WO2022246086A1 - Antibody drug conjugates using mates technology for delivering cytotoxic agents - Google Patents

Antibody drug conjugates using mates technology for delivering cytotoxic agents Download PDF

Info

Publication number
WO2022246086A1
WO2022246086A1 PCT/US2022/030070 US2022030070W WO2022246086A1 WO 2022246086 A1 WO2022246086 A1 WO 2022246086A1 US 2022030070 W US2022030070 W US 2022030070W WO 2022246086 A1 WO2022246086 A1 WO 2022246086A1
Authority
WO
WIPO (PCT)
Prior art keywords
moiety
agent
antibody
amino acid
group
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/030070
Other languages
English (en)
French (fr)
Inventor
Gene M. Dubowchik
Wieslaw Kazmierski
Richard Pracitto
Reese M. CALDWELL
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biohaven Therapeutics Ltd
Original Assignee
Biohaven Therapeutics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Biohaven Therapeutics Ltd filed Critical Biohaven Therapeutics Ltd
Priority to CN202280034208.8A priority Critical patent/CN117412761A/zh
Priority to CA3219550A priority patent/CA3219550A1/en
Priority to MX2023013270A priority patent/MX2023013270A/es
Priority to PH1/2023/553153A priority patent/PH12023553153A1/en
Priority to US18/555,858 priority patent/US20250108124A1/en
Priority to BR112023023525A priority patent/BR112023023525A2/pt
Priority to JP2023571661A priority patent/JP2024521092A/ja
Priority to KR1020237039501A priority patent/KR20240012381A/ko
Priority to IL307884A priority patent/IL307884A/en
Priority to AU2022277698A priority patent/AU2022277698A1/en
Priority to EP22805492.0A priority patent/EP4340859A4/en
Publication of WO2022246086A1 publication Critical patent/WO2022246086A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6855Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6861Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from kidney or bladder cancer cell
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment

Definitions

  • Antibody-drug conjugates are useful for various purposes, e.g., as diagnostic reagents, therapeutics (e.g., antigen targeted therapeutics), etc.
  • Existing drug antibody conjugation technologies can suffer from various challenges.
  • reactions conjugating moieties of interest (e.g., detection moieties, drug moieties, etc.) to target molecules (e.g., antibodies for antibody-drug conjugates) can be of low efficiency and/or have low selectivity (e.g., conjugation at various locations (e.g., various amino acid residues of antibodies) of target molecules), and product conjugate compositions are often highly heterogeneous, comprising a number of individual conjugate types each independently having its own copy number of moieties of interest, conjugation locations (e.g., different amino acid residues of proteins), etc.
  • Approved antibody drug conjugates for delivering for delivering cytotoxic agents to cancer cells include PADCEV (enfortumab vedotin) are ADCETRIS (brentuximab vedotin), both useful for delivering monomethyl auristatin E (MMAE).
  • Current drug antibody conjugation technologies include conjugation through lysine residues, conjugation through reduced interchain disulfide bonds, and conjugation through engineered cysteine residues. FIG. 1.
  • Each of these techniques has shortcomings. Conjugation through lysine produces a broad range of drug anti-body ratios (DAR), with each lysine labeled at is statistically probability. The result being millions of possible drug antibody conjugates.
  • DAR drug anti-body ratios
  • High DAR specifies are prone to CMC issues such as aggregation. Some species may easily release their conjugated drug, leading to toxicity. Conjugation through reduced inter-chain disulfide bonds also produces a variety of antibody conjugate species. The drug linkage can reverse over time, releasing free drug.
  • Existing techniques for conjugation through engineered cysteines involved extensive antibody manipulation or engineering.
  • This disclosure provides bifunctional molecules comprising monomethyl auristatin E (MMAE) and capable of forming antibody drug conjugates, in which conjugation occurs at finite and predictable sites on the antibody.
  • MMAE monomethyl auristatin E
  • manufacturing of conjugates involves multiple steps and includes various reactions, such as reduction, oxidation, hydrolysis, etc., and such reactions may cause undesired transformations, e.g., at one or more locations of target agent moieties (e.g., at one or more residues, and/or one or more modifications (e.g., glycans) of antibody moieties).
  • target agent moieties e.g., at one or more residues, and/or one or more modifications (e.g., glycans) of antibody moieties.
  • Such undesired transformations may further lower efficiency and/or increase heterogeneity of product conjugate compositions, complicate characterization, assessment and/or purification processes and increase product cost.
  • the present disclosure provides conjugation technologies for conjugating various moieties of interest to targets (e.g., proteins).
  • targets e.g., proteins
  • provided technologies provide directed conjugation in that moieties of interest are selectively conjugated at certain locations of targets (e.g., proteins such as antibodies).
  • provided technologies utilizes fewer steps.
  • provided technologies utilizes mild reaction conditions.
  • provided technologies include no reaction conditions such as reduction, oxidation, and/or hydrolysis.
  • provided technologies include substantially no cleavage from conjugate molecules comprising target agent moieties and moieties of interest (e.g., no cleavage of a group from target agent moieties, moieties of interest and/or linker moieties).
  • moieties of interest are detectable moieties (e.g., FITC).
  • moieties of interest are drug moieties (e.g., various drug moieties utilized in antibody-drug conjugates).
  • moieties of interest are protein moieties (e.g., antibody agents conjugated to other antibody agents (as target agent moieties)).
  • moieties of interest are or comprise reaction groups.
  • moieties of interest are or comprise reaction groups so that other moieties of interest can be further incorporated through reactions at the reaction groups.
  • the present disclosure provides improved efficiency and/or selectivity, reduced levels of heterogeneity, and/or reduced undesired transformations (e.g., through fewer steps of reactions (in some embodiments, only one), avoidance of certain reaction conditions (e.g., reduction, oxidation, hydrolysis, etc.).
  • the present disclosure provides agents comprising moieties of interest are conjugated at certain locations of target agent moieties.
  • the present disclosure provides compositions of increased homogeneity compared to compositions from a reference technology (e.g., a technology without using target binding moieties (e.g., LG) as described in provided methods).
  • the present disclosure provides technologies, e.g., mAb therapy enhancer (MATETM) technologies that can provide efficient site-directed chemical conjugation to "off-the-shelf" therapeutic antibody agents, e.g. various mAbs, and allow development of various bispecific therapeutic agents.
  • MATETM mAb therapy enhancer
  • technologies of the present disclosure e.g., MATE technologies, provide chemical engineering of antibody agents, e.g., various existing antibodies, without the need to create new DNA vectors or genetic engineering of master cell lines.
  • advantages of provided technologies include 1) site-directed conjugation specificity, and/or 2) no requirement of genetic engineering, compared to certain existing methods that 1) lack site-directed conjugation specificity by indiscriminately binding/conjugating to available amino acid residues, and/or 2) require genetic engineering to create conjugate tags.
  • Schematics of the MATES technology are shown in FIGURE 2 and S. BRIEF DESCRIPTION OF THE DRAWINGS
  • FIGURE 1 Diagrams of existing drug antibody technologies. A. Conjugation through lysine residues. B. Conjugation through reduced inter-chain disulfide bonds. C. Conjugation through engineered cysteine residues.
  • FIGURE 2 Schematic of MATES technology.
  • Reaction partner bearing a reactive target binding moiety a reactive group connected via a linker to a MOI specifically binds to the target (antibody).
  • the reactive group attaches at an antibody lysine residue, releasing the target binding moiety.
  • FIGURE S Chemical diagram of reactive target moiety specifically binding to an antibody following reaction of its reactive group with an antibody heavy chain lysine.
  • the reactive target binding moiety comprise a cyclic peptide target binding moiety, a fluorophenyl reactive moiety, a PEG linker, and a peptide MOI.
  • FIGURE 4 Standard curves for residual payload analysis (FIG. 4A) for Cmp. 1101, residual reagent analysis (FIG. 4B) for Cmp. 1101, and residual uABT analysis (FIG. 4C).
  • FIGURE 5 HPLC traces and peak areas for Cmp. 1101 payload analysis.
  • FIGURE 6 HPLC traces and peak areas for Cmp. 1101 residual reagent analysis.
  • FIGURE 7 HPLC traces for uABT analysis. Successive traces are shown for payloads from 14 pM (largest peak), 7 pM, 3.5 pM, 1.75 pM, and 0.7 pM.
  • the term “a” or “an” may be understood to mean “at least one”; (ii) the term “or” may be understood to mean “and/or”; (iii) the terms “comprising”, “comprise”, “including” (whether used with “not limited to” or not), and “include” (whether used with “not limited to” or not) may be understood to encompass itemized components or steps whether presented by themselves or together with one or more additional components or steps; (iv) the open ended transitional phrase “comprising” (and other opened ended transitional phrases such as “comprise,” “including,” and “include”) encompass and include the intermediate and closed ended phrases “consisting essentially of” and “consisting of” and unless indicated otherwise by the context a claim with an open ended phrase can be amended to have an intermediate or closed transitional phrase (v) the term “another” may be understood to mean at least an additional/second one or more; (v) the terms "about”
  • Agent may be used to refer to a compound or entity of any chemical class including, for example, a polypeptide, nucleic acid, saccharide, lipid, small molecule, metal, or combination or complex thereof.
  • the term may be utilized to refer to an entity that is or comprises a cell or organism, or a fraction, extract, or component thereof.
  • the term may be used to refer to a natural product in that it is found in and/or is obtained from nature.
  • the term may be used to refer to one or more entities that is man-made in that it is designed, engineered, and/or produced through action of the hand of man and/or is not found in nature.
  • an agent may be utilized in isolated or pure form; in some embodiments, an agent may be utilized in crude form.
  • potential agents may be provided as collections or libraries, for example that may be screened to identify or characterize active agents within them.
  • the term "agent" may refer to a compound or entity that is or comprises a polymer; in some cases, the term may refer to a compound or entity that comprises one or more polymeric moieties.
  • the term "agent" may refer to a compound or entity that is not a polymer and/or is substantially free of any polymer and/or of one or more particular polymeric moieties. In some embodiments, the term may refer to a compound or entity that lacks or is substantially free of any polymeric moiety.
  • an agent is a compound (e.g., a small molecule, a protein, a nucleic acid, etc.). In some embodiments, an agent is a mono-, bi- or polyvalent moiety of a compound (e.g., by removing one (for a monovalent moiety) or more (for a bi- or polyvalent moiety) hydrogen atoms and/or other monovalent groups from a compound).
  • Aliphatic "Aliphatic" means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a substituted or unsubstituted monocyclic, bicyclic, or polycyclic hydrocarbon ring that is completely saturated or that contains one or more units of unsaturation (but not aromatic), or combinations thereof.
  • aliphatic groups contain 1-50 aliphatic carbon atoms. In some embodiments, aliphatic groups contain 1- 20 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-10 aliphatic carbon atoms.
  • aliphatic groups contain 1-9 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-8 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-7 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-6 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-5 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1, 2, 3, or 4 aliphatic carbon atoms.
  • Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
  • Alkenyl means an aliphatic group, as defined herein, having one or more double bonds.
  • Alkyl is given its ordinary meaning in the art and may include saturated aliphatic groups, including straight-chain alkyl groups, branched-chain alkyl groups, cycloalkyl (alicyclic) groups, alkyl substituted cycloalkyl groups, and cycloalkyl substituted alkyl groups.
  • an alkyl has 1-100 carbon atoms.
  • a straight chain or branched chain alkyl has about 1-20 carbon atoms in its backbone (e.g., C1-C20 for straight chain, C2-C20 for branched chain), and alternatively, about 1-10.
  • cycloalkyl rings have from about 3-10 carbon atoms in their ring structure where such rings are monocyclic, bicyclic, or polycyclic, and alternatively about 5, 6 or 7 carbons in the ring structure.
  • an alkyl group may be a lower alkyl group, wherein a lower alkyl group comprises 1-4 carbon atoms (e.g., C1-C4 for straight chain lower alkyls).
  • Alkynyl is an aliphatic group, as defined herein, having one or more triple bonds.
  • Aryl used alone or as part of a larger moiety as in “aralkyl,” “aralkoxy,” or “aryloxyalkyl,” refers to monocyclic, bicyclic or polycyclic ring systems having a total of five to thirty ring members, wherein at least one ring in the system is aromatic.
  • an aryl group is a monocyclic, bicyclic or polycyclic ring system having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic, and wherein each ring in the system contains 3 to 7 ring members.
  • an aryl group is a biaryl group.
  • aryl may be used interchangeably with the term “aryl ring.”
  • aryl refers to an aromatic ring system which includes, but is not limited to, phenyl, biphenyl, naphthyl, binaphthyl, anthracyl and the like, which may bear one or more substituents.
  • aryl is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.
  • Antibody refers to a polypeptide that includes canonical immunoglobulin sequence elements sufficient to confer specific binding to a particular target antigen. As is known in the art, intact antibodies as produced in nature are approximately 150 kD tetrameric agents comprised of two identical heavy chain polypeptides (about 50 kD each) and two identical light chain polypeptides (about 25 kD each) that associate with each other into what is commonly referred to as a "Y-shaped" structure.
  • Each heavy chain is comprised of at least four domains (each about 110 amino acids long)- an amino-terminal variable (VH) domain (located at the tips of the Y structure), followed by three constant domains: CHI, CH2, and the carboxy-terminal CH3 (located at the base of the Y's stem).
  • a short region known as the "switch" connects the heavy chain variable and constant regions.
  • the "hinge” connects CH2 and CH3 domains to the rest of the antibody. Two disulfide bonds in this hinge region connect the two heavy chain polypeptides to one another in an intact antibody.
  • Each light chain is comprised of two domains - an amino-terminal variable (VL) domain, followed by a carboxy-terminal constant (CL) domain, separated from one another by another "switch".
  • Intact antibody tetramers are comprised of two heavy chain-light chain dimers in which the heavy and light chains are linked to one another by a single disulfide bond; two other disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are connected to one another and the tetramer is formed.
  • Naturally produced antibodies are also glycosylated, typically on the CH2 domain.
  • Each domain in a natural antibody has a structure characterized by an "immunoglobulin fold" formed from two beta sheets (e.g., 3-, 4-, or 5- stranded sheets) packed against each other in a compressed antiparallel beta barrel.
  • Each variable domain contains three hypervariable loops known as "complement determining regions” (CDR1, CDR2, and CDR3) and four somewhat invariant "framework” regions (FR1, FR2, FR3, and FR4).
  • CDR1, CDR2, and CDR3 complement determining regions
  • FR1, FR2, FR3, and FR4 somewhat invariant "framework” regions
  • the FR regions form the beta sheets that provide the structural framework for the domains
  • the CDR loop regions from both the heavy and light chains are brought together in three-dimensional space so that they create a single hypervariable antigen binding site located at the tip of the Y structure.
  • the Fc region of naturally occurring antibodies binds to elements of the complement system, and to receptors on effector cells, including for example effector cells that mediate cytotoxicity.
  • antibodies produced and/or utilized in accordance with the present disclosure include glycosylated Fc domains, including Fc domains with modified or engineered such glycosylation.
  • any polypeptide or complex of polypeptides that includes sufficient immunoglobulin domain sequences as found in natural antibodies can be referred to and/or used as an "antibody", whether such polypeptide is naturally produced (e.g., generated by an organism reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other artificial system or methodology.
  • an antibody is polyclonal; in some embodiments, an antibody is monoclonal. In some embodiments, an antibody has constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies. In some embodiments, antibody sequence elements are humanized, primatized, chimeric, etc., as is known in the art. Moreover, the term "antibody” as used herein, can refer in appropriate embodiments (unless otherwise stated or clear from context) to any of the art-known or developed constructs or formats for utilizing antibody structural and functional features in alternative presentation.
  • an antibody utilized in accordance with the present disclosure is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi- specific antibodies (e.g., Zybodies ® , additional bi- or multi- specific antibodies described in Ulrich Brinkmann & Roland E.
  • antibodies may have enhanced Fc domains.
  • antibodies may comprise one or more unnatural amino acid residues.
  • an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
  • an antibody is an afucosylated antibody.
  • an antibody is conjugated with another entity.
  • an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload [e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc.], or other pendant group [e.g., poly-ethylene glycol, etc.]).
  • Comparable refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison there between so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
  • comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features.
  • Cycloaliphatic The term “cycloaliphatic,” “carbocycle,” “carbocyclyl,”
  • Carbocyclic radical and “carbocyclic ring,” are used interchangeably, and refer to saturated or partially unsaturated, but non-aromatic, cyclic aliphatic monocyclic, bicyclic, or polycyclic ring systems, as described herein, having, unless otherwise specified, from 3 to 30 ring members.
  • Cycloaliphatic groups include, without limitation, cyclopropyl, cyclobutyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, norbornyl, adamantyl, and cyclooctadienyl.
  • a cycloaliphatic group has 3-6 carbons.
  • a cycloaliphatic group is saturated and is cycloalkyl.
  • cycloaliphatic may also include aliphatic rings that are fused to one or more aromatic or nonaromatic rings, such as decahydronaphthyl ortetrahydronaphthyl.
  • a cycloaliphatic group is bicyclic.
  • a cycloaliphatic group is tricyclic.
  • a cycloaliphatic group is polycyclic. In some embodiments,
  • cycloaliphatic refers to C3-C6 monocyclic hydrocarbon, or Cs-Cio bicyclic or polycyclic hydrocarbon, that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule, or a C9-C16 polycyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule.
  • Haloalkyl and Haloalkoxy refers to a C 1-4 straight or branched alkyl group that is substituted with one or more halogen atoms, examples are trifluoromethyl, difluoromethyl, and dichloromethyl.
  • haloalkoxy is a haloalkyl group attached to the group it substitutes via a an -O- linkage. Examples include trifluoromethoxy and difluoromethoxy.
  • Heteroaliphatic is given its ordinary meaning in the art and refers to aliphatic groups as described herein in which one or more carbon atoms are independently replaced with one or more heteroatoms (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like). In some embodiments, one or more units selected from C, CH, CH 2 , and CH 3 are independently replaced by one or more heteroatoms (including oxidized and/or substituted forms thereof). In some embodiments, a heteroaliphatic group is heteroalkyl. In some embodiments, a heteroaliphatic group is heteroalkenyl.
  • Heteroalkyl The term "heteroalkyl” is given its ordinary meaning in the art and refers to alkyl groups as described herein in which one or more carbon atoms are independently replaced with one or more heteroatoms (e.g., oxygen, nitrogen, sulfur, silicon, phosphorus, and the like).
  • heteroalkyl groups include, but are not limited to, alkoxy, polyethylene glycol)-, alkyl-substituted amino, tetrahydrofuranyl, piperidinyl, morpholinyl, etc.
