and left in FACS Buffer overnight. The following day, cells were centrifuged and washed. This was followed by intracellular staining with anti-IFN ⁇ antibody. Cells were centrifuged and resuspended FACS buffer prior to being analyzed on the Symphony Cell Analyzer (BD Biosciences).
- % CD107 + cells and % IFN- ⁇ cells were measured.
- FIGs.17A-17H expression of both CD107a and IFN- ⁇ increased when NK cells were pre-incubated with the anti-CD161 antibody (Ab9) prior to co-culture with K562 cells overexpressing CLEC2D.
- Ab9 antibody There was no effect of Ab9 antibody on CD107a expression in NK cells when CLEC2D was not present on the target K562 cells (FIGs.17B and 17F).
- no effect was seen in the presence of an isotype control antibody.
- PBMCs from donor RTD165 responded in a dose dependent manner in the degranulation (FIG.17A) and IFN ⁇ assays (FIG.17C).
- Example 14 Human NK Cells Display Higher Cytotoxicity of CLEC2D Expressing Target Cells in Presence of An Anti-CD161 Antibody
- This example assesses the ability of an anti-CD161 antibody (Ab9) to enhance NK cell killing of CLEC2D expressing target cells by blocking the interaction of CD161 on NK cells with CLEC2D on target cells.
- the interaction of CD161 on the surface of NK cells with its ligand, CLEC2D has been previously shown to inhibit the killing function of the NK cells (see Examples 6 and 13) and this can be restored using anti-CD161 antibody.
- NK cells were isolated from frozen human PBMCs of two healthy donors and stimulated with IL-2 overnight.
- the IL-2 stimulated NK cells were then added to wells of a microtiter plate per pre-defined plate maps.
- Test articles (Ab9 or isotype control (D1.3_hIgG1_N297A was used as a negative control)) were added to the effector cells starting at 300 nM to 0.02 nM as a 4 fold dilution and incubated for 30 minutes on ice.
- Burkitt Lymphoma cell line Raji cells (target cell line that endogenously expresses high levels of CLEC2D, CLEC2D + target cells) were stained with Cell Trace Violet (CTV) for 20 minutes at room temperature protected from light. Post staining with CTV, the target cells were incubated for 5 minutes with Heat inactivated-FBS and then centrifuged to remove all unbound CTV. The CLEC2D + target cells were added to the effector cells at a final effector:target ratio of 1:1 and incubated at 37°C/5% CO2 for 4 hours. Cells were washed twice and resuspended in FACS buffer followed by staining with FVD-Near IR.
- CTV Cell Trace Violet
- NK cell mediated cytotoxicity was measured by analyzing %CTV + FVD + population.
- FIGs.18A (donor #1) and 18B (donor #2) Ab9 shows dose dependent increase in NK cell mediated cytotoxicity, wherein 0.01 nM of Ab9 does not show any efficacy and the cytotoxic activity saturates at 1 nM for both donors showing high potency of the molecule in enhancing NK cell function.
- Example 15 Enhanced T Cell Activation in Antigenic Peptide Recall Assay in the Presence of An Anti-CD161 antibody
- the example assesses the ability of anti-CD161 antibody, Ab9 to enhance re- activation of antigen specific effector memory CD4 T cells by blocking CD161 (expressed on T cells) interaction with CLEC2D (expressed on monocyte-derived DCs).
- anti-CD161 antibodies are able to increase antigen-mediated T cell receptor signaling in engineered Jurkat T cell lines by blocking the interaction of CD161 with CLEC2D expressed on target cells displaying relevant antigen.
- This example tests whether anti-CD161 antibody (Ab9) treatment enhances the reactivation of an effector memory subset of primary human T cells expanded from human PBMCs.
- Infections from a variety of pathogens result in the activation and expansion of antigenic peptide-specific effector T cells. Memory T cells towards these peptides remain in circulation long after the infectious agent is cleared.
- Peptide reactive memory T cells from human peripheral blood can be re-activated and expanded following presentation with HLA- bound antigenic peptides, termed as antigen specific memory T cell recall response.
- Peptide pools can be used to expand multiple T cell precursors from a single donor.
- Monocytes were differentiated into dendritic cells (MoDC) by culturing purified CD14 + monocytes in DC differentiation media supplemented with 100 ng/ml GMCSF and 20 ng/ml IL-4.
- Purified CD14 + monocytes from donor D10637 (Hemacare) (termed as Donor 6) were plated in 1 ml of media at 1 x 10 6 cells per well in a 12 well plate in the presence of 100 ng/ml GMCSF and 20 ng/ml IL-4. 400 ⁇ l of media was removed and discarded every other day (Day2, Day4, and Day6) and replaced with 500 ⁇ l new media supplemented with cytokines.
- PBMCs were washed and counted.
- Cells were plated at 7.5 x 10 5 /ml in complete media supplemented with 2.5 ng/ml IL-2, 5 ng/ml IL-7, and 5 ng/ml IL- 15. Media was exchanged on Day 5 in complete media supplemented with cytokines. T cell cultures did not exceeded a density of 1.5 x 10 6 /ml.
- MoDCs were exposed to CEFX peptide (10 ng/ml) for 2 hours at 37°C.
- Intracellular staining was performed with the following antibodies: Alexa-488 Ki67 (Clone Ki-67) and PE-IFN ⁇ (Clone B27). Cells were washed 3X in FACS staining buffer (PBS + 1% FCS) and analyzed on the SymphonyTM Cell Analyzer (BD Biosciences). Data was analyzed on Flow JoTM and plotted using GraphPad PRISMTM. Statistics were performed using Graphpad PRISM. P-values were analyzed from replicate datasets using student t-test. [00554] To explore the effect of anti-CD161 antibody (Ab9) in a memory recall assay, PBMCs from a donor who was seropositive for CMV and prior tested to respond to CEFX peptide stimulation were utilized.
- Ab9 anti-CD161 antibody
- Monocytes differentiated into dendritic cells were activated to increase expression of CLEC2D.
- autologous T cells were activated and expanded on CEFX peptide for 7 days.
- MoDCs were pulsed with 10 ng/ml of CEFX peptide and co-cultured with autologous T cells that were previously expanded on CEFX peptide, either in presence of Ab9 or isotype control or absence of any antibody treatment for 24 hours.
- the co-culture was followed with flow cytometric staining for T cell markers, CD45RO for memory T cells, CD161 using a non-cross-reactive antibody clone and intracellular staining for IFN ⁇ and Ki67.
- CD45RO + EM CD4 T cells expressing CD161 had lower IFN ⁇ production and lower proliferation (as measured by Ki67 expression) in the presence of CLEC2D expressing MoDCs than CD4 EM cells that did not express CD161, suggesting that CD161 is a negative regulator of T cell activation.
- FIGs 19A-19B when Ab9 was used to block CD161 interaction with CLEC2D, both cytokine production and proliferation were significantly increased as compared to the isotype control.
- cytokines from T cells within the tumor microenvironment plays a critical role in anti-tumor immunity.
- Tumor-infiltrating T cells can express inhibitory molecules which, upon binding to their respective ligands, function to suppress T cell effector functions.