  • Heteroaryl The terms "heteroaryl” used alone or as part of a larger moiety, e.g.,
  • heteroarylkyl refers to monocyclic, bicyclic or polycyclic ring systems having a total of five to thirty ring members, wherein at least one ring in the system is aromatic and at least one aromatic ring atom is a heteroatom.
  • a heteroaryl group is a group having 5 to 10 ring atoms (i.e., monocyclic, bicyclic or polycyclic), in some embodiments 5, 6, 9, or 10 ring atoms.
  • a heteroaryl group has 6, 10, or 14 p electrons shared in a cyclic array; and having, in addition to carbon atoms, from one to five heteroatoms.
  • Heteroaryl groups include, without limitation, thienyl, furanyl, pyrrolyl, imidazolyl, pyrazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridyl, pyridazinyl, pyrimidinyl, pyrazinyl, indolizinyl, purinyl, naphthyridinyl, and pteridinyl.
  • a heteroaryl is a heterobiaryl group, such as bipyridyl and the like.
  • heteroaryl as used herein, also includes groups in which a heteroaromatic ring is fused to one or more aryl, cycloaliphatic, or heterocyclyl rings, where the radical or point of attachment is on the heteroaromatic ring.
  • Non-limiting examples include indolyl, isoindolyl, benzothienyl, benzofuranyl, dibenzofuranyl, indazolyl, benzimidazolyl, benzthiazolyl, quinolyl, isoquinolyl, cinnolinyl, phthalazinyl, quinazolinyl, quinoxalinyl, 4/-/— quinolizinyl, carbazolyl, acridinyl, phenazinyl, phenothiazinyl, phenoxazinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, and pyrido[2,3-b]-l,4-oxazin-3(4H)-one.
  • heteroaryl group may be monocyclic, bicyclic or polycyclic.
  • heteroaryl may be used interchangeably with the terms “heteroaryl ring,” “heteroaryl group,” or “heteroaromatic,” any of which terms include rings that are optionally substituted.
  • heteroarylkyl refers to an alkyl group substituted by a heteroaryl group, wherein the alkyl and heteroaryl portions independently are optionally substituted.
  • Heteroatom means an atom that is not carbon or hydrogen.
  • a heteroatom is boron, oxygen, sulfur, nitrogen, phosphorus, or silicon (including various forms of such atoms, such as oxidized forms (e.g., of nitrogen, sulfur, phosphorus, or silicon), quaternized form of a basic nitrogen or a substitutable nitrogen of a heterocyclic ring (for example, N as in 3,4-dihydro-2/-/-pyrrolyl), NH (as in pyrrolidinyl) or NR + (as in N-substituted pyrrolidinyl) etc.).
  • a heteroatom is oxygen, sulfur or nitrogen.
  • Heterocycle As used herein, the terms “heterocycle,” “heterocyclyl,”
  • heterocyclic radical and “heterocyclic ring” are used interchangeably and refer to a monocyclic, bicyclic or polycyclic ring moiety (e.g., 3-30 membered) that is saturated or partially unsaturated and has one or more heteroatom ring atoms.
  • a heterocyclyl group is a stable 5- to 7-membered monocyclic or 7- to 10-membered bicyclic heterocyclic moiety that is either saturated or partially unsaturated, and having, in addition to carbon atoms, one or more, preferably one to four, heteroatoms, as defined above.
  • nitrogen includes substituted nitrogen.
  • the nitrogen may be N (as in 3,4-dihydro-2/-/-pyrrolyl), NH (as in pyrrolidinyl), or + NR (as in /V-substituted pyrrolidinyl).
  • a heterocyclic ring can be attached to its pendant group at any heteroatom or carbon atom that results in a stable structure and any of the ring atoms can be optionally substituted.
  • saturated or partially unsaturated heterocyclic radicals include, without limitation, tetrahydrofuranyl, tetrahydrothienyl, pyrrolidinyl, piperidinyl, pyrrolinyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, oxazolidinyl, piperazinyl, dioxanyl, dioxolanyl, diazepinyl, oxazepinyl, thiazepinyl, morpholinyl, and quinuclidinyl.
  • heterocycle refers to an alkyl group substituted by a heterocyclyl, wherein the alkyl and heterocyclyl portions independently are optionally substituted.
  • compounds of the disclosure may contain optionally substituted and/or substituted moieties.
  • substituted whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
  • an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
  • an optionally substituted group is unsubstituted.
  • Suitable monovalent substituents on R° are independently halogen, -(CH 2 )O-2R ⁇ , -(haloR*), -(CH 2 ) 0-2 OH, -(CH 2 )O-20R ⁇ , -(CH 2 )O- 2 CH(OR*) 2 ; -O(haloR*), -CN, -N 3 , -(CH 2 )O- 2 C(O)R ⁇ , -(CH 2 )O- 2 C(O)OH, -(CH 2 )O- 2 C(O)OR ⁇ , -(CH 2 )O- 2 SR ⁇ , -(CH 2 )O- 2 SH, -(CH 2 )O- 2 NH 2 , -(CH 2 )O- 2 NHR ⁇ , -(CH 2 )O- 2 NR* 2 , -N0 2 ,
  • Suitable divalent substituents that are bound to vicinal substitutable carbons of an "optionally substituted” group include: -O(CR * 2 ) 2-3 0- wherein each independent occurrence of R * is selected from hydrogen, Ci- 6 aliphatic which may be substituted as defined below, and an unsubstituted 5-6-membered saturated, partially unsaturated, and aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • Suitable substituents on the aliphatic group of R * are independently halogen,
  • each R* is unsubstituted or where preceded by "halo" is substituted only with one or more halogens, and is independently C 1-4 aliphatic, -CH 2 Ph, -O(CH 2 )o-iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • suitable substituents on a substitutable nitrogen are independently -R ⁇ , -NR ⁇ 2 , -C(O)R ⁇ , -C(O)0R ⁇ , -C(O)C(O)R ⁇ , -C(O)CH 2 C(O)R ⁇ , -S(O) 2 R ⁇ , -S(O) 2 NR ⁇ 2 , -C(S)NR ⁇ 2 , -C(NH)NR ⁇ 2 , or -N(R ⁇ )S(O) 2 R ⁇ ; wherein each R ⁇ is independently hydrogen, Ci- 6 aliphatic which may be substituted as defined below, unsubstituted -OPh, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur, or, notwithstanding the definition above, two independent occurrence
  • Suitable substituents on the aliphatic group of R ⁇ are independently halogen,
  • each R* is unsubstituted or where preceded by "halo" is substituted only with one or more halogens, and is independently C aliphatic, -CH Ph, -O(CH 2 )o-iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, and sulfur.
  • Partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
  • the term “partially unsaturated” is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
  • composition refers to an active agent, formulated together with one or more pharmaceutically acceptable carriers.
  • an active agent is present in unit dose amount appropriate for administration in a therapeutic regimen that shows a statistically significant probability of achieving a predetermined therapeutic effect when administered to a relevant population.
  • compositions may be specially formulated for administration in solid or liquid form, including those adapted for the following: oral administration, for example, drenches (aqueous or non-aqueous solutions or suspensions), tablets, e.g., those targeted for buccal, sublingual, and systemic absorption, boluses, powders, granules, pastes for application to the tongue; parenteral administration, for example, by subcutaneous, intramuscular, intravenous or epidural injection as, for example, a sterile solution or suspension, or sustained-release formulation; topical application, for example, as a cream, ointment, or a controlled-release patch or spray applied to the skin, lungs, or oral cavity; intravaginally or intrarectally, for example, as a pessary, cream, or foam; sublingually; ocularly; transdermally; or nasally, pulmonary, and to other mucosal surfaces.
  • oral administration for example, drenches (aqueous or non-aqueous solutions or suspension
  • compositions and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • compositions or vehicles such as a liquid or solid filler, diluent, excipient, or solvent encapsulating material, involved in carrying or transporting the subject compound from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as corn starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; glycols, such as propylene glycol; polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; esters, such as ethyl oleate and ethyl laurate; agar; buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ring
  • compositions that are appropriate for use in pharmaceutical contexts, i.e., salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, lists of pharmaceutically acceptable salts may be found in G. Steffen Paulekuhn, et al, Journal of Medicinal Chemistry 2007, 50, 6665 and Handbook of Pharmaceutical Salts: Properties,
  • pharmaceutically acceptable salt include, but are not limited to, nontoxic acid addition salts, which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • nontoxic acid addition salts which are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • pharmaceutically acceptable salts include, but are not limited to, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palm
  • a provided compound comprises one or more acidic groups and a pharmaceutically acceptable salt is an alkali, alkaline earth metal, or ammonium (e.g., an ammonium salt of N(R)3, wherein each R is independently defined and described in the present disclosure) salt.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • a pharmaceutically acceptable salt is a sodium salt.
  • a pharmaceutically acceptable salt is a potassium salt.
  • a pharmaceutically acceptable salt is a calcium salt.
  • pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl having from 1 to 6 carbon atoms, sulfonate and aryl sulfonate.
  • a provided compound comprises more than one acid groups.
  • a pharmaceutically acceptable salt, or generally a salt, of such a compound comprises two or more cations, which can be the same or different.
  • all ionizable hydrogen e.g., in an aqueous solution with a pKa no more than about 11, 10, 9, 8, 7,
  • Protecting group is well known in the art and includes those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference. Also included are those protecting groups specially adapted for nucleoside and nucleotide chemistry described in Current Protocols in Nucleic Acid Chemistry, edited by Serge L. Beaucage et al. 06/2012, the entirety of Chapter 2 is incorporated herein by reference.
  • Suitable amino-protecting groups include methyl carbamate, ethyl carbamate, 9- fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9— (2,7— dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10- tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2— trimethylsilylethyl carbamate (Teoc), 2- phenylethyl carbamate (hZ), l-(l-adamantyl)-l-methylethyl carbamate (Adpoc), 1,1- dimethyl-2-haloethyl carbamate,
  • Suitably protected carboxylic acids further include, but are not limited to, silyl— , alkyl-, alkenyl-, aryl-, and arylalkyl-protected carboxylic acids.
  • suitable silyl groups include trimethylsilyl, triethylsilyl, t-butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and the like.
  • suitable alkyl groups include methyl, benzyl, p- methoxybenzyl, 3,4-dimethoxybenzyl, trityl, t-butyl, tetrahydropyran-2-yl.
  • suitable alkenyl groups include allyl.
  • suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl.
  • suitable arylalkyl groups include optionally substituted benzyl (e.g., p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O- nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p-cyanobenzyl), and 2- and 4- picolyl.
  • Suitable hydroxyl protecting groups include methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p- AOM), guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2- methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl, 2- (trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP), 4- methoxyl,
  • the protecting groups include methylene acetal, ethylidene acetal, 1-t-butylethylidene ketal, 1-phenylethylidene ketal, (4- methoxyphenyl)ethylidene acetal, 2,2,2-trichloroethylidene acetal, acetonide, cyclopentylidene ketal, cyclohexylidene ketal, cycloheptylidene ketal, benzylidene acetal, p-methoxybenzylidene acetal, 2,4-dimethoxybenzylidene ketal, 3,4-dimethoxybenzylidene acetal, 2-nitrobenzylidene acetal, methoxymethylene acetal, ethoxymethylene acetal, dimethoxymethylene ortho ester, 1-methoxyethylidene ortho ester, 1-methoxyethylidene ortho ester
  • a hydroxyl protecting group is acetyl, t-butyl, t- butoxymethyl, methoxymethyl, tetrahydropyranyl, 1 -ethoxyethyl, 1 -(2-chloroethoxy)ethyl, 2- trimethylsilylethyl, p-chlorophenyl, 2,4-dinitrophenyl, benzyl, benzoyl, p-phenylbenzoyl, 2,6- dichlorobenzyl, diphenylmethyl, p-nitrobenzyl, triphenylmethyl (trityl), 4,4'-dimethoxytrityl, trimethylsilyl, triethylsilyl, t-butyldimethylsilyl, t-butyldiphenylsilyl, triphenylsilyl, triisopropylsilyl, benzoylformate, chloroacetyl, t-butyl, t-
  • each of the hydroxyl protecting groups is, independently selected from acetyl, benzyl, t- butyldimethylsilyl, t-butyldiphenylsilyl and 4,4'-dimethoxytrityl.
  • the hydroxyl protecting group is selected from the group consisting of trityl, monomethoxytrityl and 4,4'- dimethoxytrityl group.
  • a phosphorous linkage protecting group is a group attached to the phosphorous linkage (e.g., an internucleotidic linkage) throughout oligonucleotide synthesis.
  • a protecting group is attached to a sulfur atom of an phosphorothioate group.
  • a protecting group is attached to an oxygen atom of an internucleotide phosphorothioate linkage.
  • a protecting group is attached to an oxygen atom of the internucleotide phosphate linkage.
  • a protecting group is 2- cyanoethyl (CE or Cne), 2-trimethylsilylethyl, 2-nitroethyl, 2-sulfonylethyl, methyl, benzyl, o- nitrobenzyl, 2-(p-nitrophenyl)ethyl (NPE or Npe), 2-phenylethyl, 3-(N-tert-butylcarboxamido)-l- propyl, 4-oxopentyl, 4-methylthio-l-butyl, 2-cyano-l,l-dimethylethyl, 4-/V-methylaminobutyl, 3- (2-pyridyl)-l-propyl, 2-[/V-methyl-/V-(2-pyridyl)]aminoethyl, 2-(/V-formyl,/V-methyl)aminoethyl, or 4-[/V-methyl-/V-(2,2,2-trifluoroacetyl)a
  • Subject refers to any organism to which a compound or composition is administered in accordance with the present disclosure e.g., for experimental, diagnostic, prophylactic and/or therapeutic purposes. Typical subjects include animals (e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.) and plants. In some embodiments, a subject is a human. In some embodiments, a subject may be suffering from and/or susceptible to a disease, disorder and/or condition.
  • animals e.g., mammals such as mice, rats, rabbits, non-human primates, and humans; insects; worms; etc.
  • a subject is a human.
  • a subject may be suffering from and/or susceptible to a disease, disorder and/or condition.
  • the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
  • One of ordinary skill in the art will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result.
  • the term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and/or chemical phenomena.
  • Therapeutic agent in general refers to any agent that elicits a desired effect (e.g., a desired biological, clinical, or pharmacological effect) when administered to a subject.
  • a desired effect e.g., a desired biological, clinical, or pharmacological effect
  • an agent is considered to be a therapeutic agent if it demonstrates a statistically significant effect across an appropriate population.
  • an appropriate population is a population of subjects suffering from and/or susceptible to a disease, disorder or condition.
  • an appropriate population is a population of model organisms.
  • an appropriate population may be defined by one or more criterion such as age group, gender, genetic background, preexisting clinical conditions, prior exposure to therapy.
  • a therapeutic agent is a substance that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms or features of a disease, disorder, and/or condition in a subject when administered to the subject in an effective amount.
  • a "therapeutic agent” is an agent that has been or is required to be approved by a government agency before it can be marketed for administration to humans.
  • a "therapeutic agent” is an agent for which a medical prescription is required for administration to humans.
  • a therapeutic agent is a compound described herein.
  • Therapeutically effective amount means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that elicits a desired biological response when administered as part of a therapeutic regimen.
  • a therapeutically effective amount of a substance is an amount that is sufficient, when administered to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
  • the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
  • the effective amount of compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
  • a therapeutically effective amount is administered in a single dose; in some embodiments, multiple unit doses are required to deliver a therapeutically effective amount.
  • Treat The term "treat,” “treatment,” or “treating” refers to any method used to partially or completely alleviate, ameliorate, relieve, inhibit, prevent, delay onset of, reduce severity of, and/or reduce incidence of one or more symptoms or features of a disease, disorder, and/or condition.
  • Treatment may be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition. In some embodiments, treatment may be administered to a subject who exhibits only early signs of the disease, disorder, and/or condition, for example for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
  • Unsaturated means that a moiety has one or more units of unsaturation.
  • structures depicted herein are also meant to include all isomeric (e.g., enantiomeric, diastereomeric, and geometric (or conformational)) forms of the structure; for example, the R and S configurations for each asymmetric center, Z and E double bond isomers, and Z and E conformational isomers. Therefore, single stereochemical isomers as well as enantiomeric, diastereomeric, and geometric (or conformational) mixtures of the present compounds are within the scope of the present disclosure. Unless otherwise stated, all tautomeric forms of the compounds are within the scope of the present disclosure.
  • structures depicted herein are also meant to include compounds that differ only in the presence of one or more isotopically enriched atoms.
  • compounds having the present structures including the replacement of hydrogen by deuterium or tritium, or the replacement of a carbon by a 13 C- or 14 C-enriched carbon are within the scope of the present disclosure.
  • Such compounds are useful, for example, as analytical tools, as probes in biological assays, or as therapeutic agents in accordance with the present disclosure.
  • the present disclosure provides technologies that can conjugate moieties of interest to targets with high efficiency, high selectivity, and/or reduced side transformations (e.g., due to numbers of chemical reactions and/or conditions/types of chemical reactions).
  • the present disclosure provides useful reagents and methods for conjugation, and provide product compositions with enhanced homogeneity (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, or 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more fold, increase of modification/conjugation at one or more desired sites of target agents, and/or 10%, 20%, 30%,
  • the present disclosure provides a compound of formula R-l or a salt thereof as described herein.
  • a compound of formula R-l or a salt thereof is useful for introducing a moiety of interest to a target in one step of reaction.
  • the present disclosure provides agents of formula P-l or P-ll, or a salt thereof.
  • a product composition comprise a plurality of agents having the structure of formula P-l or P-ll, or a salt thereof, wherein the product composition has a higher level of homogeneity of said agents compared to a reference product composition (e.g., a product composition from a method in which a compound of formula R-l or a salt thereof is replaced with a compound which has the same structure as the compound of formula R-l or a salt thereof except that each target binding moiety is replaced with -H).
  • a reference product composition e.g., a product composition from a method in which a compound of formula R-l or a salt thereof is replaced with a compound which has the same structure as the compound of formula R-l or a salt thereof except that each target binding moiety is replaced with -H.
  • the present disclosure provides a method, comprising steps of:
  • a reaction partner comprising: a first group comprising a target binding moiety that binds to a target agent, a reactive group; a moiety of interest that is or comprises MMAE; and optionally one or more linker moieties;
  • an agent comprising: a target agent moiety; a moiety of interest that is or comprises MMAE; and optionally one or more linker moieties.
  • MMAE Monomethyl auristatin E
  • CAS Reg. No. 474645-27-7 is a compound having the chemical formula:
  • the target binding moiety binds specifically to the target agent and the reactive group reacts with specific sites of the target agent, such as specific lysine residues of a target agent antibody, such that the agent formed by the method comprises the target agent with MMAE attached, optionally via a linker, to the specific sites.
  • a reaction group is located between a first group and a moiety of interest, and is connected to a first group and a moiety of interest independently and optionally through a linker moiety.
  • a reaction partner is a compound of formula R-l or a salt thereof.
  • a first group is or comprises a LG group as described herein. In some embodiments, a first group is or comprises a LG group as described herein.
  • the disclosure provides a compound having the structure of formula R-l:
  • LG is a group comprising a target binding moiety that binds to a target agent
  • RG is a reactive group
  • L RM is a linker
  • MOI is a moiety of interest comprising monomethyl auristatin E (MMAE).
  • the disclosure provides a compound having the structure of formula R-l: LG-RG-L RM -MOI,
  • R LG is Ns — ' , R c -(Xaa)z-, a nucleic acid moiety, or a small molecule moiety; each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50; each R c is independently -L a -R'; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')
  • L LG is — L lg1 — -L LG1 -L LG2 - —
  • RG is -L RG1 -L RG2 - — L LG4 — L RG1 — L RG2 — -L LG3 -L LG4 -L RG1 -L RG2 - -L LG2 -L LG3 -L LG4 -L RG1 -L RG2 -' each of L LG1 , L LG2 , L LG3 , L LG4 , L RG1 , L RG2 , and L RM is independently L; each L is independently a covalent bond, or a bivalent optionally substituted, linear or branched Ci-100 group comprising one or more aliphatic moieties, aryl moieties, heteroaliphatic moieties each independently having 1-20 heteroatoms, heteroaromatic moieties each independently having 1-20 heteroatoms, or any combinations of any one or more of such moieties, wherein one or more methylene units of the group are optionally and independently replaced with Ci- 6 alkylene, Ci
  • MOI is a moiety of interest comprising monomethyl auristatin E (MMAE).
  • the present disclosure provides a method comprising steps of:
  • LG is a group comprising a target binding domain that binds to a target agent
  • RG is a reactive group
  • L RM is a linker
  • MOI is a moiety of interest that is or comprises MMAE; and 2) forming an agent having the structure of formula P-l:
  • P is a target agent moiety
  • L PM is a linker
  • MOI is a moiety of interest that is or comprises MMAE.
  • a target agent is an antibody.
  • a target agent is an IgG antibody.
  • the antibody can be an anti-CDBO monoclonal antibody such as brentuximab, or an anti nectin-4 antibody such as enfortumab.
  • a target is a protein, and the moiety of interest is conjugated at one or more lysine residues.
  • an agent of formula P-l or a salt thereof is an agent of formula P-ll or a salt thereof.
  • the present disclosure provides a method of manufacturing an agent having the structure of P-ll:
  • P-N is a protein agent moiety comprising a lysine residue
  • L PM is a linker; and MOI is a moiety of interest; the method comprising: contacting P-N with a reaction partner having a structure of formula R-l:
  • LG is a group comprising a protein-binding domain that binds to P-N, RG is a reactive group;
  • L RM is a linker; and MOI is a moiety of interest that is or comprises MMAE.
  • contacting is performed under conditions and for a time sufficient for the lysine residue N to react and form a bond with an atom of RG and release LG.
  • target agents are or comprise nucleic acids.
  • a target agent is or comprises a protein agent.
  • a target agent is a protein agent.
  • a target agent is a natural protein in a cell, tissue, organ or organism.
  • a target agent is an endogenous protein.
  • a target agent is an exogenous protein.
  • a target agent is a manufactured protein, e.g., a protein produced using various biotechnologies.
  • a target agent is an antibody agent.
  • a target agent is an antibody useful as therapeutics. Various such antibodies are known in the art and can be utilized as target agents.
  • an antibody is a monoclonal antibody.
  • an antibody is a polyclonal antibody. In some embodiments, an antibody is an IgG antibody. In some embodiments, an antibody is IVIG (in some embodiments, pooled from healthy donors). In some embodiments, a protein comprises a Fc region. In some embodiments, an antibody comprises a Fc region. In some embodiments, a Fc region comprises a single heavy chain or a fragment thereof. In some embodiments, a Fc region comprises two heavy chains or fragments thereof. In some embodiments, an antibody is a human antibody. In some embodiments, an antibody is a chimeric antibody. In some embodiments, an antibody is a humanized antibody. In some embodiments, an antibody is a mouse antibody.
  • digestions are performed, e.g., enzyme digestions using IdeZ, IdeS, etc., so that certain regions of antibodies (e.g., Fab) are removed to provide compositions with improved homogeneity for characterization (e.g., by MS).
  • an antibody is a therapeutic antibody, e.g., a FDA- approved antibody for therapeutic uses.
  • a therapeutic antibody is useful for treating cancer.
  • an antibody is adalimumab, alemtuzumab, atezolizumab, avelumab, basiliximab, brentuximab, enfortumab, ipilimumab, cetuximab, daratumumab, dinutuximab, elotuzumab, ibritumomab tiuxetan, imgatuzumab, infliximab, necitumumab, obinutuzumab, ofatumumab, pertuzumab, reslizumab, rituximab, trastuzumab, mogamulizumab, AMP-224, FS-102, GSK-2857916, A
  • an antibody is siltuximab, daclizumab, palivizumab, omalizumab, efalizumab, bevacizumab, natalizumab, tocilizumab, eculizumab, vedolizumab, pembrolizumab, mepolizumab, ixekizumab, panitumumab, golimumab, ustekinumab, canakinumab, denosumab, belimumab, raxibacumab, ramucirumab, nivolumab, secukinumab, evolocumab, alirocumab, brodalumab, or olaratumab.
  • an antibody is brentuximab or enfortumab. In some embodiments, an antibody is cetuximab. In some embodiments, a provided compound or agent comprising an antibody agent moiety is useful for treating a condition, disorder or disease that may be treated by the antibody agent.
  • Antibodies may be prepared in a number of technologies in accordance with the present disclosure.
  • antibodies may have engineered structures compared to natural immunoglobulins.
  • antibodies may comprise certain tags for purification, identification, assessment, etc.
  • antibodies may contain fragments (e.g., CDR and/or Fc, etc.) and not full immunoglobulins.
  • an amino acid residue may not be at the exact numbered site but may be at a site that corresponds to that numbered site per, e.g., EU numbering and/or sequence homology (e.g., homologues of the same or different species).
  • target agents are or comprise native antibody agents.
  • target agents are or comprise engineered antibody agents.
  • target agents, e.g., antibodies comprise no engineered unnatural amino acid residues.
  • the present disclosure provides compounds each independently comprising a first group comprising a target binding moiety that binds to a target agent, a reactive group, a moiety of interest, and optionally one or more linker moieties linking such groups/moieties.
  • a compound is useful as reaction partners for conjugating moieties of interest to targets.
  • the present disclosure provides compounds for conjugating moieties of interest to targets, e.g., various proteins.
  • provided compounds each comprise a moiety of interest, a reactive group, a target binding moiety, and optionally one or more linker moieties (linkers) linking such moieties.
  • a target binding moiety is part of a leaving group that is released upon contacting such a compound with a target and reacting a reactive group of the compound with a reactive group of a target (e.g., -IMH2 of a Lys residue of a target protein).
  • a target e.g., -IMH2 of a Lys residue of a target protein.
  • a provided compound has the structure of formula R-l or a salt thereof:
  • LG is a group comprising a target binding moiety that binds to a target agent, RG is a reactive group;
  • L RM is a linker
  • MOI is a moiety of interest that is or comprises MMAE.
  • a first group is LG.
  • LG is or comprises a target binding moiety that can bind to a target agent, and optionally a linker moiety.
  • a moiety generally refers to a part of a molecule, e.g., in an ester RCOOR', the alcohol moiety is RO-.
  • a moiety of a compound e.g., a target agent, a protein agent, an antibody agent, etc.
  • a target binding moiety can bind to a target, optionally in a comparable fashion, as its corresponding target binding compound; in some embodiments, a target agent moiety maintains one or more desired structural features, properties, functions, and/or properties comparable to its corresponding target agent compound; in some embodiments, an antibody agent moiety maintains one or more desired structural features, properties, functions, and/or properties (e.g., 3-dimension structure, antigen specificity, antigen-binding capacity, and/or immunological functions, etc.) comparable to its corresponding antibody agent compound.
  • a moiety of a compound e.g., a target agent moiety, a protein agent moiety, an antibody agent moiety, etc.
  • a monovalent radical is formed by removing a monovalent part (e.g., hydrogen, halogen, another monovalent group like alkyl, aryl, etc.) from a compound.
  • a bivalent or polyvalent radical is formed by removing one or more monovalent (e.g., hydrogen, halogen, monovalent groups like alkyl, aryl, etc.), bivalent and/or polyvalent parts from a compound.
  • radicals are formed by removing hydrogen atoms.
  • a moiety is monovalent.
  • a moiety is bivalent.
  • a moiety is polyvalent. [0077]
  • LG is or comprises R LG -L lg -, wherein R LG is or comprises a target binding moiety, and L LG is L LG1 as described herein.
  • L LG is -L LG1 -L LG2 -, wherein each of L LG1 and L LG2 is independently as described herein.
  • L LG is — L LG1 — L LG2 — L LG3 — , wherein each of L LG1 , L LG2 and L LG3 is independently as described herein.
  • L LG is -L LG1 -L LG2 -L LG3 -L LG4 -, wherein each of L LG1 , L LG2 , L LG3 and L LG4 is independently as described herein.
  • L LG1 is bonded to R LG .
  • L LG1 is bonded to moiety of interest.
  • L LG is -L lg1 -, and a reactive group comprises L LG2 , L LG3 and L LG4 .
  • L LG is _L LGI _L LG2 _, anc
  • L LG is — L LG1 — L LG2 — L LG3 — , and a reactive group comprises L LG4 .
  • target binding moieties, first groups, and/or LG are released after reactions, e.g., after partner compounds react with target agents.
  • a first group is released after a reaction.
  • a target binding moiety is released after a reaction.
  • LG is released after a reaction.
  • a first group is released as part of a compound having the structure of LG-H or a salt thereof.
  • a target binding moiety is released as part of a compound having the structure of LG-H or a salt thereof.
  • LG is released as part of a compound having the structure of LG-H or a salt thereof.
  • a first group is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof.
  • a target binding moiety is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof.
  • a target binding moiety is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof, wherein R LG is or comprises the target binding moiety.
  • LG is released as part of a compound having the structure of R LG _
  • LG is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof, wherein LG is RLG_
  • LG is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof, wherein LG is R LG -
  • LG is released as part of a compound having the structure of R LG -L LG1 -L LG2 -L LG3 -L LG4 -H or a salt thereof, wherein LG is pLG_
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci-ioo group comprising one or more aliphatic moieties, aryl moieties, heteroaliphatic moieties each independently having 1-20 heteroatoms, heteroaromatic moieties each independently having 1-20 heteroatoms, or any combinations of any one or more of such moieties, wherein one or more methylene units of the group are optionally and independently replaced with Ci- 6 alkylene, Ci- 6 alkenylene, a bivalent Ci- 6 heteroaliphatic group having 1-5 heteroatoms, — C oC— t -Cy-, -C(R')2-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, — C(S)— , -C(NR')-, -C(O)N(R')-, -C(O)C(R
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched CMOO aliphatic or heteroaliphatic group 1-20 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with — CoC— > -Cy-, -C(R')2-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, — C(S)— , -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -C(O)S-, -C(O)0-, -P(
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci, C 2 , C3, C4, C5, C10, C15, C 2 o, C 2 s, C30, C40, C50, C60, Ci- 2 , Ci-5, Ci-10, Ci-15, Ci- 2 o, Ci-30, Ci-40, Ci-50, Ci-60, Ci-70, Ci-80, or Ci-90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with — CoC— ; -Cy-, -C(R')2-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci, C2, C3, C4, C5, C10, Cl5, C20, C25, C30, C40, C50, C60, Cl-2, Cl-5, Cl-10, Cl-15, Cl-20, Cl-30, Cl-40, Cl-50, Cl-60, Ci- 70 , Ci-80, or Ci- 90 aliphatic or heteroaliphatic group 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -CoC-, -Cy-, -C(R') 2 -, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci, C2, C3, C4, C5, C10, C15, C20, C25, C30, C40, C50, C60, Ci-2, Cl-5, Ci-io, Cl-15, Ci-20, Cl-30, Cl-40, Cl-50, Ci-60, Ci-70, Ci-80, or Ci-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with -O-, -N(R')-, -C(O)-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, amino acid residues, or -[(O-,
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci, C2, C3, C4, C5, C10, C15, C20, C25, C30, C40, C50, C60, C1-2, C1-5, Ci-10, Cl-15, Ci-20, Cl-30, Cl-40, Cl-50, Ci-60, Ci-70, Ci-80, or Ci-90 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with -O-, -N(R')-, -C(O)-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, or -[(-O-C(R)-,
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with -O-, -N(R')-, -C(O)-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -Cy-, or -[(-O-C(R') 2 -C(R') 2 -)n]-, wherein n is 1-10.
  • L is a covalent bond, or a bivalent optionally substituted, linear or branched Ci-10 aliphatic group, wherein one or more methylene units of the group are optionally and independently replaced with -O-, -N(R')-, -C(O)-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, or -[(-O-C(R') 2 -C(R') 2 -)n]-, wherein n is 1-10.
  • L comprises no -C(O)0-. In some embodiments, L comprises no -C(O)-N(R')-. In some embodiments, L comprises no -S-. In some embodiments, L comprises no -S-Cy-. In some embodiments, L comprises no -S-S-. In some embodiments, L does not contain one or more or any of -C(O)0-, -C(O)-N(R')-, -S-, and -S-S-. In some embodiments, L does not contain one or more or any of -C(O)0-,
  • L does not contain one or more or any of -C(O)0-, -S-, and -S-S-. In some embodiments, L does not contain one or more or any of -C(O)0-, -S-Cy-, and -S-S-. In some embodiments, L contains none of -C(O)0-, -S-, and -S-S-. In some embodiments, L contains none of -C(O)0-, -S-Cy-, and -S-S-. In some embodiments, L contains none of -C(O)0- and -S-S-.
  • each amino acid residue is independently a residue of an amino acid having the structure of formula A-l or a salt thereof. In some embodiments, each amino acid residue independently has the structure of -N(R al )-L al -C(R a2 )(R a3 )-L a2 -CO- or a salt form thereof. In some embodiments, each amino acid residue independently has the structure of -N(R al )-C(R a2 )(R a3 )-CO- or a salt form thereof.
  • L is a covalent bond. In some embodiments, L is not a covalent bond.
  • L LG1 is a covalent bond. In some embodiments, L LG1 is not a covalent bond. In some embodiments, L LG1 is or comprises -(CH 2 CH 2 O)n-. In some embodiments, L LG1 is or comprises -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L LG1 is -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted.
  • L LG1 is -(CH 2 ) 2 -O-(CH 2 CH 2 0)n-(CH 2 ) 2 -, wherein n is as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L LG1 is -(CH 2 )2-0-(CH 2 CH 2 0)n-(CH 2 )2-, wherein n is as described herein.
  • L LG1 is -CH 2 -. In some embodiments, L LG1 is -(Cbhh-. In some embodiments, L LG1 is -(CH 2 ) 2 -C(O)-. In some embodiments, L LG1 is -(CH 2 ) 2 -C(O)-NH-. In some embodiments, L LG1 is -(Chhb-. In some embodiments, L LG1 is -(ChhbNH-. In some embodiments, L LG1 is -(ChhbNH-CiO)-. In some embodiments, L LG1 is -C(O)-(CH 2 ) 3 NH-C(O)-.
  • L LG1 is -C(O)-(CH 2 ) 3 -. In some embodiments, L LG1 is -NH-C(O)-(CH 2 ) 3 -. In some embodiments, L LG1 is -NHC(O)-(CH 2 ) 3 NH-C(O)-. In some embodiments, a -CH 2 - is bonded to a target binding moiety.
  • L LG1 is -CH 2 CH 2 -O-CH 2 CH 2 -O-CH 2 CH 2 -. In some embodiments, L LG1 is -CH 2 CH 2 -O-CH 2 CH 2 -O-CH 2 CH 2 -C(O)-. In some embodiments, L LG1 is -CH 2 CH 2 -O-CH 2 CH 2 -O-CH 2 CH 2 -C(O)NH-. In some embodiments, L LG1 is -CH 2 CH 2 -O-CH 2 CH 2 -O-CH 2 CH 2 -C(O)NH-CH 2 -. In some embodiments, -CH 2 CH 2 - is bonded to a target binding moiety.
  • L LG1 is -(CH 2 CH 2 0)n-. In some embodiments, L LG1 is
  • L LG1 is -(CH 2 CH 2 0)n-CH 2 -CH 2 -.
  • L LG1 is -(CH 2 CH 2 0)n-CH 2 -CH 2 -C(O)-.
  • L LG1 is -(CH 2 CH 2 0) 2 -CH 2 -CH 2 -C(O)-.
  • L LG1 is -(CH 2 CH 2 0) 4 -CH 2 -CH 2 -C(O)-.
  • L LG1 is -(CH 2 CH 2 0) 8 -CH 2 -CH 2 -C(O)-.
  • -C(O)- is bonded to a target binding moiety.
  • L LG1 is -N(R')-. In some embodiments, L LG1 is -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)]n-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)]n-CH 2 CH 2 -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)]n-CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)]n-CH 2 CH 2 -NH-C(O)-. In some embodiments, n is 1.
  • n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, L LG1 is -NH-CH 2 CH 2 -O-. In some embodiments, L LG1 is -NH-CH 2 CH 2 -O- CH 2 CH 2 -. In some embodiments, L LG1 is -NH-CH 2 CH 2 -O- CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-CH 2 CH 2 -O- CH 2 CH 2 -NH-C(O)-.
  • L LG1 is -NH-[(-CH 2 CH 2 -O-)] 2 -. In some embodiments,
  • L LG1 is -NH-[(-CH 2 CH 2 -O-)] 2 -CH 2 CH 2 -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 2 -CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 2 -CH 2 CH 2 -NH-C(O)-.
  • L LG1 is -NH-[(-CH 2 CH 2 -O-)] 3 -. In some embodiments,
  • L LG1 is -NH-[(-CH 2 CH 2 -O-)] 3 -CH 2 CH 2 -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 3 -CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 3 -CH 2 CH 2 -NH-C(O)-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 4 -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)]4-CH 2 CH 2 -.