- the interaction between CD161 on T cells with its ligand, CLEC2D has been shown to inhibit T cell cytokine production in previous studies (see Mathewson et al. (2021) CELL, 184(5), 1281-1298).
- the anti CD161 antibody (Ab9) is able to recover IL-2 production by Jurkat T cells in presence of CLEC2D expressing target cells.
- This antigen is expressed on normal melanocytes and is highly expressed on malignant melanoma samples thus behaving as a Tumor Associated Antigen (TAA).
- TAA Tumor Associated Antigen
- the antigenic peptide of MART-1 (ELAGIGILTV) is presented in context of the HLA-A2 subtype of MHC Class I. Healthy individuals have a high frequency of circulating MART-1 T cells that can display potent anti-tumor lytic activity upon in vitro expansion and reactivation. The experiment leveraged this to develop an antigen specific human T cell functional assay using MART-1 specific CD8 + T cells as effectors and peptide-loaded HLA-A2 + tumor cell lines as target cells.
- MART-1 T cells were primed, activated, and expanded in the presence of autologous antigen-presenting cells that are pulsed with the MART-1 peptide.
- these antigen specific T cells were enriched by cell sorting and subsequently reactivated via co-culture with target cells that are peptide pulsed with MART-1 peptide.
- T cell cytokine responses were evaluated.
- human CD8 + T cells that recognize the MART-1 antigen were expanded and sorted from PBMCs over the course of approximately 3 weeks. 48 hours prior to reactivation, the MART-1-specific T cells were enriched for their expression of CD161 by cell sorting (BD MelodyTM).
- Ab9 and the corresponding isotype control antibody were diluted to 400 nM (4x final concentration) in 200 ⁇ L of T cell media in the first column of a 96-well polypropylene plate.
- the antibodies were serially diluted 10-fold across the plate by transferring 20 ⁇ L into 180 ⁇ L T cell media.
- MART-1-specific T cells were pre-incubated with antibodies (Ab9 or isotope control) for 30 minutes and then co-cultured with MART-1 peptide-loaded or no-peptide Raji cells overnight (approximately 20 hours).
- Co-cultures were transferred to V-bottom assay plates and stained with surface stain master mix containing (diluted in FACS buffer): 1:1000 NEAR-IR Live/Dead stain, 1:20 anti-human CD8a APC, 1:20 anti-human CD161 BV421, and 1:20 anti-human CD19 PE. Following a 30-minute incubation, cells were fixed by incubation with fixation buffer for 30 minutes. Plates were resuspended in FACS buffer, then covered in foil and placed at 4°C overnight. Plates were spun, supernatant removed, and co-cultures were washed with 1X permeabilization buffer (diluted 10X stock Permeabilization buffer 1:10 in UltraPure water). This step was repeated once more.
- 1X permeabilization buffer diluted 10X stock Permeabilization buffer 1:10 in UltraPure water
- Co- cultures were then incubated with intracellular stain master mix containing (diluted in 1x permeabilization buffer): 1:20 anti-human IFN ⁇ FITC. Co-cultures were again spun and washed with 1x permeabilization buffer, resuspended in FACS buffer and analyzed on the FACS SymphonyTM. The data was then analyzed on Flow JoTM followed with graphing and statistical analyses on GraphPadTM Prism. [00559] To elicit cytokine production, MART-1-specific T cells were expanded in vitro for 23 days and subsequently reactivated via co-culture with peptide-loaded Raji target cells in the presence of Ab9 or an isotype control.
- Raji is a Burkitt lymphoma cell line which endogenously expresses CLEC2D, the ligand for CD161, and was engineered to overexpress HLA-A0201 to allow for exogenous loading of the MART-1 peptide.
- Granzyme B was undetectable via MSD while secreted IFN ⁇ levels were above the standard curve range. Summary of the cytokine readouts is provided in TABLE 19.
- Example 17 Blocking of CD161-CLEC2D interaction by Ab9 Results in Restoration of Anti-Tumor Cytotoxicity of Primary Antigen-Specific Human MART-1 T cells
- This example assesses the ability of anti CD161 antibody (Ab9) to enhance the cytotoxicity function of MART-1-specific T cells in co-culture with Raji target cells through blockade of interaction of CD161 on the T cells with CLEC2D expressed on the target cells.
- anti CD161 antibody (Ab9) is able to restore human NK cell degranulation and cytolytic function.
- MART-1 Antigen-Specific T Cell Cytotoxicity Assay Similar to Example 16, T cells utilized in this assay were specific to MART-1. To initially generate the effector cells, MART-1 T cells are primed, activated and expanded in the presence of autologous antigen-presenting cells that are pulsed with the MART-1 peptide.
- these antigen specific T cells are enriched by cell sorting and subsequently reactivated via co-culture with target cells that are peptide pulsed with MART-1 peptide. Upon reactivation, T cell mediated killing of target cells is evaluated as a measure of its cytolytic function.
- human CD8+ T cells that recognize the MART-1 antigen were expanded and sorted from PBMCs from two donors over the course of approximately 3 weeks. Then, 48 hours prior to reactivation, the MART-1-specific T cells were enriched for their expression of CD161 by cell sorting (BD MelodyTM).
- Ab9 and the corresponding isotype control antibody were diluted to 400 nM (4x final concentration) in 200 ⁇ L of T cell media in the first column of a 96- well polypropylene plate.
- the antibodies were serially diluted 10-fold across the plate by transferring 20 ⁇ L into 180 ⁇ L T cell media.
- MART-1-specific T cells were pre-incubated with antibodies (Ab9 or isotype control) for 30 minutes and then co-cultured with either MART-1 peptide-loaded or no-peptide Raji cells overnight (approximately 20 hours).
- Brefeldin A was added to the co-cultures, followed by an additional 6 hours of incubation for intracellular detection of Granzyme B expression.
- Co-cultures were transferred to V-bottom assay plates and stained with surface stain master mix containing (diluted in FACS buffer): 1:1000 NEAR-IR Live/Dead stain, 1:20 anti-human CD8a APC, 1:20 anti-human CD161 BV421, and 1:20 anti- human CD19 PE.
- the anti CD19 antibody is used to label the target cell line Raji and the Live/Dead stain is preferentially taken up by dead cells.
- This staining methodology enables live target cell quantification after co-culture with the MART-1 T cells by flow cytometry. Following a 30-minute incubation, cells were fixed by incubation with fixation buffer for 30 minutes.
- MART-1- specific T cells were expanded in vitro for 23 days and subsequently reactivated via co-culture with peptide-loaded Raji target cells in the presence of Ab9 or an isotype control. Compared to isotype control, administration of Ab9 resulted in a concentration-dependent increase in the frequency of Granzyme B producing T cells from 2 different donors as shown in FIGs.21A- 21B. The EC 50 and EC 90 values from these analyses are shown in TABLE 20.
- Example 18 Evaluation of Cytokine Release by Immobilized or Soluble Anti-CD161 Antibody (Ab9) in Human PBMCs From Healthy Donors [00571] This example evaluates the potential for Ab9 to induce cytokine release in PBMCs from six healthy donors using two different assay formats: plate bound and soluble form of antibody.
- Anti-CD20 rituximab anti-CD20 B-cell depleting antibody and known to stimulate cytokine storm in a subset of cancer patients
- anti-CD3 muromonab a known CRS inducer
- Cytokine release syndrome (CRS; or cytokine storm) is a rare potential side effect associated with the use of certain therapeutic antibodies and can result in morbidity and mortality.
- PBMCs peripheral blood mononuclear cells
- test article antibodies (Ab9, isotype control D1.3 with N297A, rituximab, muromonab, mouse IgG2A isotype control for anti CD3 (“isotype control antibody”), and D1.3 IgG1 WT isotype control) were serially diluted into individual wells of a microtiter plate and incubated at room temperature for 2 hours.
- Muromonab and rituximab were plated at 1 ⁇ g/well and isotype control antibody was plated at 20 ⁇ g/well.
- PBMCs were resuspended and plated in the antibody-coated microtiter plates at 2 x 10 5 cells in 200 ⁇ L per well and then incubated at 37 °C in a CO2 incubator for 48 hours.
- serially diluted antibodies were added to each well mixed with PBMCs at 2 x 10 5 cells in 200 ⁇ L per well and then incubated at 37 °C in a CO 2 incubator for 48 hours.
- Muromonab and rituximab were added at a final concentration of 5 ⁇ g/ml and isotype control antibody (isotype control D1.3 with N297A) was added at a final concentration of 100 ⁇ g/ml.
- MSD assay was performed according to the manufacturer’s instructions (MSD kit for cytokine analyses: U-PLEX Biomarker Group 1 (hu) assays (K15067L-2). This kit includes reagents to detect Human IFN- ⁇ , IL1 ⁇ , IL-2, IL-4, IL-6, IL-10, IL-17A and TNF- ⁇ in a U-PLEX format). Data analyses was done on the Discovery Workbench software from MSD, followed by graphing and statistical analyses on GraphPadTM Prism.
- FIGs.22A-22F and FIGs.23A-23F show the cytokine release in presence of Ab9 using plate bound format and soluble format, respectively.
- Ab9 was tested for a range of concentrations from 0.01 ⁇ g/ml up to 1000 ⁇ g/ml and isotype control (isotype control D1.3 with N297A) was tested at 100 ⁇ g/ml.
- Muromonab and Rituximab and their corresponding isotype controls were tested at a concentration of 5 ⁇ g/ml, which has been reported to induce cytokine release in vitro.
- Non-GLP DRF Toxicology Study A nonterminal, non-GLP, DRF study in cynomolgus monkeys was conducted to evaluate the tolerability and PK of Ab9 after a total of 3 once weekly (days 1, 8, and 15) intravenous (IV) slow bolus injections at 10 mg/kg and 100 mg/kg per dose in female cynomolgus monkeys (3 females/group).
- IV intravenous
- TABLE 22 Study design of non-GLP DRF toxicology study.
- Whole blood samples of approximately 1 mL were collected from a peripheral vein of all animals for determination of Ab9 exposure.
- Samples were collected at the following target timepoints: x Day 1 at predose, 1-hour, 24 hours, and 96 hours postdose; x Day 8 at predose and 1-hour postdose; and x Day 15 at predose, 1-hour, 24 hours, 96 hours, 168 hours, 336 hours, 528 hours, 672 hours, 840 hours, and 1008 hours postdose.
- Quantification of Ab9 in serum from the blood samples was performed using a qualified bioanalytical method (enzyme-linked immunosorbent assay).
- TK parameters were generated from individual Ab9 serum concentrations and nominal times. Individual concentrations less than the LLOQ were treated as 0 in the TK data analysis.
- the plots of mean Ab9 serum concentrations versus time profiles for each dose group are presented in FIG.24 using a semilog scale. After weekly IV slow bolus (over 2-3 minutes) administration of Ab9 at doses of 10 mg/kg and 100 mg/kg per dose for a total of 3 doses, the female monkeys were systemically exposed to Ab9 with concentrations above 0.625 ⁇ g/mL (LLOQ) until 1,008 hours for 4 out of 6 animals at both Ab9 dose levels investigated. The time of observed maximum concentration (Tmax) was observed 1 hour after single or multiple weekly dose administrations.
- TK parameters were generated from individual Ab9 serum concentrations and nominal times on days 1, 22, and 29. Individual concentrations less than the LLOQ were treated as 0 in the TK data analysis.
- day 8 pre-dose was used with day 1 data as 168 hours postdose and day 29 pre- dose was used with day 22 data as 168 hours post-dose.
- AUC 0-24 area under the plasma concentration-time curve from time 0 to time 24 hours postdose
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Public Health (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3229448A CA3229448A1 (en) | 2021-08-23 | 2022-08-23 | Anti-cd161 antibodies and uses thereof |
| MX2024002281A MX2024002281A (es) | 2021-08-23 | 2022-08-23 | Anticuerpos anti-cd161 y usos de los mismos. |
| AU2022332285A AU2022332285A1 (en) | 2021-08-23 | 2022-08-23 | Anti-cd161 antibodies and uses thereof |
| CN202280071271.9A CN118284623A (zh) | 2021-08-23 | 2022-08-23 | 抗cd161抗体及其用途 |
| EP22777507.9A EP4392451A1 (en) | 2021-08-23 | 2022-08-23 | Anti-cd161 antibodies and uses thereof |
| JP2024537299A JP2024534265A (ja) | 2021-08-23 | 2022-08-23 | 抗cd161抗体及びその使用 |
| KR1020247009143A KR20240099138A (ko) | 2021-08-23 | 2022-08-23 | 항-cd161 항체 및 그의 용도 |
| IL310662A IL310662A (en) | 2021-08-23 | 2022-08-23 | Anti-CD161 antibodies and their uses |
| ZA2024/01321A ZA202401321B (en) | 2021-08-23 | 2024-02-12 | Anti-cd161 antibodies and uses thereof |
| US18/582,950 US12215159B2 (en) | 2021-08-23 | 2024-02-21 | Anti-CD161 antibodies and uses thereof |
| US18/987,178 US12304957B2 (en) | 2021-08-23 | 2024-12-19 | Anti-CD161 antibodies and uses thereof |
| US19/179,208 US20250243281A1 (en) | 2021-08-23 | 2025-04-15 | Anti-cd161 antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163236122P | 2021-08-23 | 2021-08-23 | |
| US63/236,122 | 2021-08-23 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/582,950 Continuation US12215159B2 (en) | 2021-08-23 | 2024-02-21 | Anti-CD161 antibodies and uses thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023028501A1 true WO2023028501A1 (en) | 2023-03-02 |
Family
ID=83447883
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/075370 Ceased WO2023028501A1 (en) | 2021-08-23 | 2022-08-23 | Anti-cd161 antibodies and uses thereof |
Country Status (11)
| Country | Link |
|---|---|
| US (3) | US12215159B2 (https=) |