  • L LG1 is -NH-[(-CH 2 CH 2 -O-)] 4 -CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 4 -CH 2 CH 2 -NH-C(O)-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] S -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 5 -CH 2 CH 2 -. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 5 -CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 5 -CH 2 CH 2 -NH-. In some embodiments, L LG1 is -NH-[(-CH 2 CH 2 -O-)] 5 -CH 2 CH 2 -NH
  • L LG1 is -CH 2 -. In some embodiments, L lg1 is -CH 2 CH 2 -. In some embodiments, L LG1 is -CH 2 CH 2 NH-. In some embodiments, L LG1 is -CH 2 CH 2 NH-(CO)-. In some embodiments, -CH 2 - is bonded to a target binding moiety.
  • L LG1 is -CH 2 -. In some embodiments, L LG1 is -CH 2 C(O)-.
  • L LG1 is -CH 2 C(O)NH-. In some embodiments, L LG1 is -CH 2 (CO)NHCH 2 -.
  • -CH 2 -C(O)- is bonded to a target binding moiety at -CH 2 -.
  • L LG2 is a covalent bond. In some embodiments, L LG2 is not a covalent bond. In some embodiments, L LG2 is -N(R')C(O)-. In some embodiments, L LG2 is -NHC(O)-. In some embodiments, L LG2 is -(CH 2 )n-N(R')C(O)-, wherein -(CH 2 )n- is optionally substituted. In some embodiments, L LG2 is -(CH 2 )n-OC(O)-, wherein -(CH 2 )n- is optionally substituted.
  • L LG2 is -(CH 2 )n-OC(O)N(R')-, wherein -(CH 2 )n- is optionally substituted. In some embodiments, L LG2 is -(CH 2 )n-OC(O)NH-, wherein -(CH 2 )n- is optionally substituted. In some embodiments, n is 1-10, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, -(CH 2 )n- is substituted. In some embodiments, -(CH 2 )n- is unsubstituted.
  • L LG2 is -CH 2 N(CH 2 CH 2 CH 2 S(O) 2 0H)-C(O)-. In some embodiments, L LG2 is -C(O)-NHCH 2 -. In some embodiments, L LG2 is -C(O)-NHCH 2 CH 2 -. In some embodiments, L LG2 is -C(O)0-CH 2 -. In some embodiments, L LG2 is -NH-C(O)0-CH 2 -. In some embodiments, -C(O)- is bonded to L LG3 . In some embodiments, -N(R')-, -NH-, or an optionally substituted — CH 2 — unit (of optionally substituted -(CH 2 )n-) is bonded to L LG3 .
  • L LG2 is -N(R')-. In some embodiments, L LG2 is -N(R)-. In some embodiments, L LG2 is -NH-. [0093] In some embodiments, L LG2 is optionally substituted bivalent Ci- 6 aliphatic. In some embodiments, L LG2 is -CH 2 -. In some embodiments, L LG2 is -CH 2 IMH-. In some embodiments, L LG2 is -CH 2 NH-C(O)-. In some embodiments, L LG2 is -CH 2 NH-C(O)-CH 2 -.
  • L LG3 is or comprises an optionally substituted aryl ring. In some embodiments, L LG3 is or comprises an optionally substituted phenyl ring. In some embodiments, L LG3 is a phenyl ring substituted with one or more electron-withdrawing groups. As appreciated by those skilled in the art, various electron-withdrawing groups are known in the art and may be utilized in accordance with the present disclosure. In some embodiments, an electron-withdrawing group is halogen. In some embodiments, an electron-withdrawing group is -F. In some embodiments, it is -Cl. In some embodiments, it is -Br. In some embodiments, it is -I.
  • X is a heteroatom.
  • Y is a heteroatom.
  • each of X and Y is independently a heteroatom.
  • Y is O.
  • Y is S.
  • X is C.
  • X is N.
  • X is P.
  • X is S.
  • an electron-withdrawing group is -C(O)-L-R'. In some embodiments, an electron-withdrawing group is -C(O)-R'. In some embodiments, it is -NO2. In some embodiments, it is -S(O)-L-R'. In some embodiments, it is -S(O)-R'. In some embodiments, it is -S(O) 2 -L-R'. In some embodiments, it is -S(O) 2 -O-R'.
  • it is -S(O) 2 -N(R') 2 . In some embodiments, it is -P(O)(-L-R') 2 . In some embodiments, it is -P(O)(R') 2 . In some embodiments, it is -P(O)(OR') 2 . In some embodiments, it is -P(O)[N(R') 2 ] 2 .
  • L LG3 is -
  • L LG3a is bonded to L LG2
  • L LG3b is bonded to L LG4 .
  • L LG3a is a covalent bond. In some embodiments, L LG3a is
  • L LG3a is -C(O)0-CH 2 -, wherein -CH 2 - is substituted. In some embodiments, L LG3a is -C(O)0-CH 2 -, wherein -CH 2 - is unsubstituted.
  • a first group, a target binding moiety, and/or LG is released as part of a compound having the structure of R LG -L LG1 -L LG2 -H or a salt thereof.
  • L LG3b is an optionally substituted phenyl ring.
  • at least one substituent is an electron-withdrawing group as described herein.
  • L LG3 is ( RS ) s , wherein s is 0-4, each R s is independently halogen, -N0 2 , -L-R', -C(O)-L-R', -S(O)-L-R', -S(O) 2 -L-R', or -P(O)(-L-R') 2 .
  • Cl is bonded to L LG4 .
  • L LG3 is .
  • L LG3 is .
  • L LG3 is RS .
  • L LG3 is .
  • RS is a halogen-N0 2 , -L-R', -C(O)-L-R', -S(O)-L-R', -S(O) 2 -L-R', or -P(O)(-L-R') 2 .
  • Cl is bonded to L LG4 .
  • L LG3 is .
  • L LG3 is .
  • L LG3b is ( R ) s , wherein s is 0-4, each R s is independently halogen, -N0 2 , -L-R', -C(O)-L-R', -S(O)-L-R', -S(O) 2 -L-R', or -P(O)(-L-R') 2 .
  • Cl is bonded to L LG4 .
  • L LG3b is .
  • L LG3b is In some embodiments, some embodiments, some embodiments, L LG3b is . In some embodiments,
  • s is 0. In some embodiments, s is 1-4. In some embodiments, s is 1. In some embodiments, s is 2. In some embodiments, s is 3. In some embodiments, s is 4.
  • s is 1-4, and at least one R s is an electron-withdrawing group, e.g., an electron-withdrawing group described above. In some embodiments, at least one R s is -NO2. In some embodiments, at least one R s is -F. In some embodiments, each R s is independently an electron-withdrawing group. In some embodiments, each R s is -NO2. In some embodiments, each R s is -F.
  • an electron-withdrawing group or R s is at C2. In some embodiments, an electron-withdrawing group or R s is at C3. In some embodiments, an electron-withdrawing group or R s is at C4. In some embodiments, an electron-withdrawing group or R s is at C2 and C5.
  • L LG3 is . In some embodiments, L LG3 is , some embodiments, L LG3 is
  • L LG3 is . n some embodiments, L LG3 is In some embodiments, L LG3 is , . In some embodiments, L LG3b is , some embodiments, L LG3b is /V . In some embodiments, L LG3b is 3 ⁇ 4 F. In some embodiments, L LG3b is n some embodiments, L LG3b is . In some embodiments, L LG3b is
  • L LG3b is optionally substituted O .
  • the nitrogen atom is boned to L LG4 which is -O-.
  • the nitrogen atom is boned to L LG4 which is -O-, and -
  • -L LG4 -L RG1 -L RG2 - is -O-C(O)-. In some embodiments,
  • L LG4 — L RG1 — L RG2 — is -S-C(O)-.
  • -L LG4 -L RG1 -L RG2 - is -S-C(O)-.
  • L LG4 is a covalent bond. In some embodiments, L LG4 is not a covalent bond. In some embodiments, L LG4 is -O-. In some embodiments, L LG4 is -N(R')-. In some embodiments, L LG4 is -NH-. In some embodiments, L LG4 is -N(CH3)-. In some embodiments, L LG4 is -N(R')-, and L LG3 is -O-. In some embodiments, R' is optionally substituted Ci- 6 alkyl. In some embodiments, L LG4 is -S-. Target Binding Moieties
  • target binding moieties can be utilized in accordance with the present disclosure.
  • Various technologies are also available in the art for developing and assessing target binding moieties and can be utilized in accordance with the present disclosure.
  • a target binding moiety is or comprises a small molecule moiety. In some embodiments, a target binding moiety is or comprises a polymeric moiety. In some embodiments, a target binding moiety is or comprises nucleic acid or fragments thereof. In some embodiments, a target binding moiety is or comprises a peptide moiety. In some embodiments, a target binding moiety is a polypeptide moiety.
  • provided technologies comprise one and no more than one target binding moiety.
  • provided technologies comprise two or more target binding moieties.
  • provided compounds may comprise two or more target binding moieties that can bind to target antibody agents, a.
  • a target binding moiety is or comprises a small molecule moiety that can selectively bind to a target agent.
  • Small molecule binders to target agents including various protein agents are widely known in the art and can be utilized in accordance with the present disclosure.
  • a small molecule binder is or is a moiety of a therapeutic agent, e.g., a drug, an antibody-drug conjugate, etc.
  • a target binding moiety is a small molecule moiety.
  • a small molecule moiety has a molecular weight no more than 8000, 7000, 6000, 5000, 4000, 3000, 2000, 1500, 1000, 900, 800, 700, or 600.
  • a small molecule moiety has a molecular weight no more than 8000.
  • a small molecule moiety has a molecular weight no more than 7000.
  • a small molecule moiety has a molecular weight no more than 6000.
  • a small molecule moiety has a molecular weight no more than 5000.
  • a small molecule moiety has a molecular weight no more than 4000. In some embodiments, a small molecule moiety has a molecular weight no more than 3000. In some embodiments, a small molecule moiety has a molecular weight no more than 2000. In some embodiments, a small molecule moiety has a molecular weight no more than 1500. In some embodiments, a small molecule moiety has a molecular weight no more than 1000. In some embodiments, a small molecule moiety has a molecular weight no more than 900.
  • a target binding moiety is or comprises a peptide agent.
  • a target binding moiety is a peptide moiety.
  • a peptide moiety can either be linier or cyclic.
  • a target binding moiety is or comprises a cyclic peptide moiety.
  • Various peptide target binding moieties are known in the art and can be utilized in accordance with the present disclosure.
  • a target binding moiety is or comprises a peptide aptamer agent.
  • R LG is or comprises a target binding moiety. In some embodiments, R LG is or comprises a protein binding moiety. In some embodiments, R LG is or comprises an antibody binding moiety. In some embodiments, R LG is a target binding moiety. In some embodiments, R LG is a protein binding moiety. In some embodiments, R LG is an antibody binding moiety. c. Aptamer Agents
  • a target binding moiety is or comprises a nucleic acid agent. In some embodiments, a target binding moiety is or comprises an oligonucleotide moiety. In some embodiments, a target binding moiety is or comprises an aptamer agent.
  • Various aptamer agents are known in the art or can be readily developed using common technologies, and can be utilized in provided technologies in accordance with the present disclosure.
  • a target binding moiety is an antibody binding moiety.
  • Such target binding moieties are, among other things, for conjugating moieties of interest to antibody agents.
  • Antibody Binding Moieties are, among other things, for conjugating moieties of interest to antibody agents.
  • targets are antibody agents.
  • target binding moieties are antibody binding moieties.
  • provided compounds and/or agents comprise antibody binding moieties.
  • Various antibody binding moieties can be utilized in accordance with the present disclosure.
  • antibody binding moieties are universal antibody binding moieties which can bind to antibodies having different Fab regions and different specificity.
  • compounds comprising such antibody binding moieties may be utilized for conjugation with antibodies having different specificity.
  • antibody binding moieties of the present disclosure e.g., universal antibody binding moieties, bind to Fc regions.
  • binding of antibody binding moieties to Fc regions can happen at the same time as binding of Fc receptors, e.g., CD16a, to the same Fc regions (e.g., may at different locations/amino acid residues of the same Fc regions).
  • an Fc region upon binding of antibody binding moieties, e.g., those in provided agents, compounds, methods, etc., an Fc region can still interact with Fc receptors and perform one or more or all of its immune activities, including recruitment of immune cells (e.g., effector cells such as NK cells), and/or triggering, generating, encouraging, and/or enhancing immune system activities toward target cells, tissues, objects and/or entities, for example, antibody-dependent cell-mediated cytotoxicity (ADCC) and/or ADCP.
  • immune cells e.g., effector cells such as NK cells
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • an antibody binding moiety comprises one or more amino acid residues, each independently natural or unnatural.
  • a target binding moiety e.g., a protein binding moiety
  • each of R 1 , R 3 and R 5 is independently hydrogen or an optionally substituted group selected from Ci- 6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or:
  • R 1 and R 1' are optionally taken together with their intervening carbon atom to form a 3- 8 membered optionally substituted saturated or partially unsaturated spirocyclic carbocyclic ring or a 3-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;
  • R 3 and R 3' are optionally taken together with their intervening carbon atom to form a 3- 8 membered optionally substituted saturated or partially unsaturated spirocyclic carbocyclic ring or a 3-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur; an R 5 group and the R 5' group attached to the same carbon atom are optionally taken together with their intervening carbon atom to form a 3-8 membered optionally substituted saturated or partially unsaturated spirocyclic carbocyclic ring or a 3-8 membered saturated or partially unsaturated spirocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or two R 5 groups are optionally taken together with their intervening atoms to form a Ci- io optionally substituted bivalent straight or branched saturated or unsaturated hydrocarbon chain wherein 1-3 methylene units of the chain are independently and optionally replaced with
  • R 2 and R 1 are optionally taken together with their intervening atoms to form a 4-8 membered, optionally substituted saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;
  • R 4 and R 3 are optionally taken together with their intervening atoms to form a 4-8 membered optionally substituted saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or an R 6 group and its adjacent R 5 group are optionally taken together with their intervening atoms to form a 4-8 membered optionally substituted saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur;
  • L 1 is a trivalent linker moiety; and each of m and n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20.
  • L 1 is an optionally substituted trivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R') 2 -, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -,
  • a target binding moiety e.g. a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)), has the structure salt form thereof, wherein: each of R 7 is independently hydrogen or an optionally substituted group selected from Ci- 6 aliphatic, a 3-8 membered saturated or partially unsaturated monocyclic carbocyclic ring, phenyl, an 8-10 membered bicyclic aromatic carbocyclic ring, a 4-8 membered saturated or partially unsaturated monocyclic heterocyclic ring having 1-2 heteroatoms independently selected from nitrogen, oxygen, or sulfur, a 5-6 membered monocyclic heteroaromatic ring having 1-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or an 8-10 membered bicyclic heteroaromatic ring having 1-5 heteroatoms independently selected from nitrogen, oxygen, or sulfur; or: an R 7 group and the R 7' group attached to the same carbon atom are optionally
  • an antibody binding moiety e.g., a universal antibody binding moiety is or comprises a peptide moiety, e.g., a moiety having the structure of R c -(Xaa)z- or a salt form thereof, wherein each of R c , z and Xaa is independently as described herein.
  • one or more Xaa are independently an unnatural amino acid residue.
  • side chains of two or more amino acid residues may be linked together to form bridges.
  • side chains of two cysteine residues may form a disulfide bridge comprising -S-S- (which, as in many proteins, can be formed by two -SH groups).
  • a target binding moiety e.g. a protein binding moiety
  • each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50;
  • L is a linker moiety; each R c is independently -L a -R'; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -C(O)S-, or -C(O)0-; each
  • a heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • a target binding moiety is or comprises R c -(Xaa)z- or a salt form thereof, wherein each variable is as described herein.
  • a protein binding moiety is or comprises R c -(Xaa)z- or a salt form thereof, wherein each variable is as described herein.
  • an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises R c -(Xaa)z- or a salt form thereof, wherein each variable is as described herein.
  • a target binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
  • a protein binding moiety is or comprises wherein each variable is as described herein.
  • an antibody binding moiety e.g., a universal antibody binding moiety
  • an antibody binding moiety is or comprises or a salt form thereof, wherein each variable is as described herein.
  • an antibody binding moiety e.g., a universal antibody binding moiety is R c -(Xaa)z- or salt form thereof, and is or comprises a peptide unit.
  • -(Xaa)z- is or comprises a peptide unit.
  • amino acid residues may form bridges, e.g., connections formed by side chains optionally through linker moieties (e.g., L); for example, as in many polypeptides, cysteine residues may form disulfide bridges.
  • a peptide unit comprises an amino acid residue (e.g., at physiological pH about 7.4, "positively charged amino acid residue", Xaa p ), e.g., a residue of an amino acid of formula A-l that has a positively charged side chain.
  • a peptide unit comprises R.
  • at least one Xaa is R.
  • a peptide unit is or comprises APAR.
  • a peptide unit is or comprises RAPA.
  • a peptide unit comprises an amino acid residue, e.g., a residue of an amino acid of formula A-l, that has a side chain comprising an aromatic group ("aromatic amino acid residue", Xaa A ).
  • a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
  • a peptide unit comprises W.
  • a peptide unit comprises a positively charged amino acid residue and an aromatic amino acid residue.
  • a peptide unit is or comprises Xaa A XaaXaa p Xaa p .
  • a peptide unit is or comprises Xaa p Xaa p XaaXaa A . In some embodiments, a peptide unit is or comprises Xaa p Xaa A Xaa p . In some embodiments, a peptide unit is or comprises two or more Xaa p Xaa A Xaa p . In some embodiments, a peptide unit is or comprises Xaa p Xaa A Xaa p XaaXaaa p Xaa A Xaa p .
  • a peptide unit is or comprises Xaa p Xaa p Xaa A Xaa A Xaa p . In some embodiments, a peptide unit is or comprises Xaa p Xaa p Xaa p Xaa A . In some embodiments, a peptide unit is or comprises two or more Xaa A Xaa A Xaa p . In some embodiments, a peptide residue comprises one or more proline residues. In some embodiments, a peptide unit is or comprises HWRGWA (SEQ ID NO:l). In some embodiments, a peptide unit is or comprises WGRR (SEQ ID NO:2).
  • a peptide unit is or comprises RRGW (SEQ ID NO:3). In some embodiments, a peptide unit is or comprises NKFRGKYK (SEQ ID NO:4). In some embodiments, a peptide unit is or comprises NRFRGKYK (SEQ ID NO:5). In some embodiments, a peptide unit is or comprises NARKFYK (SEQ ID NO:6). In some embodiments, a peptide unit is or comprises NARKFYKG (SEQ ID NO:7). In some embodiments, a peptide unit is or comprises HWRGWV (SEQ ID NO:8). In some embodiments, a peptide unit is or comprises KHFRNKD (SEQ ID NO:9).
  • a peptide unit comprises a positively charged amino acid residue, an aromatic amino acid residue, and an amino acid residue, e.g., a residue of an amino acid of formula A-l, that has a negatively charged side chain (e.g., at physiological pH about 7.4, "negatively charged amino acid residue", Xaa N ).