| EP (1) | EP4392451A1 (https=) |
| JP (1) | JP2024534265A (https=) |
| KR (1) | KR20240099138A (https=) |
| CN (1) | CN118284623A (https=) |
| AU (1) | AU2022332285A1 (https=) |
| CA (1) | CA3229448A1 (https=) |
| IL (1) | IL310662A (https=) |
| MX (1) | MX2024002281A (https=) |
| WO (1) | WO2023028501A1 (https=) |
| ZA (1) | ZA202401321B (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024229461A3 (en) * | 2023-05-04 | 2024-12-26 | Novasenta, Inc. | Anti-cd161 antibodies and methods of use thereof |
| WO2025111317A1 (en) * | 2023-11-21 | 2025-05-30 | The Brigham And Women's Hospital, Inc. | Klrb1 binding agents and methods of use thereof |
| WO2025128975A1 (en) * | 2023-12-14 | 2025-06-19 | Immunitas Therapeutics, Inc. | Cd161 binding proteins and related methods |
| WO2025190376A1 (zh) * | 2024-03-15 | 2025-09-18 | 深圳众格生物科技有限公司 | 抗cd161抗体及其用途 |
| WO2025190375A1 (zh) * | 2024-03-15 | 2025-09-18 | 深圳众格生物科技有限公司 | 抗cd161抗体及其用途 |
| WO2025222087A3 (en) * | 2024-04-19 | 2026-01-29 | The Brigham And Women's Hospital, Inc. | Klrb1 binding agents and methods of use thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3229448A1 (en) | 2021-08-23 | 2023-03-02 | Immunitas Therapeutics, Inc. | Anti-cd161 antibodies and uses thereof |
Citations (89)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| US4560655A (en) | 1982-12-16 | 1985-12-24 | Immunex Corporation | Serum-free cell culture medium and process for making same |
| WO1987000195A1 (en) | 1985-06-28 | 1987-01-15 | Celltech Limited | Animal cell culture |
| US4657866A (en) | 1982-12-21 | 1987-04-14 | Sudhir Kumar | Serum-free, synthetic, completely chemically defined tissue culture media |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4767704A (en) | 1983-10-07 | 1988-08-30 | Columbia University In The City Of New York | Protein-free culture medium |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1990003430A1 (en) | 1988-09-23 | 1990-04-05 | Cetus Corporation | Cell culture medium for enhanced cell growth, culture longevity and product expression |
| US4927762A (en) | 1986-04-01 | 1990-05-22 | Cell Enterprises, Inc. | Cell culture medium with antioxidant |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0453082A1 (en) | 1990-03-09 | 1991-10-23 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| US5122469A (en) | 1990-10-03 | 1992-06-16 | Genentech, Inc. | Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| WO1993009872A1 (en) | 1991-11-21 | 1993-05-27 | Seed Capital Investments (Sci) B.V. | Test device comprising a plate containing a multiplicity of wells with an associated metering device, as well as a kit which comprises these devices and use of the devices |
| WO1993011794A1 (en) | 1991-12-13 | 1993-06-24 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5534615A (en) | 1994-04-25 | 1996-07-09 | Genentech, Inc. | Cardiac hypertrophy factor and uses therefor |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| US5589369A (en) | 1992-02-11 | 1996-12-31 | Cell Genesys Inc. | Cells homozygous for disrupted target loci |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US5855887A (en) | 1995-07-25 | 1999-01-05 | The Regents Of The University Of California | Blockade of lymphocyte down-regulation associated with CTLA-4 signaling |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6072035A (en) | 1992-09-25 | 2000-06-06 | Novartis Corporation | Reshaped monoclonal antibodies against an immunoglobulin isotype |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
| US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
| US6706477B2 (en) | 1997-09-22 | 2004-03-16 | University Of Rochester | Methods for producing polynucleotide libraries in vaccinia virus |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| US6893625B1 (en) | 1986-10-27 | 2005-05-17 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US7109003B2 (en) | 1998-12-23 | 2006-09-19 | Abgenix, Inc. | Methods for expressing and recovering human monoclonal antibodies to CTLA-4 |
| US7307064B2 (en) | 2003-08-04 | 2007-12-11 | Bristol-Myers Squibb Company | Methods for treating cardiovascular disease using a soluble CTLA4 molecule |
| US7311910B2 (en) | 1991-06-27 | 2007-12-25 | Bristol-Myers Squibb Company | Methods for treating cancer and infectious disease by blocking CTLA4-B7 interactions |
| WO2008077546A1 (en) | 2006-12-22 | 2008-07-03 | F. Hoffmann-La Roche Ag | Antibodies against insulin-like growth factor i receptor and uses thereof |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| WO2009036379A2 (en) | 2007-09-14 | 2009-03-19 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7670600B2 (en) | 2000-12-12 | 2010-03-02 | MedImmine, LLC | Molecules with extended half-lives, compositions and uses thereof |
| WO2010105256A1 (en) | 2009-03-13 | 2010-09-16 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| EP1537878B1 (en) | 2002-07-03 | 2010-09-22 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| US7972993B2 (en) | 2000-10-11 | 2011-07-05 | Pepscan Systems B.V. | Identification of protein binding sites |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8017114B2 (en) | 1999-08-24 | 2011-09-13 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
| WO2012009568A2 (en) | 2010-07-16 | 2012-01-19 | Adimab, Llc | Antibody libraries |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US8258082B2 (en) | 2000-12-18 | 2012-09-04 | Dyax Corp. | Focused libraries of genetic packages |
| US8263073B2 (en) | 2008-02-04 | 2012-09-11 | Medarex, Inc. | Anti-CTLA-4 antibodies with reduced blocking of binding of CTLA-4 to B7 and uses thereof |
| US8394925B2 (en) | 2004-11-12 | 2013-03-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| US8741295B2 (en) | 2009-02-09 | 2014-06-03 | Universite De La Mediterranee | PD-1 antibodies and PD-L1 antibodies and uses thereof |
| US8900587B2 (en) | 2007-06-18 | 2014-12-02 | Merck Sharp & Dohme Corp. | Antibodies to human programmed death receptor PD-1 |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US9102728B2 (en) | 2010-03-11 | 2015-08-11 | Ucb Biopharma Sprl | PD-1 antibodies |
| US9150641B2 (en) | 2009-12-22 | 2015-10-06 | Hoffmann—La Roche Inc. | Sequence dependent aggregation |
| US9175082B2 (en) | 2012-05-31 | 2015-11-03 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind PD-L1 |