  • a peptide unit comprises RHRFNKD (SEQ ID NO:10).
  • a peptide unit is RHRFNKD (SEQ ID NO:10).
  • a peptide unit comprises TY.
  • a peptide unit is TY.
  • a peptide unit comprises TYK.
  • a peptide unit is TYK. In some embodiments, a peptide unit comprises RTY. In some embodiments, a peptide unit is RTY. In some embodiments, a peptide unit comprises RTYK (SEQ ID NO:ll). In some embodiments, a peptide unit is RTYK (SEQ ID NO:ll). In some embodiments, a peptide unit is or comprises a sequence selected from PAM. In some embodiments, a peptide unit comprises WHL. In some embodiments, a peptide unit is WHL.
  • a peptide unit is or comprises WXL, wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit comprises WDL.
  • a peptide unit is WDL.
  • a peptide unit comprises ELVW (SEQ ID NO:12).
  • a peptide unit is ELVW (SEQ ID NO:12).
  • a peptide unit comprises GELVW (SEQ ID NO:13).
  • a peptide unit is GELVW (SEQ ID NO:13). In some embodiments, a peptide unit is or comprises a sequence selected from AWHLGELVW (SEQ ID NO:14). In some embodiments, a peptide unit is or comprises AWHLGELVW (SEQ ID NO:14). In some embodiments, a peptide unit is or comprises a sequence selected from AWDLGELVW (SEQ ID NO:15). In some embodiments, a peptide unit is or comprises AWDLGELVW (SEQ ID NO:15).
  • a peptide unit is or comprises AWXLGELVW (SEQ ID NO:16), wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises a sequence selected from DCAWHLGELVWCT (SEQ ID NO:17), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises DCAWHLGELVWCT (SEQ ID NO:17), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises a sequence selected from DCAWXLGELVWCT (SEQ ID NO:18), wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises DCAWXLGELVWCT (SEQ ID NO:18), wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • X comprises -COOH or a salt or activated form thereof in its side chain.
  • a peptide unit is or comprises a sequence selected from DCAWDLGELVWCT (SEQ ID NO:19), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises DCAWDLGELVWCT (SEQ ID NO:19), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises a sequence selected from Fc-lll. In some embodiments, a peptide unit is or comprises Fc-lll.
  • a peptide unit is or comprises a sequence selected from DpLpAWXLGELVW (SEQ ID NO:20), wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises DpLpAWXLGELVW (SEQ ID NQ:20), wherein X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises a sequence selected from DpLpAWDLGELVW (SEQ ID NO:21).
  • a peptide unit is or comprises DpLpAWDLGELVW (SEQ ID NO:21).
  • a peptide unit is or comprises a sequence selected from DpLpAWHLGELVW (SEQ ID NO:22), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises DpLpAWHLGELVW (SEQ ID NO:22) (e.g., FcBP-1), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises a sequence selected from FcBP-1.
  • a peptide unit is or comprises a sequence selected from DpLpDCAWXLGELVWCT (SEQ ID NO:23), wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises DpLpDCAWXLGELVWCT (SEQ ID NO:23), wherein the two cysteine residues can form a disulfide bond as found in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises a sequence selected from DpLpDCAWHLGELVWCT (SEQ ID NO:24), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises DpLpDCAWHLGELVWCT (SEQ ID NO:24) (e.g., FcBP-2), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises a sequence selected from DpLpDCAWDLGELVWCT (SEQ ID NO:25), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises DpLpDCAWDLGELVWCT (SEQ ID NO:25), wherein the two cysteine residues can form a disulfide bond as found in natural proteins.
  • a peptide unit is or comprises a sequence selected from FcBP-2.
  • a peptide unit is or comprises a sequence selected from CDCAWXLGELVWCTC (SEQ ID NO:26), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises CDCAWXLGELVWCTC (SEQ ID NO:26), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins, and X is an amino acid residue as described herein, e.g., one suitable for connection with another moiety (e.g., an amino acid residue comprising -COOH or a salt or activated form thereof such as D, E, etc.).
  • a peptide unit is or comprises a sequence selected from CDCAWHLGELVWCTC (SEQ ID NO:27), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
  • a peptide unit is or comprises CDCAWHLGELVWCTC (SEQ ID NO:27), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
  • a peptide unit is or comprises a sequence selected from CDCAWDLGELVWCTC (SEQ ID NO:28), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
  • a peptide unit is or comprises CDCAWDLGELVWCTC (SEQ ID NO:28), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, can each independently form a disulfide bond as in natural proteins.
  • a peptide unit is or comprises a sequence selected from Fc-lll-4c.
  • a peptide unit is or comprises a sequence selected from FcRM. In some embodiments, a peptide unit is or comprises a cyclic peptide unit. In some embodiments, a cyclic peptide unit comprises amide group formed by an amino group of a side chain and the C-terminus -COOH. It is appreciated by those skilled in the art that in various embodiments, when a peptide unit is connected to another moiety, an amino acid residue of a peptide unit may be connected through various positions, e.g., its backbone, its side chain, etc. In some embodiments, an amino acid residue is modified for connection.
  • an amino acid residue is replaced with another suitable residue for connection while maintaining one or more properties and/or activities a peptide unit (e.g., binding to an antibody as described herein).
  • an amino acid residue is replaced with an amino acid residue with a side chain comprising -COOH or a salt or activated form thereof (e.g., side chain being -CH 2 -COOH or a salt or activated form thereof).
  • H may be replaced with D (e.g., in various peptide units comprising WHL).
  • a peptide unit is connected to another moiety through -COOH or a salt or activated form thereof, e.g., through formation of e.g., -CON(R')-.
  • R' is -H.
  • -COOH is in a side chain of an amino acid residue.
  • 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue
  • 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted
  • 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted
  • 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
  • a peptide moiety is connected to the rest of a molecule through its N-terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
  • the total number of replacement, deletion and insertion is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4. In some embodiments, the total number is no more than 5.
  • the total number is no more than 6. In some embodiments, the total number is no more than 7. In some embodiments, the total number is no more than 8. In some embodiments, the total number is no more than 9. In some embodiments, the total number is no more than 10. In some embodiments, there are no insertions. In some embodiments, there are no deletions.
  • -(Xaa)z- is or comprises [X 1 ] Pi [X 2 ] P 2- X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X 11 X 12 -[X 13 ]pi3-[X 14 ]pi4[X 15 ]pi5[X 16 ]pi6, wherein each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue, e.g., of an amino acid of formula A-l, and each of pi, p2, plB, pl4, pl5 and pl6 is independently 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently an amino acid residue of an amino acid of formula A-l. In some embodiments, each of X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 is independently a natural amino acid residue.
  • X 1 , X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , and X 13 are independently an unnatural amino acid residue as described in the present disclosure.
  • a peptide unit comprises a functional group in an amino acid residue that can react with a functional group of another amino acid residue.
  • a peptide unit comprises an amino acid residue with a side chain which comprises a functional group that can react with another functional group of the side chain of another amino acid residue to form a linkage (e.g., see moieties described in Table A-l, example 8, etc.).
  • one functional group of one amino acid residue is connected to a functional group of another amino acid residue to form a linkage (or bridge).
  • Linkages are bonded to backbone atoms of peptide units and comprise no backbone atoms.
  • a peptide unit comprises a linkage formed by two side chains of nonneighboring amino acid residues.
  • a linkage is bonded to two backbone atoms of two non-neighboring amino acid residues. In some embodiments, both backbone atoms bonded to a linkage are carbon atoms. In some embodiments, a linkage has the structure of L b , wherein L b is L a as described in the present disclosure, wherein L a is not a covalent bond. In some embodiments, L a comprises -Cy-. In some embodiments, L a comprises -Cy-, wherein -Cy- is optionally substituted heteroaryl. In some embodiments, -Cy- is
  • L a can be formed by a -IM3 group of the side chain of one amino acid residue, and the -o- of the side chain of another amino acid residue.
  • a linkage is formed through connection of two thiol groups, e.g., of two cysteine residues.
  • L a comprises -S-S-.
  • L a is -CH 2 -S-S-CH 2 -.
  • a linkage is formed through connection of an amino group (e.g., -IMH2 in the side chain of a lysine residue) and a carboxylic acid group (e.g., -COOH in the side chain of an aspartic acid or glutamic acid residue).
  • L a comprises -C(O)-N(R')-. In some embodiments, L a comprise -C(O)-NH-. In some embodiments, L a is -ChhCONH-iChhb-. In some embodiments, L a comprises -C(O)-N(R')-, wherein R' is R, and is taken together with an R group on the peptide backbone to form a ring (e.g., in A-34). In some embodiments, L a is -(CH 2 ) 2 -N(R')-CO — (Cbhh-. In some embodiments, -Cy- is optionally substituted phenylene.
  • -Cy- is optionally substituted 1,2-phenylene.
  • two amino acid residues bonded to a linkage are separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more than 15 amino acid residues between them (excluding the two amino acid residues bonded to the linkage).
  • the number is 1. In some embodiments, the number is 2. In some embodiments, the number is 3. In some embodiments, the number is 4. In some embodiments, the number is 5. In some embodiments, the number is 6. In some embodiments, the number is 7. In some embodiments, the number is 8. In some embodiments, the number is 9. In some embodiments, the number is 10. In some embodiments, the number is 11. In some embodiments, the number is 12. In some embodiments, the number is 13. In some embodiments, the number is 14. In some embodiments, the number is 15.
  • each of pi, p2, pl3, pl4, pl5 and pl6 is 0.
  • -(Xaa)z- is or comprises -X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X n X 12 -, wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue;
  • X 6 is Xaa A or Xaa p ;
  • X 9 is Xaa N ; and X 12 is Xaa A or Xaa p .
  • each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-l as described in the present disclosure.
  • X 5 is Xaa A or Xaa p .
  • X 5 is Xaa A .
  • X 5 is Xaa p .
  • X 5 is an amino acid residue whose side chain comprises an optionally substituted saturated, partially saturated or aromatic ring.
  • X 5 is ⁇ .
  • X 5 is .
  • X 6 is Xaa A .
  • X 6 is Xaa p . In some embodiments, X 6 is His. In some embodiments, X 12 is Xaa A . In some embodiments, X 12 is Xaa p . In some embodiments, X 9 is Asp. In some embodiments,
  • X 9 is Glu.
  • X 12 is In some embodiments, X 12 is .
  • each of X 7 , X 10 , and X 11 is independently an amino acid residue with a hydrophobic side chain ("hydrophobic amino acid residue", Xaa H ).
  • X 7 is Xaa H . In some embodiments, In some embodiments, X 7 is
  • X 10 is Xaa H . In some embodiments, X 10 is Met. In some embodiments, some embodiments, X 11 is Xaa H . In some embodiments,
  • X 8 is Gly. In some embodiments, X 4 is Pro. In some embodiments, X 3 is Lys. In some embodiments, the -COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then a target binding moiety.
  • -(Xaa)z- is or comprises -X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X n X 12 -, wherein: each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ;
  • L b is an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 - -S(O) 2 N(R')-, — C(O)S— , or -C(O)0-, wherein L b is bonded to a backbone atom of one amino acid residue and a backbone atom of another amino acid residue, and comprises
  • X 6 is Xaa A or Xaa p ;
  • X 9 is Xaa N ; and X 12 is Xaa A or Xaa p .
  • each of X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-l as described in the present disclosure.
  • two non-neighboring amino acid residues are connected by lA
  • X 5 and X 10 are connected by lA
  • X 6 is Xaa A .
  • X 6 is Xaa p .
  • X 6 is His.
  • X 9 is Asp.
  • X 9 is Glu.
  • each of X 4 , X 7 , and X 11 is independently Xaa H .
  • X 4 is Xaa H .
  • X 4 is Ala.
  • X 7 is Xaa H .
  • X 7 is
  • X 11 is Xaa H .
  • X 8 is Gly.
  • X 3 is Lys.
  • the -COOH of X 12 forms an amide bond with the side chain amino group of Lys (X 3 ), and the other amino group of the Lys (X 3 ) is connected to a linker moiety and then a target binding moiety.
  • L b is In some embodiments, L b is . In some embodiments, L b connects two alpha-carbon atoms of two different amino acid residues. In some embodiments, both X 5 and X 10 are Cys, and the two -SH groups of their side chains form -S-S- (L b is -CH 2 -S-S-CH 2 -).
  • -(Xaa)z- is or comprises -X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X n X 12 -, wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ;
  • L b is an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, — C(O)S— , or -C(O)0-, wherein L b is bonded to a backbone atom of one amino acid residue and a backbone atom of another amino acid residue, and
  • X 4 is Xaa A ;
  • X 5 is Xaa A or Xaa p ;
  • X 8 is Xaa N ; and X 11 is Xaa A .
  • each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-l as described in the present disclosure.
  • two non-neighboring amino acid residues are connected by L b .
  • X 2 and X 12 are connected by L b .
  • L b is -CH 2 -S-S-CH 2 -.
  • L b is -CH 2 -CH 2 -S-CH 2 -.
  • L b is In some embodiments, L b is In some embodiments, L b is In some embodiments, L b is -CH 2 CH 2 CO-N(R')-CH 2 CH 2 -. In some embodiments, R' are taken together with an R group on the backbone atom that -N(R')-CH 2 CH 2 - is bonded to form a ring, e.g., as in A-34. In some embodiments, a formed ring is 3-, 4-, 5-, 6-, 7- or 8-membered. In some embodiments, a formed ring is monocyclic. In some embodiments, a formed ring is saturated. In some embodiments, L b is . In some embodiments,
  • L b connects two alpha-carbon atoms of two different amino acid residues.
  • X 4 is Xaa A .
  • X 4 is Tyr.
  • X 5 is Xaa A .
  • X 5 is Xaa p .
  • X 5 is His.
  • X 8 is Asp.
  • X 8 is Glu.
  • X 11 is Tyr.
  • both X 2 and X 12 are Cys, and the two -SH groups of their side chains form -S-S- (L b is -CH 2 -S-S-CH 2 -).
  • each of X 3 , X 6 , X 9 , and X 10 is independently Xaa H .
  • X 3 is Xaa H .
  • X 3 is Ala.
  • X 6 is Xaa H .
  • X 6 is Leu.
  • X 9 is Xaa H .
  • X 9 is Leu.
  • X 10 is Xaa H .
  • X 10 is Val.
  • X 7 is Gly.
  • pi is 1.
  • X 1 is Asp.
  • pl3 is 1.
  • pl4, pl5 and pl6 are 0.
  • X 13 is an amino acid residue comprising a polar uncharged side chain (e.g., at physiological pH, "polar uncharged amino acid residue", Xaa L ) ⁇
  • X 13 is Thr.
  • X 13 is Val.
  • pl3 is 0.
  • R c is -NHCH 2 CH(OH)CH3.
  • R c is (/?)-NHCH 2 CH(OH)CH 3 .
  • R c is (S)-NHCH 2 CH(OH)CH 3 .
  • -(Xaa)z- is or comprises -X 2 X 3 X 4 X 5 X 6 X 7 X 8 X 9 X 10 X n X 12 -, wherein: each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue; at least two amino acid residues are connected through one or more linkages L b ;
  • L b is an optionally substituted bivalent group selected from C 1 -C 20 aliphatic or C 1 -C 20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R') 2 -, -Cy-, -0-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, — C(O)S— , or -C(O)0-, wherein L b is bonded to a backbone atom of one amino acid residue and a backbone atom of another amino acid
  • X 5 is Xaa A orXaa p ;
  • X 8 is Xaa N ; and X 11 is Xaa A .
  • each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-l as described in the present disclosure.
  • two non-neighboring amino acid residues are connected by lA
  • there is one linkage lA there are two or more linkages A
  • X 2 and X 12 are connected by A
  • X 4 and X 9 are connected by A
  • X 4 and X 10 are connected by A
  • L b is -CH 2 -S-S-CH 2 -.
  • N N embodiments, L b is
  • both X 2 and X 12 are Cys, and the two -SH groups of their side chains form -S-S- (L b is -CH 2 -S-S-CH 2 -).
  • both X 4 and X 10 are Cys, and the two -SH groups of their side chains form -S-S- (L b is -CH 2 -S-S-CH 2 -).
  • X 4 and X 10 are Cys, and the two -SH groups of their side chains form -S-S- (L b is -CH 2 -S-S-CH 2 -).
  • X 9 are connected by L b , wherein L b is . in some embodiments, X 4 and X 9 are connected by L b , wherein L b
  • L b connects two alpha-carbon atoms of two different amino acid residues.
  • each of X 3 , X 6 , and X 9 is independently Xaa H .
  • X 3 is Xaa H .
  • X 3 is Ala.
  • X 6 is Xaa H .
  • X 6 is Leu.
  • X 6 is .
  • X 9 is Xaa H . In some embodiments, X 9 is Leu. In some embodiments, X 9 is . in some embodiments, X 10 is Xaa H . In some embodiments, X 10 is Val. In some embodiments, X 7 is Gly. In some embodiments, pi is 1. In some embodiments, X 1 is Xaa N . In some embodiments, X 1 is Asp. In some embodiments, X 1 is Glu. In some embodiments, plB is 1. In some embodiments, pl4, pl5 and pl6 are 0. In some embodiments, X 13 is Xaa L . In some embodiments, X 13 is Thr. In some embodiments, X 13 is Val.
  • -(Xaa)z- is or comprises
  • each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , X 12 , X 13 , X 14 , X 15 , and X 16 is independently an amino acid residue; at least two amino acid residues are connected through a linkage L b ;
  • L b is an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, — C(O)S— , or -C(O)0-, wherein L b is bonded to a backbone atom of one amino acid residue and a backbone atom of another amino acid residue, and
  • X 3 is Xaa N ;
  • X 6 is Xaa A ;
  • X 7 is Xaa A or Xaa p ;
  • X 9 is Xaa N ;
  • X 13 is Xaa A .
  • each of X 2 , X 3 , X 4 , X 5 , X 6 , X 7 , X 8 , X 9 , X 10 , X 11 , and X 12 is independently an amino acid residue of an amino acid of formula A-l as described in the present disclosure.
  • two non-neighboring amino acid residues are connected by lA
  • an amino acid residue may be replaced by another amino acid residue having similar properties, e.g., one Xaa H (e.g., Val, Leu, etc.) may be replaced with another Xaa H (e.g., Leu, lie, Ala, etc.), one Xaa A may be replaced with another Xaa A , one Xaa p may be replaced with another Xaa p , one Xaa N may be replaced with another Xaa N , one Xaa L may be replaced with another Xaa L , etc.
  • one Xaa H e.g., Val, Leu, etc.
  • another Xaa H e.g., Leu, lie, Ala, etc.
  • one Xaa A may be replaced with another Xaa A
  • one Xaa p may be replaced with another Xaa
  • a target binding moiety is or comprises optionally substituted moiety of Table A-l.
  • a protein binding moiety is or comprises optionally substituted moiety of Table A-l.
  • an antibody binding moiety e.g., a universal antibody binding moiety, is or comprises optionally substituted moiety of Table A-l.
  • a target binding moiety is selected from able A-l.
  • a protein binding moiety is selected from able A-l.
  • an antibody binding moiety e.g., a universal antibody binding moiety, is selected from able A-l.
  • C-terminus and/or N-terminus are optionally capped (e.g., for C-terminus, by converting -COOH into -C(O)N(R') 2 like -C(O)NH 2 ; for N-terminus, by adding R'C(O)- like CH 3 C(O)- to an amino group).
  • Table A-l Exemplary antibody binding moieties.
  • a target binding moiety is an antibody binding moiety described herein.
  • a protein binding moiety is an antibody binding moiety described herein.
  • -COOH and/or amino groups of amino acid residues e.g., those at the C-terminus or N-terminus, is optionally capped.
  • a -COOH group e.g., a C-terminus -COOH
  • is amidated e.g., converted into -CON(R')2, e.g., -C(O)NHR (e.g., -C(O)NH 2 )
  • an amino group e.g.
  • -IMH2 (e.g., a N-terminus -NH2) is capped with R'- or R'C(O)- (e.g., in some embodiments, by conversion -NH 2 into -NHR' (e.g., -NHC(O)R, (e.g., -NHC(O)CH 3 ))).
  • a target binding moiety is or comprises optionally substituted A-l, A-2, A-3, A-4, A-5, A-6, A-7, A-8, A-9, A-10, A-ll, A-12, A-13, A- 14, A-15, A-16, A-17, A-18, A-19, A-20, A-21, A-22, A-23, A-24, A-25, A-26, A-27, A-28, A-29, A-30, A-31, A-32, A- 33, A-34, A-35, A-36, A-37, A-38, A-39, A-40, A-41, A-42, A-43, A-44, A-45, A-46, A-47, A-48, A- 49, or A-50, each of which is optionally substituted.
  • such a target binding moiety is an antibody binding moiety. In some embodiments, such a target binding moiety is a universal antibody binding moiety. [0140] In some embodiments, a target binding moiety, e.g., a protein binding moiety
  • an antibody binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a linker moiety through the C-terminus of the peptide unit. In some embodiments, it is connected to a linker moiety through the N-terminus of the peptide unit. In some embodiments, it is connected to a linker through a side chain group of the peptide unit.
  • an antibody binding moiety e.g., a universal antibody binding moiety comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through the C-terminus of the peptide unit.
  • a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through the N-terminus of the peptide unit.
  • a protein binding moiety e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)
  • a target binding moiety comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through the N-terminus of the peptide unit.
  • a target binding moiety e.g., a protein binding moiety (e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)) comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through a side chain of the peptide unit.
  • a protein binding moiety e.g., an antibody binding moiety (e.g., a universal antibody binding moiety)
  • a target binding moiety comprises a peptide unit, and is connected to a target binding moiety optionally through a linker moiety through a side chain of the peptide unit.
  • a target binding moiety is or comprises
  • DCAWHLGELVWCT (SEQ ID NO:17))-, wherein 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
  • 1-5 e.g., 1, 2, 3, 4, or 5
  • amino acid residues may be independently and optionally deleted
  • 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
  • it is connected to the rest of a molecule through its N-terminus. In some embodiments, it is connected to the rest of a molecule through its C-terminus.
  • a target binding moiety is s- -s S - S
  • DCAW ⁇ CLGELVWCT or comprises I (SEQ ID NO:18), i (SEQ ID NO:17), , wherein X is an amino acid residue bonded to the rest of a compound or agent, and wherein 1-5 (e.g., 1, 2,
  • amino acid residues may be independently and optionally replaced with another amino acid residue, 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally deleted, and/or 1-5 (e.g., 1, 2, 3, 4, or 5) amino acid residues may be independently and optionally inserted.
  • the total number of replacements, deletions, and insertions is no more than 10 (e.g., 0, or no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10). In some embodiments, the total number is 0. In some embodiments, the total number is no more than 1. In some embodiments, the total number is no more than 2. In some embodiments, the total number is no more than 3. In some embodiments, the total number is no more than 4.
  • the total number is no more than 5. In some embodiments, the total number is no more than 6. In some embodiments, the total number is no more than 7. In some embodiments, the total number is no more than 8. In some embodiments, the total number is no more than 9. In some embodiments, the total number is no more than 10. In some embodiments, there are no insertions. In some embodiments, there are no deletions. In some embodiments, there are no replacements. In some embodiments X is X is an amino acid residue bonded to the rest of a compound or agent. In some embodiments, X is -N(R')-CH(-)-C(O)-.
  • X is -N(R')-CH(-L LG1 -)-C(O)-. In some embodiments, X is -N(R')-CH(-L LG1 -L LG2 -)-C(O)-. In some embodiments, X is -N(R')-CH(-L LG1 -L LG2 -L LG3 -)-C(O)-. In some embodiments, X is -N(R')-CH(-L LG1 -L LG2 -L LG3 -L LG4 -)-C(O)-.
  • X is a residue of any of the following:
  • X is K. In some embodiments, X is D. In some embodiments, X is a residue of Dab. In some embodiments, X is E.
  • an antibody binding moiety e.g., a universal antibody binding moiety
  • Suitable such antibody binding moieties include small molecule Fc binder moieties, e.g., those described in US 9,745,339, US 201/30131321, etc.
  • an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
  • an antibody binding moiety ABT is of such a structure that H-ABT is a compound described in US 9,745,339 or US 2013/0131321, the compounds of each of which are independently incorporated herein by reference.
  • such a compound can bind to an antibody.
  • such a compound can bind to Fc region of an antibody.
  • a target binding moiety is or comprises any of the following, each of which is optionally substituted:
  • target binding moiety is or comprises any of the following, each of which is optionally substituted: can be, for example, hydrogen, Ci-
  • a target binding moiety is or comprises any of the following:
  • target binding moiety is or comprises , wherein each variable is independently as described herein.
  • m is 4 to IB.
  • a target binding moiety is or comprises , wherein b is 1-20, and each other variable is independently as described herein.
  • b is 4-13.
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises any of the following: is, e.g., H or C1-C4 alkyl and R' is e.g., H or Ci-C4alkyl.
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises ,
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises any one of the following:
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises
  • -NH- is bonded to a R c group.
  • R c is R-C(O)-.
  • R c is CH 3 C(O)-.
  • target binding moieties are antibody binding moieties.
  • a target binding moiety e.g., or
  • R c -(Xaa)z- is or comprises any one of the following:
  • a target binding moiety e.g., R c -(Xaa)z-
  • a target binding moiety e.g., R c -(Xaa)z-
  • a target binding moiety is or comprises -FNMQQQRRFYEALHDPNLNEEQRNAKIKSIRDD-NH2 (SEQ ID NO: 29) or a fragment thereof.
  • a target binding moiety e.g., R c -(Xaa)z-, is or comprises FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC (SEQ ID NO:30) or a fragment thereof.
  • a target binding moiety e.g moiety of a peptide such as FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC (SEQ ID NO:30), RGNCAYHRGQLVWCTYH (SEQ ID NO:31), RGNCAYHKGQLVWCTYH, RGNCKYHRGQLVWCTYH (SEQ ID NO:32), RGNCAWHRGKLVWCTYH(SEQ ID NO:33), RGNCAWHRGKLVWCTYH (SEQ ID NO:34), RGNCKWHRGELVWCTYH (SEQ ID NO:35), RGNCKWHRGQLVWCTYH (SEQ ID NO:36), RGNCKYHLGELVWCTYH (SEQ ID NO:37), RGNCKYHLGQLVWCTYH (SEQ ID NO:38), DCKWHLGELVWCT (SEQ ID NO:39), DCKYHLGELVWCT (SEQ ID NO:40), DCKWHRGELVWCT (SEQ ID NO:40), DC
  • a peptide such as Z33, FNMQCQRRFYEALHDPNLNEEQRNAKIKSIRDDC (SEQ ID NO:30), RGNCAYHRGQLVWCTYH (SEQ ID NO:31), RGNCKYHRGQLVWCTYH (SEQ ID NO:33), RGNCAYHKGQLVWCTYH (SEQ ID NO:32), RGNCAWHRGKLVWCTYH (SEQ ID NO:34), RGNCKWHRGQLVWCTYH (SEQ ID NO:36), RGNCKWHRGELVWCTYH (SEQ ID NO:34), RGNCKYHLGELVWCTYH (SEQ ID NO:37), RGNCKYHLGQLVWCTYH (SEQ ID NO:38), DCKWHLGELVWCT (SEQ ID NO:39), DCKYHLGELVWCT (SEQ ID NO:40), DCKWHLGELVWCT (SEQ ID NO:39), DCKYHLGELVWCT (SEQ ID NO:40), DCKWHLGELVW
  • FNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:50), RGNCAWHLGQLVWCKYH (SEQ ID NO:51), RGNCAWHLGELVWCKYH (SEQ ID NO:52), RGNCAYHLGQLVWCTKH (SEQ ID NO:53), RGNCAYHLGQLVWCTYK (SEQ ID NO:54), RGNCAYHRGQLVWCTKH (SEQ ID NO:55), KNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:56), FNMQCQKRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:57), FNMQCQRRFYEAKHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:58), FNMQCQRRFYEALHDPNLNEEQRKARIRSIRDDC (SEQ ID NO:59), FNMQCQRRFYEALHDPNLNKEQRNARIRSIR
  • FNMQCQRRFYEALHDPNLNKEQRNARIRSIRDDC (SEQ ID NO:49), RGNCAWHLGELVWCKYH (SEQ ID NO:52), RGNCAYHLGQLVWCTKH (SEQ ID NO:53), RGNCAYHLGQLVWCTYK (SEQ ID NO:54).
  • RGNCAYHRGQLVWCTKH (SEQ ID NO:55), KNMQCQRRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:56), FNMQCQKRFYEALHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:57), FNMQCQRRFYEAKHDPNLNEEQRNARIRSIRDDC (SEQ ID NO:58), FNMQCQRRFYEALHDPNLNEEQRKARIRSIRDDC (SEQ ID NO:59), FNMQCQRRFYEALHDPNLNKEQRNARIRSIRDDC (SEQ ID NO:49), FNMQCQRRFYEALHDPNLNEEQRNARIRSIKDDC (SEQ ID NO:48), FNKQCQRRFYEALHDPNLNEEQRNARIRSIKDDC (SEQ ID NO:48), FNKQCQRRFYEALHDPNLNEEQRNARIRSIKDDC (SEQ ID NO:48), FNKQCQRRFY
  • one or more amino acid residues of a sequence may be independently and optionally replaced (e.g., 1-5), deleted (e.g., 1-5) and/or inserted (e.g., 1-5) as described herein.
  • a target binding moiety e.g.
  • X 8 (the X after H) is Orn.
  • X 8 is Dab.
  • X 8 is Lys(Ac).
  • X 8 is Orn(Ac).
  • X 8 is Dab(Ac).
  • X 8 is Arg.
  • X 8 is Nle.
  • X 8 is Nva.
  • X 8 is Val.
  • X 8 is Tie.
  • X 8 is Leu. In some embodiments, X 8 is Ala(tBu). In some embodiments, X 8 is Cha. In some embodiments, X 8 is Phe.
  • a target binding moiety e.g., or R c -(Xaa)z-, is or comprises DCAWHLGELVWCT (SEQ ID NO:17).
  • a C- terminus and/or a N-terminus of a protein agent/peptide agent moiety are independently capped (e.g., RC(O)- such as CH 3 C(O)- for N-terminus, -N(R')2 such as -NH2 for C-terminus, etc.).
  • target binding moieties are antibody binding moieties.
  • a residue may be modified or replaced for connection with another moiety, e.g., in some embodiments, H may be replaced with an amino acid residue comprises a side chain that contain -COOH or a salt or activated form thereof (e.g., D).
  • a target binding moiety e.g., or
  • R c -(Xaa)z- is or comprises (Xi- 3 )-C-(X 2 )-H-(Xaal)-G-(Xaa2)-L-V-W-C-(Xi- 3 ) (SEQ ID NO:68), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
  • Xaal is R, L, L, D, E, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is L, D, E, N, or Q.
  • Xaal is a lysine residue, a cysteine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is a glutamic acid residue or an aspartic acid residue.
  • Xaal is an arginine residue or a leucine residue.
  • Xaa2 is a lysine residue, a glutamine residue, or an aspartic acid residue.
  • target binding moieties are antibody binding moieties.
  • a target binding moiety e.g.
  • R c -(Xaa)z- is or comprises (Xl-3)-C-(Xaa3)-(xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)- (Xaa7) (SEQ ID NO:68), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
  • Xaa3 is an alanine residue or a lysine residue.
  • Xaa4 is a tryptophan residue or a tyrosine residue.
  • Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
  • Xaa5 is a threonine residue or a lysine residue.
  • Xaa6 is a tyrosine residue, a lysine residue, or absent.
  • Xaa7 is a histidine residue, a lysine residue, or absent.
  • such target binding moieties are antibody binding moieties.
  • a target binding moiety e.g.
  • R c -(Xaa)z- is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-(Xaa5)-(Xaa6)-(Xaa7) (SEQ ID NO:69), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
  • Xaa3 is an alanine residue or a lysine residue.
  • Xaa4 is a tryptophan residue or a tyrosine residue.
  • Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
  • Xaa5 is a threonine residue or a lysine residue.
  • Xaa6 is a tyrosine residue, a lysine residue, or absent.
  • Xaa7 is a histidine residue, a lysine residue, or absent.
  • such target binding moieties are antibody binding moieties.
  • a target binding moiety e.g.
  • R c -(Xaa)z- is or comprises D-C-(Xaa3)-(Xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-T (SEQ ID NO:70), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
  • Xaa3 is an alanine residue or a lysine residue.
  • Xaa4 is a tryptophan residue or a tyrosine residue.
  • Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
  • target binding moieties are antibody binding moieties.
  • a target binding moiety e.g.
  • R c -(Xaa)z- is or comprises R-G-N-C-(Xaa3)-(Xaa4)-H-(Xaal)-G-(Xaa2)-L-V-W-C-(Xaa5)- (Xaa6)- (Xaa7) (SEQ ID NO:71), wherein each of X and Xaa is independently an amino acid residue and optionally not a cysteine residue.
  • Xaa3 is an alanine residue or a lysine residue.
  • Xaa4 is a tryptophan residue or a tyrosine residue.
  • Xaal is an arginine residue, a leucine residue, a lysine residue, an aspartic acid residue, a glutamic acid residue, a 2-amino suberic acid residue, or a diaminopropionic acid residue.
  • Xaa2 is a lysine residue, a glutamine residue, a glutamic acid residue, an asparagine residue, or an aspartic acid residue.
  • Xaa5 is a threonine residue or a lysine residue.
  • Xaa6 is a tyrosine residue, a lysine residue, or absent.
  • Xaa7 is a histidine residue, a lysine residue, or absent.
  • target binding moieties are antibody binding moieties.
  • target binding moieties e.g., various target binding moieties described above, are protein binding moieties.
  • target binding moieties are antibody binding moieties.
  • LG is or comprises such a target binding moiety.
  • LG is or comprises a protein binding moiety.
  • LG is or comprises an antibody binding moiety.
  • a target binding moiety e.g., an antibody binding moiety
  • an adapter protein agent e.g., as described in Hui, et al., Bioconjugate Chem. 2015, 26, 1456-1460, doi: 10.1021/acs.bioconjchem.5b00275.
  • adapter proteins when utilized in accordance with the present disclosure, do not require reactive residues (e.g., BPA) to achieve one or more or all advantages.
  • target binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one is described in US 2009/0286693.
  • a target binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
  • a target binding moiety e.g., an antibody binding moiety
  • ABT is of such a structure that H-ABT is a compound described in US 2009/0286693, the compounds of which are independently incorporated herein by reference.
  • such a compound can bind to an antibody. In some embodiments, such a compound can bind to Fc region of an antibody.
  • a target binding moiety e.g., an antibody binding moiety is or comprises a triazine moiety, e.g., one described in Teng, et al., A strategy for the generation of biomimetic ligands for affinity chromatography. Combinatorial synthesis and biological evaluation of an IgG binding ligand, !. Mol. Recognit. 1999;12:67-75 ("Teng").
  • a target binding moiety, e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
  • a target binding moiety e.g., an antibody binding moiety
  • ABT is of such a structure that H-ABT is a compound described in Teng, the compounds of which are independently incorporated herein by reference.
  • such a compound can bind to an antibody.
  • such a compound can bind to Fc region of an antibody.
  • v target binding moiety e.g., an antibody binding moiety is a triazine moiety, e.g., one described in Uttamchandani, et al., Microarrays of Tagged Combinatorial Triazine Libraries in the Discovery of Small-Molecule Ligands of Human IgG, J Comb Chem. 2004 Nov-Dec;6(6):862-8 ("Uttamchandani").
  • a target binding moiety e.g., an antibody binding moiety is of such a structure that its corresponding compound is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
  • a target binding moiety e.g., an antibody binding moiety
  • ABT is of such a structure that H-ABT is a compound described in Uttamchandani, the compounds of which are independently incorporated herein by reference.
  • such a compound can bind to an antibody.
  • such a compound can bind to Fc region of an antibody.
  • an antibody binding moiety binds to one or more binding sites of protein A. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein G. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein L. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein Z. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LG. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein LA. In some embodiments, an antibody binding moiety binds to one or more binding sites of protein AG.
  • a target binding moiety e.g., an antibody binding moiety can bind to a nucleotide-binding site.
  • a target binding moiety e.g., an antibody binding moiety is a small molecule moiety that can bind to a nucleotide-binding site.
  • a small molecule is tryptamine.
  • a target binding moiety e.g., an antibody binding moiety, ABT is of such a structure that H-ABT is tryptamine.
  • an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can selectively bind to IgG, and when used in provided technologies can provide and/or stimulate ADCC and/or ADCP.
  • peptide display technologies e.g., phase display, non-cellular display, etc.
  • an antibody binding moiety is a moiety (e.g., small molecule moiety, peptide moiety, nucleic acid moiety, etc.) that can bind to IgG and optionally can compete with known antibody binders, e.g., protein A, protein G, protein L, etc.
  • antibodies of various properties and activities may be targeted by antibody binding moieties described in the present disclosure.
  • such antibodies include antibodies administered to a subject, e.g., for therapeutic purposes.