| US9181342B2 (en) | 2008-09-12 | 2015-11-10 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| WO2019094983A1 (en) * | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| WO2021080682A1 (en) * | 2019-10-24 | 2021-04-29 | Massachusetts Institute Of Technology | Monoclonal antibodies that bind human cd161 and uses thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA3229448A1 (en) | 2021-08-23 | 2023-03-02 | Immunitas Therapeutics, Inc. | Anti-cd161 antibodies and uses thereof |
-
2022
- 2022-08-23 CA CA3229448A patent/CA3229448A1/en active Pending
- 2022-08-23 JP JP2024537299A patent/JP2024534265A/ja active Pending
- 2022-08-23 WO PCT/US2022/075370 patent/WO2023028501A1/en not_active Ceased
- 2022-08-23 CN CN202280071271.9A patent/CN118284623A/zh active Pending
- 2022-08-23 EP EP22777507.9A patent/EP4392451A1/en active Pending
- 2022-08-23 KR KR1020247009143A patent/KR20240099138A/ko active Pending
- 2022-08-23 AU AU2022332285A patent/AU2022332285A1/en active Pending
- 2022-08-23 MX MX2024002281A patent/MX2024002281A/es unknown
- 2022-08-23 IL IL310662A patent/IL310662A/en unknown
-
2024
- 2024-02-12 ZA ZA2024/01321A patent/ZA202401321B/en unknown
- 2024-02-21 US US18/582,950 patent/US12215159B2/en active Active
- 2024-12-19 US US18/987,178 patent/US12304957B2/en active Active
-
2025
- 2025-04-15 US US19/179,208 patent/US20250243281A1/en active Pending
Patent Citations (118)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4560655A (en) | 1982-12-16 | 1985-12-24 | Immunex Corporation | Serum-free cell culture medium and process for making same |
| US4657866A (en) | 1982-12-21 | 1987-04-14 | Sudhir Kumar | Serum-free, synthetic, completely chemically defined tissue culture media |
| WO1984003564A1 (en) | 1983-03-08 | 1984-09-13 | Commw Serum Lab Commission | Method of determining antigenically active amino acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4767704A (en) | 1983-10-07 | 1988-08-30 | Columbia University In The City Of New York | Protein-free culture medium |
| WO1987000195A1 (en) | 1985-06-28 | 1987-01-15 | Celltech Limited | Animal cell culture |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US6982321B2 (en) | 1986-03-27 | 2006-01-03 | Medical Research Council | Altered antibodies |
| US4927762A (en) | 1986-04-01 | 1990-05-22 | Cell Enterprises, Inc. | Cell culture medium with antioxidant |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US6893625B1 (en) | 1986-10-27 | 2005-05-17 | Royalty Pharma Finance Trust | Chimeric antibody with specificity to human B cell surface antigen |
| US5500362A (en) | 1987-01-08 | 1996-03-19 | Xoma Corporation | Chimeric antibody with specificity to human B cell surface antigen |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5204244A (en) | 1987-10-27 | 1993-04-20 | Oncogen | Production of chimeric antibodies by homologous recombination |
| WO1990003430A1 (en) | 1988-09-23 | 1990-04-05 | Cetus Corporation | Cell culture medium for enhanced cell growth, culture longevity and product expression |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5591669A (en) | 1988-12-05 | 1997-01-07 | Genpharm International, Inc. | Transgenic mice depleted in a mature lymphocytic cell-type |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US7022500B1 (en) | 1988-12-28 | 2006-04-04 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| EP0453082A1 (en) | 1990-03-09 | 1991-10-23 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US5122469A (en) | 1990-10-03 | 1992-06-16 | Genentech, Inc. | Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5821337A (en) | 1991-06-14 | 1998-10-13 | Genentech, Inc. | Immunoglobulin variants |
| US7311910B2 (en) | 1991-06-27 | 2007-12-25 | Bristol-Myers Squibb Company | Methods for treating cancer and infectious disease by blocking CTLA4-B7 interactions |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5587458A (en) | 1991-10-07 | 1996-12-24 | Aronex Pharmaceuticals, Inc. | Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof |
| WO1993009872A1 (en) | 1991-11-21 | 1993-05-27 | Seed Capital Investments (Sci) B.V. | Test device comprising a plate containing a multiplicity of wells with an associated metering device, as well as a kit which comprises these devices and use of the devices |
| US5869619A (en) | 1991-12-13 | 1999-02-09 | Xoma Corporation | Modified antibody variable domains |
| US5770196A (en) | 1991-12-13 | 1998-06-23 | Xoma Corporation | Modified antibody variable domains and therapeutic uses thereof |
| WO1993011794A1 (en) | 1991-12-13 | 1993-06-24 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| US5821123A (en) | 1991-12-13 | 1998-10-13 | Xoma Corporation | Modified antibody variable domains |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| US5589369A (en) | 1992-02-11 | 1996-12-31 | Cell Genesys Inc. | Cells homozygous for disrupted target loci |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US6072035A (en) | 1992-09-25 | 2000-06-06 | Novartis Corporation | Reshaped monoclonal antibodies against an immunoglobulin isotype |
| US5534615A (en) | 1994-04-25 | 1996-07-09 | Genentech, Inc. | Cardiac hypertrophy factor and uses therefor |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| US5855887A (en) | 1995-07-25 | 1999-01-05 | The Regents Of The University Of California | Blockade of lymphocyte down-regulation associated with CTLA-4 signaling |
| US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| WO1997030087A1 (en) | 1996-02-16 | 1997-08-21 | Glaxo Group Limited | Preparation of glycosylated antibodies |
| US6207156B1 (en) | 1997-03-21 | 2001-03-27 | Brigham And Women's Hospital, Inc. | Specific antibodies and antibody fragments |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| WO1998058964A1 (en) | 1997-06-24 | 1998-12-30 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| US6872518B2 (en) | 1997-09-22 | 2005-03-29 | University Of Rochester | Methods for selecting polynucleotides encoding T cell epitopes |
| US6800442B2 (en) | 1997-09-22 | 2004-10-05 | University Of Rochester | Methods of selecting polynucleotides encoding antigens |
| US6706477B2 (en) | 1997-09-22 | 2004-03-16 | University Of Rochester | Methods for producing polynucleotide libraries in vaccinia virus |