  • antibody binding moieties described herein may bind antibodies toward different antigens and are useful for conjugating moieties of interest with various antibodies.
  • a target binding moiety e.g., an antibody binding moiety
  • a meditope agent is described in, e.g., US 2019/0111149.
  • a target binding moiety e.g., an antibody binding moiety
  • a target binding moiety can bind to human IgG.
  • a target binding moiety e.g., an antibody binding moiety
  • rabbit IgG e.g., a target binding moiety, e.g., an antibody binding moiety
  • a target binding moiety e.g., an antibody binding moiety
  • binds to IgGl e.g., an antibody binding moiety
  • a target binding moiety e.g., an antibody binding moiety
  • lgG2 binds to lgG3.
  • a target binding moiety binds to lgG4. In some embodiments, a target binding moiety, e.g., an antibody binding moiety, binds to IgGl, lgG2 and/or lgG4. In some embodiments, a target binding moiety, e.g., an antibody binding moiety, binds to IgGl, lgG2 and lgG4.
  • target binding moieties bind to targets (e.g., antibody agents for antibody binding moieties) with a Kd that is about 1 mM-1 pM or less.
  • a Kd is about 1 mM, 0.5 mM, 0.2 mM, 0.1 mM, 0.05 mM, 0.02 mM, 0.01 mM, 0.005 mM, 0.002 mM, 0.001 mM, 500 nM, 200 nM, 100 nM, 50 nM, 20 nM, 10 nM, 5 nM, 2 nM, 1 nM, 0.5 nM, 0.2 nM, 0.1 nM, or less.
  • Kd is about 1 mM or less.
  • Kd is about 0.5 mM or less.
  • Kd is about 0.1 mM or less.
  • Kd is about 0.05 mM or less. In some embodiments, Kd is about 0.01 mM or less. In some embodiments, Kd is about 0.005 mM or less. In some embodiments, Kd is about 0.001 mM or less. In some embodiments, Kd is about 500 nM or less. In some embodiments, Kd is about 200 nM or less. In some embodiments, Kd is about 100 nM or less. In some embodiments, Kd is about 50 nM or less. In some embodiments, Kd is about 20 nM or less. In some embodiments, Kd is about 10 nM or less. In some embodiments, Kd is about 5 nM or less. In some embodiments, Kd is about 2 nM or less. In some embodiments, Kd is about 1 nM or less. For example, in some embodiments, antibody binding moieties bind to IgG antibody agents with Kd described herein.
  • provided compounds and agents may comprise one or more amino acid moieties, e.g., in antibody binding moieties, linker moieties, etc.
  • Amino acid moieties can either be those of natural amino acids or unnatural amino acids.
  • an amino acid has the structure of formula A-l:
  • each of R al , R a2 and R a3 is independently -L a -R' or an amino acid side chain; each of L al and L a2 is independently L a ; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2
  • an amino acid residue e.g., of an amino acid having the structure of formula A-l, has the structure of -N(R al )-L al -C(R a2 )(R a3 )-L a2 -CO-.
  • each amino acid residue in a peptide independently has the structure of -N(R al )-L al -C(R a2 )(R a3 )-L a2 -CO-.
  • the present disclosure provides a derivative of an amino acid of formula A-l or a salt thereof. In some embodiments, a derivative is an ester. In some embodiments, the present disclosure provides a compound of formula
  • R CT is R' and each other variable is independently as described herein.
  • R CT is R.
  • R 07 is optionally substituted aliphatic.
  • R CT is t-butyl.
  • L al is a covalent bond.
  • a compound of formula A-l is of the structure NH(R al )-C(R a2 )(R a3 )-L a2 -COOH.
  • L a2 is -CH 2 SCH 2 -.
  • L a2 is a covalent bond.
  • a compound of formula A-l is of the structure NH(R al )-L al -C(R a2 )(R a3 )-COOH.
  • an amino acid residue has the structure of -N(R al )-L al -C(R a2 )(R a3 )-CO-.
  • L al is -CH 2 CH 2 S-.
  • L al is -CH 2 CH 2 S-, wherein the CH 2 is bonded to NH(R al ).
  • L al is a covalent bond and L a2 is a covalent bond.
  • a compound of formula A-l is of the structure NH(R al )-C(R a2 )(R a3 )-COOH; NH(R al )-CH(R a2 )-COOH; NH(R al )-CH(R a3 )-COOH; NH 2 -CH(R a2 )-COOH; NH 2 -CH(R a3 )-COOH; -N(R al )-C(R a2 )(R a3 )-CO-; N(R al )-CH(R a2 )-CO-; -N(R al )-CH(R a3 )-CO-; -NH-CH(R a2 )-CO-; or -NH-CH(R a3 )-CO-;
  • L a is a covalent bond; L a is optionally substituted Ci- 6 bivalent aliphatic; L a is optionally substituted Ci- 6 alkylene; L a is -CH 2 -; L a is -CH 2 CH 2 -; or L a is -CH 2 CH 2 CH 2 -.
  • L a is bivalent optionally substituted Ci-20 aliphatic, wherein one or more methylene units are independently replaced with -C(O)-, -N(R')-, -Cy-, and/or -O-.
  • L a is bivalent optionally substituted Ci-20 aliphatic, wherein one or more methylene units are independently replaced with -C(O)N(R')-, -Cy-, and -O-.
  • L a is bivalent optionally substituted Ci-20 aliphatic, wherein two or more methylene units are independently replaced with -C(O)N(R')-, and -Cy- in addition to other optional replacements.
  • -Cy- is optionally substituted. In some embodiments, -Cy- is optionally substituted with an electron-withdrawing group as described herein. In some embodiments, -Cy- is substituted with one or more -F. In some embodiments, -Cy- is optionally substituted 1,3-phenylene. In some embodiments, -Cy- is optionally substituted 1,4-phenylene. In some embodiments, L a is or comprises
  • L a is or comprises In some embodiments, L a is or comprises H . In some embodiments, L a is or comprises H . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises In some embodiments, L a is or comprises In some embodiments, L a is or comprises * 3 ⁇ 4 Oz h . In some embodiments, L a is or comprises
  • L a is or comprises jyv* In some embodiments, L a is or comprises . In some embodiments, L a is or comprises
  • L a is or comprises . In is or comprises In some embodiments, L a is or comprises . e embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises . In some embodiments, L a is or comprises
  • R' is R.
  • R al is R, wherein R is as described in the present disclosure.
  • R al is R, wherein R methyl.
  • R a2 is R, wherein R is as described in the present disclosure.
  • R a3 is R, wherein R is as described in the present disclosure.
  • each of R al , R a2 , and R a3 is independently R, wherein R is as described in the present disclosure.
  • R al is hydrogen. In some embodiments, R al is a protective group. In some embodiments, R al is -Fmoc. In some embodiments, R al is -Dde. [0186] In some embodiments, each of R al , R a2 and R a3 is independently -L a -R'.
  • R a2 is hydrogen. In some embodiments, R a3 is hydrogen.
  • R al is hydrogen, and at least one of R a2 and R a3 is hydrogen. In some embodiments, R al is hydrogen, one of R a2 and R a3 is hydrogen, and the other is not hydrogen.
  • R a2 is -L a -R and R a3 is -H. In some embodiments, R a3 is -L a -R and R a2 is -H. In some embodiments, R a2 is -CH 2 -R and R a3 is -H. In some embodiments, R a3 is -CH 2 -R and R a2 is -H. In some embodiments, R a2 is R and R a3 is -H. In some embodiments, R a3 is R and R a2 is -H.
  • R a2 is -L a -R, wherein R is as described in the present disclosure.
  • R a2 is -L a -R, wherein R is an optionally substituted group selected from C3-30 cycloaliphatic, C5-30 aryl, 5-B0 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • R a2 is -L a -R, wherein R is an optionally substituted group selected from C6-30 aryl and 5-30 membered heteroaryl having 1- 10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • R a2 is a side chain of an amino acid. In some embodiments, R a2 is a side chain of a standard amino acid.
  • R a3 is -L a -R, wherein R is as described in the present disclosure.
  • R a3 is -L a -R, wherein R is an optionally substituted group selected from C3-30 cycloaliphatic, C5-30 aryl, 5-B0 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon, and 3-30 membered heterocyclyl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • R a3 is -L a -R, wherein R is an optionally substituted group selected from C6-30 aryl and 5-30 membered heteroaryl having 1- 10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • R a3 is a side chain of an amino acid. In some embodiments, R a3 is a side chain of a standard amino acid.
  • one or R a2 and R a3 is -H. In some embodiments, one or
  • R a2 and R a3 is -L a -R, wherein L a is as described herein.
  • L a is not a covalent bond.
  • one or more methylene units of L a are independently and optionally replaced as described herein, e.g., with -C(O)-, -N(R')-, -O-, -C(O)-N(R')- and/or -Cy-, etc.
  • L a is or comprises -C(O)-, -N(R')- and -Cy-.
  • L a is or comprises -C(O)N(R')- and -Cy-.
  • -Cy- is substituted and one or more substituents are independently an electron- withdrawing group.
  • an amino acid side chain is R a2 or R a3 .
  • an amino acid side chain is or comprises -L LG1 -L LG2 -L LG3 -L LG4 -H.
  • an amino acid side chain is or comprises -L LG2 -
  • an amino acid side chain is or comprises -L LG3 -L LG4 -H.
  • an amino acid side chain is or comprises -L LG4 -H.
  • such a side chain is .
  • such a side chain i some embodiments, such a side chain i some embodiments, such a side chain
  • R is an optionally substituted Ci- 6 aliphatic. In some embodiments, R is an optionally substituted Ci- 6 alkyl. In some embodiments, R is -CH3. In some embodiments, R is optionally substituted pentyl. In some embodiments, R is n-pentyl.
  • R is a cyclic group. In some embodiments, R is an optionally substituted C3-30 cycloaliphatic group. In some embodiments, R is cyclopropyl.
  • R is an optionally substituted aromatic group, and an amino acid residue of an amino acid of formula A-l is a Xaa A .
  • R a2 or R a3 is -CH 2 -R, wherein R is an optionally substituted aryl or heteroaryl group.
  • R is optionally substituted phenyl.
  • R is phenyl.
  • R is optionally substituted phenyl.
  • R is 4- trifluoromethylphenyl.
  • R is 4-phenylphenyl.
  • R is optionally substituted 5-30 membered heteroaryl having 1-10 heteroatoms independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon. In some embodiments, R is optionally substituted 5-14 membered heteroaryl having 1-5 heteroatoms independently selected from oxygen, nitrogen, and sulfur. embodiments, R is optionally substituted pyridinyl. In some embodiments, R is 1- pyridinyl. In some embodiments, R is 2- pyridinyl. In some embodiments, R is 3- pyridinyl. In some embodiments,
  • R' is-COOH.
  • a compound of and an amino acid residue of an amino acid of formula A-l is a Xaa N .
  • R' is-NH2.
  • a compound of an amino acid residue of an amino acid of formula A-l is a Xaa p .
  • R a2 or R a3 is R, wherein R is Ci-20 aliphatic as described in the present disclosure.
  • a compound of an amino acid residue of an amino acid of formula A-l is a Xaa H .
  • R is -CH3.
  • R is ethyl.
  • R is propyl.
  • R is n-propyl.
  • R is butyl.
  • R is n-butyl.
  • R is pentyl.
  • R is n-pentyl.
  • R is cyclopropyl.
  • R al , R a2 , and R a3 are R and are taken together to form an optionally substituted ring as described in the present disclosure.
  • R al and one of R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having no additional ring heteroatom other than the nitrogen atom to which R al is bonded to.
  • a formed ring is a 5- membered ring as in proline.
  • R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring as described in the present disclosure. In some embodiments, R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one or more nitrogen ring atom. In some embodiments, R a2 and R a3 are R and are taken together to form an optionally substituted 3-6 membered ring having one and no more than one ring heteroatom which is a nitrogen atom. In some embodiments, a ring is a saturated ring.
  • an amino acid is a natural amino acid. In some embodiments, an amino acid is an unnatural amino acid. In some embodiments, an amino acid is an alpha-amino acid. In some embodiments, an amino acid is a beta-amino acid. In some embodiments, a compound of formula A-l is a natural amino acid. In some embodiments, a compound of formula A-l is an unnatural amino acid.
  • an amino acid comprises a hydrophobic side chain.
  • an amino acid with a hydrophobic side chain is A, V, I, L, M, F, Y or W.
  • an amino acid with a hydrophobic side chain is A, V, I, L, M, or F.
  • an amino acid with a hydrophobic side chain is A, V, I, L, or M.
  • an amino acid with a hydrophobic side chain is A, V, I, or L.
  • a hydrophobic side chain is R wherein R is Ci-io aliphatic.
  • R is Ci-io alkyl.
  • R is methyl.
  • R is ethyl. In some embodiments, R is propyl. In some embodiments, R is butyl. In some embodiments, R is pentyl. In some embodiments, R is n-pentyl.
  • an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)-NH 2 CH(CH 2 CH 2 CH 2 CH 2 CH 3 )COOH. In some embodiments, an amino acid with a hydrophobic side chain is (/?)-
  • a hydrophobic side chain is -CH 2 R wherein R is optionally substituted phenyl. In some embodiments, R is phenyl. In some embodiments, R is phenyl substituted with one or more hydrocarbon group. In some embodiments, R is 4-phenylphenyl. In some embodiments, an amino acid with a hydrophobic side chain is NH 2 CH(CH 2 -4-phenylphenyl)COOH. In some embodiments, an amino acid with a hydrophobic side chain is (S)-NH 2 CH(CH 2 -4-phenylphenyl)COOH. In some embodiments, an amino acid with a hydrophobic side chain is (/?)-NH 2 CH(CH 2 -4-phenylphenyl)COOH.
  • an amino acid comprises a positively charged side chain
  • such an amino acid comprises a basic nitrogen in its side chain.
  • such an amino acid is Arg, His or Lys.
  • such an amino acid is Arg.
  • such an amino acid is His.
  • such an amino acid is Lys.
  • an amino acid comprises a negatively charged side chain
  • such an amino acid comprises a -COOH in its side chain.
  • such an amino acid is Asp.
  • such an amino acid is Glu.
  • an amino acid comprises a side chain comprising an aromatic group as described herein.
  • such an amino acid is Phe, Tyr, Trp, or His.
  • such an amino acid is Phe.
  • such an amino acid is Tyr.
  • such an amino acid is Trp.
  • such an amino acid is His.
  • such an amino acid is NH 2 -CH(CH 2 -4- phenylphenyl)-COOH.
  • such an amino acid is (S)-NH 2 -CH(CH 2 -4- phenylphenyl)-COOH.
  • such an amino acid is (/?)-NH 2 -CH(CH 2 -4- phenylphenyl)-COOH.
  • an amino acid salt thereof In some embodiments, an amino acid salt thereof. In some embodiments, an amino acid salt thereof. In some embodiments, an amino acid salt thereof. In some embodiments, an amino acid salt thereof. In some embodiments, an amino acid is NHFmoc or a salt thereof. In some embodiments, an amino acid i or a salt thereof. In some embodiments, an amino acid salt thereof. In some embodiments, an amino acid salt thereof. In some embodiments, a provided compound is NHFmoc _ In some embodiments, the present disclosure provides polypeptide agents comprising one or more amino acid residues described in the present disclosure.
  • provided compounds e.g., those useful as reaction partners, comprise reactive groups (e.g., RG).
  • reactive groups e.g., RG
  • first groups e.g., LG
  • moieties of interest e.g., MOI
  • RG is a reaction group as described herein.
  • reactive groups when utilized in compounds that comprise no target binding moieties react slowly and provide low level of, in some embodiments, substantially no conjugation of moieties of interest with target agents.
  • combination of reactive groups with target binding moieties in the same compounds can, among other things, promote reactions between reactive groups and target agents, enhance reaction efficiency, reduce side reactions, and/or improve reaction selectivity (e.g., in terms of target sites wherein conjugation of moieties of interest with target agents occurs).
  • Reactive groups in provided compounds can react with various types of groups in target agents.
  • reactive groups in provided compounds selectively react with amino groups of target agents, e.g., -IMH2 groups on side chains of lysine residues of proteins.
  • reactive groups when utilized in provided compounds e.g., those of formula R-l or salts thereof, selectively react with particular sites of target agents, e.g., as shown in examples herein, one or more of K246, K248, K288, K290, K317, etc. of IgGl, K251,
  • a site is K246 or K248 of an antibody heavy chain. In some embodiments, sites are K246 and/or K248 of an antibody heavy chain. In some embodiments, a site is K246 of an antibody heavy chain. In some embodiments, a site is K248 of an antibody heavy chain. In some embodiments, a site is K288 or K290 of an antibody heavy chain. In some embodiments, a site is K288 of an antibody heavy chain. In some embodiments, a site is K290 of an antibody heavy chain. In some embodiments, a site is K317.
  • a site is K414 of an antibody heavy chain. In some embodiments, a site is K185 of an antibody light chain. In some embodiments, a site is K187 of an antibody light chain. In some embodiments, sites are K251 and/or K253 of an lgG2 heavy chain. In some embodiments, a site is K251 of an lgG2 heavy chain. In some embodiments, a site is K253 of an lgG2 heavy chain. In some embodiments, sites are K239 and/or K241 of an lgG4 heavy chain. In some embodiments, a site is K239 of an lgG4 heavy chain. In some embodiments, a site is K241 of an lgG4 heavy chain. In some embodiments, conjugation selectively occurs at one or more heavy chain sites over light chain sites. In some embodiments, for technologies without target binding moieties, conjugation occurs at light chain sites more than heavy chain sites (e.g., see Figure 15).
  • a reactive group e.g., RG
  • a reactive group e.g., RG
  • an electrophilic group e.g., a Michael acceptor
  • a reactive group e.g., RG
  • a reactive group is or comprises -
  • a reactive group e.g., RG
  • a reactive group is or comprises -
  • a reactive group, e.g., RG is or comprises — L LG3 — L LG4 — L RG1 — L RG2 — , wherein each variable is as described herein.
  • a reactive group e.g., RG
  • a reactive group is or comprises -L LG2 -L LG3 -L LG4 -L RG1 -L RG2 -, wherein each variable is as described herein.
  • a reactive group e.g., RG
  • a reactive group is or comprises -L LG4 -L RG2 -, wherein each variable is as described herein.
  • a reactive group, e.g., RG is or comprises -L LG3 -L LG4 -L RG2 -, wherein each variable is as described herein.
  • a reactive group, e.g., RG is or comprises — L LG2 — L LG3 — L LG4 — L RG2 — , wherein each variable is as described herein.
  • L LG4 is -O-. In some embodiments, as described herein, L LG4 is -O-. In some embodiments,
  • L LG4 is -N(R)-. In some embodiments, L LG4 is -NH-.