| WO1999022764A1 (en) | 1997-10-31 | 1999-05-14 | Genentech, Inc. | Methods and compositions comprising glycoprotein glycoforms |
| US6602684B1 (en) | 1998-04-20 | 2003-08-05 | Glycart Biotechnology Ag | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
| US7109003B2 (en) | 1998-12-23 | 2006-09-19 | Abgenix, Inc. | Methods for expressing and recovering human monoclonal antibodies to CTLA-4 |
| US8883984B2 (en) | 1998-12-23 | 2014-11-11 | Amgen Fremont Inc. | Human monoclonal antibodies to CTLA-4 |
| US8143379B2 (en) | 1998-12-23 | 2012-03-27 | Amgen Fremont Inc. | Human monoclonal antibodies to CTLA-4 |
| US7824679B2 (en) | 1998-12-23 | 2010-11-02 | Amgen Fremont Inc. | Human monoclonal antibodies to CTLA-4 |
| US7807797B2 (en) | 1998-12-23 | 2010-10-05 | Amgen Fremont Inc. | Human monoclonal antibodies to CTLA-4 |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US7132281B2 (en) | 1998-12-23 | 2006-11-07 | Amgen Fremont Inc. | Methods and host cells for producing human monoclonal antibodies to CTLA-4 |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US7332581B2 (en) | 1999-01-15 | 2008-02-19 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US8784815B2 (en) | 1999-08-24 | 2014-07-22 | Medarex, L.L.C. | Human CTLA-4 antibodies and their uses |
| WO2001014424A2 (en) | 1999-08-24 | 2001-03-01 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| EP1212422B1 (en) | 1999-08-24 | 2007-02-21 | Medarex, Inc. | Human ctla-4 antibodies and their uses |
| US8318916B2 (en) | 1999-08-24 | 2012-11-27 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
| US6984720B1 (en) | 1999-08-24 | 2006-01-10 | Medarex, Inc. | Human CTLA-4 antibodies |
| US8017114B2 (en) | 1999-08-24 | 2011-09-13 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
| US7972993B2 (en) | 2000-10-11 | 2011-07-05 | Pepscan Systems B.V. | Identification of protein binding sites |
| US7670600B2 (en) | 2000-12-12 | 2010-03-02 | MedImmine, LLC | Molecules with extended half-lives, compositions and uses thereof |
| US8258082B2 (en) | 2000-12-18 | 2012-09-04 | Dyax Corp. | Focused libraries of genetic packages |
| US6881557B2 (en) | 2001-07-12 | 2005-04-19 | Arrowsmith Technologies Llp | Super humanized antibodies |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20030157108A1 (en) | 2001-10-25 | 2003-08-21 | Genentech, Inc. | Glycoprotein compositions |
| WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
| EP1537878B1 (en) | 2002-07-03 | 2010-09-22 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US9073994B2 (en) | 2002-07-03 | 2015-07-07 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US8728474B2 (en) | 2002-07-03 | 2014-05-20 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| WO2004056312A2 (en) | 2002-12-16 | 2004-07-08 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| US7488802B2 (en) | 2002-12-23 | 2009-02-10 | Wyeth | Antibodies against PD-1 |
| US7307064B2 (en) | 2003-08-04 | 2007-12-11 | Bristol-Myers Squibb Company | Methods for treating cardiovascular disease using a soluble CTLA4 molecule |
| WO2005100402A1 (en) | 2004-04-13 | 2005-10-27 | F.Hoffmann-La Roche Ag | Anti-p-selectin antibodies |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US8394925B2 (en) | 2004-11-12 | 2013-03-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8779105B2 (en) | 2005-05-09 | 2014-07-15 | Medarex, L.L.C. | Monoclonal antibodies to programmed death 1 (PD-1) |
| US9273135B2 (en) | 2005-07-01 | 2016-03-01 | E. R. Squibb & Sons, L. L. C. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2008077546A1 (en) | 2006-12-22 | 2008-07-03 | F. Hoffmann-La Roche Ag | Antibodies against insulin-like growth factor i receptor and uses thereof |
| US8952136B2 (en) | 2007-06-18 | 2015-02-10 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor PD-1 |
| US8900587B2 (en) | 2007-06-18 | 2014-12-02 | Merck Sharp & Dohme Corp. | Antibodies to human programmed death receptor PD-1 |
| WO2009036379A2 (en) | 2007-09-14 | 2009-03-19 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| US8691730B2 (en) | 2007-09-14 | 2014-04-08 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US8263073B2 (en) | 2008-02-04 | 2012-09-11 | Medarex, Inc. | Anti-CTLA-4 antibodies with reduced blocking of binding of CTLA-4 to B7 and uses thereof |
| US9181342B2 (en) | 2008-09-12 | 2015-11-10 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US8927697B2 (en) | 2008-09-12 | 2015-01-06 | Isis Innovation Limited | PD-1 specific antibodies and uses thereof |
| US9102727B2 (en) | 2008-09-26 | 2015-08-11 | Emory University | Human anti-PD-1 antibodies and uses therefor |
| US8552154B2 (en) | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US8741295B2 (en) | 2009-02-09 | 2014-06-03 | Universite De La Mediterranee | PD-1 antibodies and PD-L1 antibodies and uses thereof |
| WO2010105256A1 (en) | 2009-03-13 | 2010-09-16 | Adimab, Inc. | Rationally designed, synthetic antibody libraries and uses therefor |
| US9150641B2 (en) | 2009-12-22 | 2015-10-06 | Hoffmann—La Roche Inc. | Sequence dependent aggregation |
| US9102728B2 (en) | 2010-03-11 | 2015-08-11 | Ucb Biopharma Sprl | PD-1 antibodies |
| WO2012009568A2 (en) | 2010-07-16 | 2012-01-19 | Adimab, Llc | Antibody libraries |
| US9354228B2 (en) | 2010-07-16 | 2016-05-31 | Adimab, Llc | Antibody libraries |
| US9205148B2 (en) | 2011-04-20 | 2015-12-08 | Medimmune, Llc | Antibodies and other molecules that bind B7-H1 and PD-1 |
| US9175082B2 (en) | 2012-05-31 | 2015-11-03 | Sorrento Therapeutics, Inc. | Antigen binding proteins that bind PD-L1 |
| US8735553B1 (en) | 2013-09-13 | 2014-05-27 | Beigene, Ltd. | Anti-PD1 antibodies and their use as therapeutics and diagnostics |
| WO2019094983A1 (en) * | 2017-11-13 | 2019-05-16 | The Broad Institute, Inc. | Methods and compositions for treating cancer by targeting the clec2d-klrb1 pathway |
| WO2021080682A1 (en) * | 2019-10-24 | 2021-04-29 | Massachusetts Institute Of Technology | Monoclonal antibodies that bind human cd161 and uses thereof |
Non-Patent Citations (131)
| Title |
|---|
| "Uniprot", Database accession no. A0A2K5WYI1 |
| AALBERSE ET AL., IMMUNOLOGY, vol. 105, 2002, pages 9 - 19 |
| ABBOTT ET AL., IMMUNOLOGY, vol. 142, no. 4, 2014, pages 526 - 535 |
| ADALIMUMAB, LAPADULA ET AL., INT. J. IMMUNOPATHOL. PHARMACOL., vol. 27, 2014, pages 33 - 38 |
| ALDEMIR ET AL., J. I O ., vol. 175, no. 12, 2005, pages 7791 - 5 |
| ANGAL, S ET AL., MOL. IMMUNOL., vol. 30, 1993, pages 105 - 108 |
| ANSELMO ET AL., BIOENG, vol. 1, 2016, pages 10 - 29 |
| ARABI GHAHROUDI ET AL., FEBS LETTERS, vol. 414, 1998, pages 521 - 526 |
| ARMOUR ET AL., M . I ., vol. 40, 2003, pages 585 - 593 |
| AVERY, MABS, vol. 10, no. 2, 2018, pages 244 - 255 |
| BAERGA-ORTIZ, PROTEIN SCI., vol. 11, no. 6, 2002, pages 1300 - 1308 |
| BARNES ET AL., ANAL. BIOCHEM., vol. 102, 1980, pages 255 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83 |
| BRIAKINUMAB, MISSELWITZA ET AL., DIGESTION, vol. 101, 2020, pages 69 - 82 |
| BROWN ME, PLOS ONE, vol. 15, no. 3, 2020, pages e0229206 |
| BRUGGEMANN ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361 |
| BRUGGERMANN ET AL., YEAR IN IMMUNO., vol. 7, 1993, pages 33 |
| CARTER ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 163 - 167 |
| CHOTHIALESK, J. M . B ., vol. 196, 1987, pages 901 - 917 |
| CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196 |
| CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656 |
| COCHRAN ET AL., J. IMMUNOL. METH, vol. 287, 2004, pages 147 - 158 |
| COLOMAMORRISON, NATURE B O C O ., vol. 15, 1997, pages 159 - 163 |
| COLOMAMORRISON, NATURE BIOTECHNOL., vol. 15, 1997, pages 159 - 163 |
| COX ET AL.: "Immunoassay Methods", ASSAY GUIDANCE MANUAL, 24 December 2014 (2014-12-24) |
| CRAGG ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052 |
| CRAGG ET AL., BLOOD, vol. 103, 2004, pages 2738 - 2743 |
| CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 085 |
| ESTEP ET AL., MABS, vol. 5, no. 2, 2013, pages 270 - 8 |
| ESTEP ET AL., MABS, vol. 7, no. 3, 2015, pages 553 - 561 |
| FIEDLER ET AL., BIOCONJUGATE CHEMISTRY, vol. 9, no. 2, 1998, pages 236 - 234 |
| FINCO ET AL., J. P A . B O . ANAL., vol. 54, 2011, pages 351 - 358 |
| FISHWILD, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851 |
| FLANAGAN, N., GENETIC ENGINEERING AND BIOTECHNOLOGY NEWS, vol. 3, no. 2, 2010, pages 25 - 28 |
| GAZZANO-SANTORO, J. IMMUNOL. METHODS, vol. 202, 1996, pages 163 - 171 |
| GERMAIN ET AL., J. BIOL. CHEM., vol. 286, no. 44, 2011, pages 37964 - 37975 |
| GRAMER ET AL., A S, vol. 5, 2013, pages 962 - 972 |
| GRUBER ET AL., J. I O ., vol. 152, 1994, pages 5368 - 5374 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 - 5374 |
| GUSS ET AL., EMBO J., vol. 5, 1986, pages 1567 - 1575 |
| HAM, METH. ENZ., vol. 58, 1979, pages 44 |
| HARLOWLANE: "ANTIBODIES: A LABORATORY MANUAL", vol. 14, 1988, COLD SPRING HARBOR LABORATORY |
| HAWKINS ET AL., J. M . B ., vol. 226, 1992, pages 889 - 896 |
| HELLSTROM ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502 |
| HELLSTROM ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063 |
| HOLLINGER ET AL., P . N . A . S USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381 - 388 |
| HOOGENBOOM ET AL., METHODS MOL. BIOL., vol. 178, 2001, pages 1 - 37 |
| HUDSON ET AL., NAT. MED, vol. 9, 2003, pages 129 - 134 |
| J. M . B ., vol. 273, 1997, pages 927 - 48 |
| JACKSON ET AL., J. I ., vol. 154, 1995, pages 3310 - 33199 |
| JAIN ET AL., PROC. NATL. ACAD. SCI USA, vol. 114, no. 5, 2017, pages 944 - 949 |
| JAIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 114, no. 5, 2017, pages 944 - 949 |
| JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258 |
| JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI USA, vol. 90, 1993, pages 2551 |
| JOHNNSON, B. ET AL., ANAL. BIOCHEM., vol. 198, 1991, pages 268 - 277 |
| JOHNSSON, B., J. MOL. RECOGNIT., vol. 8, 1995, pages 125 - 131 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JONSSON, U. ET AL., ANN. BIOL. CLIN., vol. 51, 1993, pages 19 - 26 |
| JONSSON, U. ET AL., BIOTECHNIQUES, vol. 11, 1991, pages 620 - 627 |
| KABAT ET AL., J. B O . C ., vol. 252, 1977, pages 6609 - 6616 |
| KABAT, A . PROTEIN C ., vol. 32, 1978, pages 1 - 75 |
| KANDA ET AL., BIOTECHNOL. BIOENG., vol. 94, 2006, pages 680 - 688 |
| KELLY ET AL., MABS, vol. 9, no. 7, 2017, pages 1036 - 1040 |
| KNAPPIK ET AL., J. MO . B O ., vol. 296, 2000, pages 57 - 86 |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 - 497 |
| KOSTELNY ET AL., J. I ., vol. 148, no. 12, 1992, pages 1547 - 1553 |
| KOZBOR, J. I ., vol. 133, 1984, pages 3001 |
| KREBS ET AL., J. I O . M ., vol. 254, 2001, pages 67 - 84 |
| LABRIJN ET AL., NATURE PROTOCOLS, vol. 9, 2014, pages 2450 - 2463 |
| LABRIJN ET AL., P OC. N . A . S . USA, vol. 110, 2013, pages 5145 - 5150 |
| LAZAR ET AL., P . N . A . S USA, vol. 103, 2006, pages 4005 - 4010 |
| LEFRANC ET AL., D . C . I O, vol. 27, 2003, pages 55 - 77 |
| LINDMARK ET AL., J. IMMUNOL. METH., vol. 62, 1983, pages 1 - 13 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| MARKS ET AL., J. MOL. BIOL, vol. 222, 1991, pages 581 - 597 |
| MARTIN ET AL., PLOSBIOL, vol. 7, no. 3, 2009, pages e1000054 |
| MARTIN: "REMINGTON'S PHARMACEUTICAL SCIENCES", 1990, MACK PUBLISHING COMPANY |
| MATHEWSON ET AL., CELL, vol. 184, no. 5, 2021, pages 1281 - 1298 |
| MAYROSE ET AL., BIOINFORMATICS, vol. 23, 2007, pages 3244 - 3246 |
| MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
| MERCHANT ET AL., NATURE B O C O ., vol. 16, 1998, pages 677 - 681 |
| MERCHANT ET AL., NATURE BIOTECHNOL, vol. 16, 1998, pages 677 - 681 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 540 |
| MOREA ET AL., METHODS, vol. 20, 2000, pages 267 - 279 |
| MORRIS: "METHODS IN MOLECULAR BIOLOGY", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols" |
| MORRISON ET AL., PROC. NAT. ACAD. SCI., vol. 81, 1984, pages 6851 - 6855 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855 |
| MUYLDERMANS ET AL., TRENDS IN BLOCHEM. SC, vol. 26, 2001, pages 230 - 245 |
| NEUBERGER ET AL., NATURE, vol. 312, 1984, pages 604 - 608 |
| PAES ET AL., J. AM. CHEM. SOC., vol. 131, no. 20, 2009, pages 6952 - 6954 |
| PETKOVA ET AL., INT'L. IMMUNOL, vol. 18, 2006, pages 1759 - 1769 |
| PRESTA, C . OP. S C . B O ., vol. 2, 1992, pages 2719 - 596 |
| QUEEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| RAVETCHKINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492 |
| REINEKE ET AL., CURR. OPIN. BIOTECHNOL., vol. 12, 2001, pages 59 - 64 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545 |
| ROCKBERG ET AL., NATURE METHODS, vol. 5, 2008, pages 1039 - 1045 |
| ROGUSKA ET AL., PROT. ENGINEER, vol. 9, 1996, pages 895 - 904 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SCHROEDERCAVACINI, J. ALLERGY C . I ., vol. 125, 2010, pages 41 - 52 |
| SCHROEDERCAVACINI, J. ALLERGY CLIN. IMMUNOL., vol. 125, 2010, pages 41 - 52 |
| SHIELDS ET AL., J. B . C ., vol. 277, 2002, pages 26733 - 26740 |
| SIEGEL ET AL., J. IMMUNOL. METHODS, vol. 286, no. 1-2, 2004, pages 141 - 153 |
| SILMAN ET AL., CYTOMETRY, vol. 44, 2001, pages 30 - 37 |
| STAERZ, NATURE, vol. 314, 1985, pages 628 - 631 |
| STAERZBEVAN, P . N . A . S . USA, vol. 83, 1986, pages 1453 - 1457 |
| STAERZBEVAN, PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 1453 - 1457 |
| STEINBERGER ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 36073 - 36078 |
| SUCKAU ET AL., PROC. NATL. ACAD. SCI USA, vol. 87, 1990, pages 9848 - 9852 |
| TAN ET AL., J. I ., vol. 169, 2002, pages 1119 - 1125 |
| TODOROVSKA ET AL., J. I . METHODS, vol. 248, 2001, pages 47 - 66 |
| TODOROVSKA, IMMUNOL. METHODS, vol. 248, 2001, pages 47 - 66 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659 |
| TRUONG ET AL., NATURE COMM., vol. 10, 2019, pages 2263 |
| TUTT ET AL., J. I O ., vol. 147, 1991, pages 60 - 69 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 - 69 |
| USTEKINUMAB, BENSON, MABS, vol. 3, no. 6, 2011, pages 535 - 545 |
| VAN DE WATER ET AL., CLIN. IMMUNOL. IMMUNOPATHOL., vol. 85, no. 3, 1997, pages 229 - 235 |
| VASWAMI ET AL., ANNALS OF ALLERGY, ASTHMA, & IMMUNOL, vol. 81, 1998, pages 105 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| VESSILLIER ET AL., J. IMMUNOL. METHODS, vol. 424, 2015, pages 43 - 52 |
| WINTER, F LETT, vol. 430, 1998, pages 92 - 94 |
| WINTERMILSTEIN, NATURE, vol. 349, 1991, pages 293 - 299 |
| WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32 |
| XU ET AL., PROTEIN ENG. DES. SEL, vol. 26, no. 10, 2013, pages 663 - 70 |
| XU ET AL., PROTEIN ENG. DES. SEL., vol. 26, no. 10, 2013, pages 663 - 70 |
| YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, pages 614 - 622 |
| YIN ET AL., MABS, vol. 4, 2012, pages 217 - 225 |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024229461A3 (en) * | 2023-05-04 | 2024-12-26 | Novasenta, Inc. | Anti-cd161 antibodies and methods of use thereof |
| WO2025111317A1 (en) * | 2023-11-21 | 2025-05-30 | The Brigham And Women's Hospital, Inc. | Klrb1 binding agents and methods of use thereof |
| WO2025128975A1 (en) * | 2023-12-14 | 2025-06-19 | Immunitas Therapeutics, Inc. | Cd161 binding proteins and related methods |
| WO2025190376A1 (zh) * | 2024-03-15 | 2025-09-18 | 深圳众格生物科技有限公司 | 抗cd161抗体及其用途 |
| WO2025190375A1 (zh) * | 2024-03-15 | 2025-09-18 | 深圳众格生物科技有限公司 | 抗cd161抗体及其用途 |
| WO2025222087A3 (en) * | 2024-04-19 | 2026-01-29 | The Brigham And Women's Hospital, Inc. | Klrb1 binding agents and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| ZA202401321B (en) | 2025-05-28 |
| KR20240099138A (ko) | 2024-06-28 |
| EP4392451A1 (en) | 2024-07-03 |
| JP2024534265A (ja) | 2024-09-18 |
| CA3229448A1 (en) | 2023-03-02 |
| US20240279346A1 (en) | 2024-08-22 |
| US12215159B2 (en) | 2025-02-04 |
| AU2022332285A1 (en) | 2024-02-15 |
| US20250243281A1 (en) | 2025-07-31 |
| IL310662A (en) | 2024-04-01 |
| MX2024002281A (es) | 2024-05-20 |
| US20250122290A1 (en) | 2025-04-17 |
| US12304957B2 (en) | 2025-05-20 |
| CN118284623A (zh) | 2024-07-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12304957B2 (en) | Anti-CD161 antibodies and uses thereof | |
| WO2022256563A1 (en) | Anti-ccr8 antibodies and uses thereof | |
| TW202134282A (zh) | 抗體和使用彼之方法 | |
| CA3099176A1 (en) | Anti-sirp-beta1 antibodies and methods of use thereof | |
| JP7842914B2 (ja) | C5aRを標的とする抗体 | |
| US20210269542A1 (en) | Anti-gitr antigen-binding proteins and methods of use thereof | |
| JP2022553927A (ja) | Ilt-2阻害剤での癌の処置 | |
| US20220162305A1 (en) | Antibodies having specificity for btn2 and uses thereof | |
| CA3042727A1 (en) | Anti-gitr antigen-binding proteins and methods of use thereof | |
| HK40107037A (zh) | 抗cd161抗体及其用途 | |
| RU2795625C2 (ru) | Антигенсвязывающие белки против gitr и способы их применения | |
| WO2023227641A1 (en) | Use of tnf-alpha binding proteins and il-7 binding proteins in medical treatment | |
| JP2025524657A (ja) | 抗tigit抗体を使用したがんの治療方法 | |
| WO2025003511A1 (en) | Dual-targeting of flt3 and cd123 co-expressing tumor cells by functional complementation of cycat® halfbody molecules | |
| TW202233677A (zh) | Bcma/taci抗原結合分子 | |
| HK40061359B (zh) | 靶向c5ar的抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22777507 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022332285 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 310662 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2022332285 Country of ref document: AU Date of ref document: 20220823 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3229448 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024537299 Country of ref document: JP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024003388 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022777507 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022777507 Country of ref document: EP Effective date: 20240325 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280071271.9 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024003388 Country of ref document: BR Free format text: APRESENTE O NOVO QUADRO REIVINDICATORIO AJUSTANDO A REIVINDICACAO 118, CONFORME ART. 17 INCISO III DA INSTRUCAO NORMATIVA/INPI/NO 31/2013, UMA VEZ QUE A APRESENTADA NA PETICAO NO 870240014360 POSSUI MAIS DE UMA EXPRESSAO "CARACTERIZADO POR". A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112024003388 Country of ref document: BR Free format text: APRESENTE O NOVO QUADRO REIVINDICATORIO AJUSTANDO A REIVINDICACAO 112, CONFORME ART. 17 INCISO III DA INSTRUCAO NORMATIVA/INPI/NO 31/2013, UMA VEZ QUE A APRESENTADA NA PETICAO NO 870240057306 NAO POSSUI A EXPRESSAO "CARACTERIZADO POR". A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| ENP | Entry into the national phase |
Ref document number: 112024003388 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240221 |