  • L LG3 is or comprises an optionally substituted aryl ring. In some embodiments, L LG3 is or comprises a phenyl ring. In some embodiments, an aryl or phenyl ring is substituted. In some embodiments, a substituent is an electron-withdrawing group as described herein, e.g., -NO2, -F, etc.
  • L RG1 is a covalent bond. In some embodiments, L RG1 is not a covalent bond. In some embodiments, L RG1 is -S(O) 2 -.
  • L RG2 is -C(O)-.
  • a reactive group is or comprises -L LG4 -C(O)-, wherein each variable is as described herein.
  • a reactive group is or comprises -L LG3 -L LG4 -C(O)-, wherein each variable is as described herein.
  • a reactive group is or comprises -L LG2 -L LG3 -L LG4 -C(O)-, wherein each variable is as described herein.
  • R RG I, R RG2 , R RG3 and R RG4 is independently -L-R', and L RG3 is -C(O)-, -C(O)0-, -C(O)N(R')-,
  • each of R RG I, R RG2 , R RG3 and R RG4 is independently R'.
  • one or more of R RG1 , R RG2 , R RG3 and R RG4 is independently -H.
  • L RG3 is -C(O)-.
  • L RG3 is -C(O)0-.
  • -O-, -N(R')-, etc. of L RG3 is bonded to
  • R RG1 is -H. In some embodiments, R RG3 is -H.
  • R RG2 and R RG4 are taken together with their intervening atoms to form an optionally substituted ring as described herein.
  • a formed ring is an optionally substituted 3-10 membered monocyclic or bicyclic ring having 0-5 heteroatoms.
  • a formed ring is an optionally substituted 3-10 membered cycloaliphatic ring.
  • a formed ring is an optionally substituted 3-8 membered cycloaliphatic ring.
  • a formed ring is an optionally substituted 5-8 membered cycloaliphatic ring.
  • a reactive group is a structure selected from the Table below.
  • — L LG2 — L LG3 — L LG4 — L RG1 — L RG2 — is a structure selected from the Table below.
  • -L LG2 -L LG3 -L LG4 -RG- is a structure selected from the Table below.
  • Table RG-1 Certain structures as examples. -L LG4 -L RG2 - is -S-C(O)-. In some embodiments, -L LG4 -L RG1 -L RG2 - is -S-C(O)-.
  • -L LG4 -L RG2 - is -N(-)-C(O)-, wherein N is a ring atom of an optionally substituted heteroaryl ring.
  • -L LG4 -L RG2 - is -N(-)-C(O)-, wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
  • -L LG4 -L RG2 - is -N(-)-C(O)-O-, wherein N is a ring atom of L LG4 which is or comprises an optionally substituted heteroaryl ring.
  • L RG2 is optionally substituted -CH 2 -C(O)-, wherein -CH 2 - is bonded to an electron-withdrawing group comprising or connected to a target binding moiety. In some embodiments, L RG2 is optionally substituted -CH 2 - bonded to an electron- withdrawing group comprising or connected to a target binding moiety. In some embodiments, L RG1 is an electron-withdrawing group. In some embodiments, L RG1 is -C(O)-. In some embodiments, L RG1 is -S(O)-. In some embodiments, L RG1 is -S(O) 2 -.
  • L RG1 is -P(0(0R)-. In some embodiments, L RG1 is -P(0(SR)-. In some embodiments, L RG1 is -P(0(N(R) 2 )-. In some embodiments, L RG1 is -OP(0(0R)-. In some embodiments, L RG1 is -OP(0(SR)-. In some embodiments, L RG1 is -OP(0(N(R) 2 )-.
  • L RG2 is optionally substituted -CH 2 -C(O)-, wherein -CH 2 - is bonded to a leaving group comprising or connected to a target binding moiety. In some embodiments, L RG2 is optionally substituted -CH 2 - bonded to a leaving group comprising or connected to a target binding moiety. In some embodiments, L RG1 is -O-C(O)-. In some embodiments, L RG1 is -OS(O) 2 -. In some embodiments, L RG1 is -OP(0(OR)-. In some embodiments, L RG1 is -OP(0(SR)-. In some embodiments, L RG1 is -OP(0(N(R) 2 )-.
  • a reactive group reacts with an amino group of a target agent.
  • an amino group is -IMH2 of the side chain of a lysine residue.
  • a target agent is a protein agent.
  • a target agent is an antibody agent.
  • a reactive group reacts with an amino acid residue of such protein or antibody agent.
  • an amino acid residue is a lysine residue.
  • a reactive group reacts with -IMH2 of the side chain of a lysine residue.
  • a reactive group is or comprises -C(O)-O-, it reacts with -IMH2 (e.g., of the side chain of a lysine residue), and forms an amide group -C(O)-O- with the -NH 2 .
  • -IMH2 e.g., of the side chain of a lysine residue
  • moieties are optionally connected to each other through linker moieties.
  • a reactive group e.g., RG
  • a moiety of interest e.g., MOI
  • a linker e.g., L RM
  • a moiety, e.g., LG may also comprise one or more linkers, e.g., L LG1 , L LG2 , L LG3 , L LG4 , etc., to link various portions.
  • L LG is a linker moiety described herein.
  • L LG1 is a linker moiety described herein.
  • L LG2 is a linker moiety described herein.
  • L LG3 is a linker moiety described herein.
  • L LG4 is a linker moiety described herein.
  • L RM is a linker moiety described herein.
  • L PM is L as described herein. In some embodiments, L PM is a linker moiety described herein. In some embodiments, L PM is L as described herein.
  • Linker moieties of various types and/or for various purposes may be utilized in accordance with the present disclosure.
  • Linker moieties can be either bivalent or polyvalent depending on how they are used. In some embodiments, a linker moiety is bivalent. In some embodiments, a linker is polyvalent and connecting more than two moieties.
  • a linker moiety e.g., L z (wherein z represents superscript text; e.g., L PM , L RM , L LG , L LG1 , etc.), is or comprises L.
  • L is a covalent bond, or a bivalent or polyvalent optionally substituted, linear or branched Ci-ioo group comprising one or more aliphatic, aryl, heteroaliphatic having 1-20 heteroatoms, heteroaromatic having 1-20 heteroatoms, or any combinations thereof, wherein one or more methylene units of the group are optionally and independently replaced with Ci- 6 alkylene, Ci- 6 alkenylene, a bivalent Ci- 6 heteroaliphatic group having 1-5 heteroatoms, —CoC— > -Cy-, -C(R') 2 -, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R)N(R')-,
  • each amino acid residue is independently a residue of an amino acid having the structure of formula A-l or a salt thereof. In some embodiments, each amino acid residue independently has the structure of -N(R al )-L al -C(R a2 )(R a3 )-L a2 -CO- or a salt form thereof.
  • L is bivalent. In some embodiments, L is a covalent bond.
  • L is a bivalent or optionally substituted, linear or branched group selected from Ci-oo aliphatic and Ci-ioo heteroaliphatic having 1-50 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with Ci- 6 alkylene, Ci- 6 alkenylene, a bivalent Ci- 6 heteroaliphatic group having 1-5 heteroatoms, — CoC— , -Cy-, -C(R') 2 -, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -, -
  • L is a bivalent or optionally substituted, linear or branched group selected from Ci-20 aliphatic and Ci-20 heteroaliphatic having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with Ci- 6 alkylene, Ci- 6 alkenylene, a bivalent Ci- 6 heteroaliphatic group having 1-5 heteroatoms, -CoC-, -Cy-, — C(R') 2 — , -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -Sic»)-, -S(O) 2
  • L is a bivalent or optionally substituted, linear or branched group selected from Ci- 2 o aliphatic wherein one or more methylene units of the group are optionally and independently replaced with — CoC— ; -Cy-, -C(R') 2 -, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -C(O)S-, -C(O)0-, -P(O)(0R')
  • L is a bivalent or optionally substituted, linear or branched group selected from Ci-20 aliphatic wherein one or more methylene units of the group are optionally and independently replaced with — coc— , -Cy-, -C(R')2-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -C(O)S-, -C(O)0-, an amino acid residue or -[(-O-C(R')2-, -O-,
  • L is a bivalent or optionally substituted, linear or branched group selected from Ci- 2 o aliphatic wherein one or more methylene units of the group are optionally and independently replaced with — CoC— ; -Cy-, -C(R') 2 -, -O-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0-, -S(O)-,
  • a linker moiety e.g., L, L PM , L RM , etc., comprises an acidic group, e.g., -S(O) 2 0H.
  • L is or comprises — [(— O— C(R') 2 — C(R') 2 — ) n ]— -
  • L is or comprises -[(-O-CH 2 -CH 2 -) n ]-.
  • L is -[(-CH 2 -CH 2 -O) 6 ]-CH 2 -CH 2 -.
  • L is -[(-CH 2 -CH 2 -O) 8 ]-CH 2 -CH 2 -.
  • -CH 2 -CH 2 -O- is bonded to a target binding moiety at a -CH 2 -.
  • -CH 2 -CH 2 -O- is bonded to a moiety of interest at a -CH 2 -.
  • L PM is such L as described herein.
  • L RM is such L as described herein.
  • a linker moiety is trivalent or polyvalent.
  • a linker moiety is L as described herein and L is trivalent or polyvalent.
  • L is trivalent.
  • L is -CH 2 -N(-CH 2 -)-C(O)-.
  • L is or comprises a bioorthogonal or enzymatic reaction product moiety. In some embodiments, L is or comprise an optionally substituted triazole moiety (which is optionally part of a bi- or poly-cyclic ring system). In some embodiments, L is or comprises LPXTG. In some embodiments, L is or comprises LPETG. In some embodiments, L is or comprises LPXT(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10. In some embodiments, L is or comprises LPET(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not substantially damage or transform target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties).
  • provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups (except one or more reactive groups and/or moieties therein) that could be cleaved under conditions that would not render target agents and/or agents comprising target agent moieties (e.g., conjugation products comprising target agent moieties) ineffective for one or more uses (e.g., for use as diagnostic agents, therapeutic agents, etc.).
  • provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups which can be cleaved under bioorthogonal conditions.
  • provided compounds/agents e.g., reaction partners, agents (e.g., products of provided methods and/or steps therein) comprise no cleavable groups which can be cleaved without substantively damaging and/or transforming proteins.
  • a cleavable group is or comprises -S-S-, -S-Cbh-Cy-, -S-Cy-, -C(
  • — C(O)-CH 2 -C(C00H) CHC(O)- moiety, -CHOH-CHOH- moiety, -Se- moiety, Si bonded to two oxygen atoms, -C(O)-CH 2 - wherein the -CH 2 - is bonded to a benzylic carbon wherein the phenyl ring of the benzyl group is substituted with -NO2-, -C(O)-CH 2 - wherein the -CH 2 - is bonded to a benzylic carbon wherein the phenyl ring of the benzyl group is substituted with -NO2- at o-position, or -C(O)-N(-)- moiety, wherein N is a ring atom of a heteroaryl ring.
  • a linker moiety comprises no -S-. In some embodiments, a linker moiety comprises no -S-S- (optionally except a disulfide moiety formed by two amino acid residues, in some embodiments, optionally except a disulfide moiety formed by two cysteine residues). In some embodiments, a linker moiety comprises no -S-Cy-. In some embodiments, a linker moiety comprises no -S-CH 2 -Cy-. In some embodiments, a linker moiety comprises no -C(O)-O-. In some embodiments, a linker moiety comprises no -C(O)-S-.
  • a linker moiety comprises no -C(O)-CH 2 -, wherein the -CH 2 - is bonded to a benzylic carbon, wherein the phenyl ring of the benzyl group is substituted with -NO2- at o- position.
  • a linker moiety comprise no -C(O)-N(-)- moiety, wherein N is a ring atom of a heteroaryl ring.
  • a linker moiety does not contain any of these groups.
  • L RM is such a linker moiety.
  • L PM is such a linker moiety.
  • L LG is such a linker moiety.
  • an agent of the present disclosure does not contain one or more or all of such moieties.
  • L is a covalent bond.
  • L is a bivalent optionally substituted, linear or branched C 1-100 aliphatic group wherein one or more methylene units of the group are optionally and independently replaced.
  • L is a bivalent optionally substituted, linear or branched C6-100 arylaliphatic group wherein one or more methylene units of the group are optionally and independently replaced.
  • L is a bivalent optionally substituted, linear or branched C5-100 heteroarylaliphatic group having 1-20 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced.
  • L is a bivalent optionally substituted, linear or branched Ci-100 heteroaliphatic group having 1-20 heteroatoms wherein one or more methylene units of the group are optionally and independently replaced.
  • a linker moiety e.g., L
  • L is or comprises one or more (e.g.,
  • a linker moiety is or comprises -(CH 2 CH 2 0) n -, wherein n is as described in the present disclosure.
  • one or more methylene units of L are independently replaced with -(ChhCl-hOjn-.
  • n is 1. In some embodiments, n is 2.
  • n is 3. In some embodiments, n is 4. In some embodiments, n is 5. In some embodiments, n is 6. In some embodiments, n is 7. In some embodiments, n is 8. In some embodiments, n is 9. In some embodiments, n is 10. In some embodiments, n is 11. In some embodiments, n is 12. In some embodiments, n is 13. In some embodiments, n is 14. In some embodiments, n is 15. In some embodiments, n is 16. In some embodiments, n is 17. In some embodiments, n is 18. In some embodiments, n is 19. In some embodiments, n is 20.
  • a linker moiety (e.g., L) is or comprises one or more (e.g.,
  • amino acid residues 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more amino acid residues.
  • "one or more" can be 1-100, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, 1,
  • one or more methylene units of L are independently replaced with an amino acid residue. In some embodiments, one or more methylene units of L are independently replaced with an amino acid residue, wherein the amino acid residue is of an amino acid of formula A-l or a salt thereof. In some embodiments, one or more methylene units of L are independently replaced with an amino acid residue, wherein each amino acid residue independently has the structure of -N(R al )-L al -C(R a2 )(R a3 )-L a2 -CO- or a salt form thereof.
  • a linker moiety comprises one or more moieties, e.g., amino, carbonyl, etc., that can be utilized for connection with other moieties.
  • a linker moiety comprises one or more -NR'-, wherein R' is as described in the present disclosure.
  • -NR'- improves solubility.
  • -NR'- serves as connection points to another moiety.
  • R' is -H.
  • one or more methylene units of L are independently replaced with -NR'-, wherein R' is as described in the present disclosure.
  • a linker moiety e.g., L
  • L comprises a -C(O)- group, which can be utilized for connections with a moiety.
  • one or more methylene units of L are independently replaced with -C(O)-.
  • a linker moiety e.g., L
  • L comprises a -NR'- group, which can be utilized for connections with a moiety.
  • one or more methylene units of L are independently replaced with -N(R')-.
  • a linker moiety e.g., L
  • L comprises a -C(O)NR'- group, which can be utilized for connections with a moiety.
  • one or more methylene units of L are independently replaced with -C(O)N(R')-.
  • a linker moiety e.g., L
  • L comprises a -C(R')2- group.
  • one or more methylene units of L are independently replaced with -C(R')2-.
  • -C(R')2- is -CHR'-.
  • R' is -(CH 2 ) 2 C(O)NH(CH 2 ) II C00H.
  • R' is -(CI-h COOH.
  • R' is -COOH.
  • a linker moiety is or comprises one or more ring moieties, e.g., one or more methylene units of L are replaced with -Cy-.
  • a linker moiety, e.g., L comprises an aryl ring.
  • a linker moiety, e.g., L comprises an heteroaryl ring.
  • a linker moiety, e.g., L comprises an aliphatic ring.
  • a linker moiety comprises an heterocyclyl ring.
  • a linker moiety e.g., L
  • a ring in a linker moiety, e.g., L is 3-20 membered.
  • a ring is 5-membered.
  • a ring is 6-membered.
  • a ring in a linker is product of a cycloaddition reaction (e.g., click chemistry, and variants thereof) utilized to link different moieties together.
  • a linker moiety (e.g., L) is or comprises .
  • a methylene unit of L is replaced with In some embodiments,
  • N N a methylene unit of L is replaced with -Cy-.
  • -Cyy- is [0256]
  • a linker moiety e.g., L
  • L is or comprises -Cy-.
  • a methylene unit of L is replaced with -Cy-.
  • -Cy- is
  • a linker moiety e.g., L, comprises
  • L RM is a covalent bond. In some embodiments, L RM is not a covalent bond. In some embodiments, L RM is or comprises -(CbhCbhOjn-. In some embodiments, L RM is or comprises -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L RM is -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted.
  • L RM is -(CH 2 ) 2 -O-(CH 2 CH 2 0)n-(CH 2 ) 2 -, wherein n is as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L RM is -(CH 2 )2-0-(CH 2 CH 2 0)n-(CH 2 )2-, wherein n is as described herein.
  • L PM is a covalent bond. In some embodiments, L PM is not a covalent bond. In some embodiments, L PM is or comprises -(CbhCbhOjn-. In some embodiments, L PM is or comprises -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L PM is -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently as described herein, and each -CH 2 - is independently optionally substituted.
  • L PM is -(CH 2 ) 2 -O-(CH 2 CH 2 0)n-(CH 2 ) 2 -, wherein n is as described herein, and each -CH 2 - is independently optionally substituted. In some embodiments, L PM is -(CH 2 )2-0-(CH 2 CH 2 0)n-(CH 2 )2-, wherein n is as described herein.
  • L PM (e.g., in a product of a first and a second agents) is or comprises a reaction product moiety formed a first reactive moiety and a second reactive moiety.
  • a linker moiety (e.g., L PM in a product of a first and a
  • a methylene unit of a linker moiety e.g., L or a linker moiety that can be L (e.g., L RM , L PM , etc.) is replaced with -Cy-.
  • N N some embodiments, -Cy- is optionally substituted . In some embodiments, -Cy- is , . In some embodiments, -Cy- is . n some em o ments, - y- s
  • the moiety of interest is or comprises monomethyl auristatin E (MMAE), or a close analog of MMAE.
  • MMAE monomethyl auristatin E
  • the moiety of interest is or comprises
  • MMAE is an anti-neoplastic agent that is used in drug-antibody conjugates, e.g. a MAB- MMAE conjugate.
  • the MMAE is joined to a monoclonal antibody through a linking structure that can be cleaved once the drug-antibody conjugate has attached to the tumor cell.
  • the linking structure includes a cathepsin-cleavable sequence (Valine-Citrulline) and a spacer. The spacer may be varied.
  • the moiety of interest is or comprises MMAF, that is monomethyl auristatin F or desmethyl-auristatin F, shown below with its linking structure.
  • a provided method further comprises: reacting a first agent comprising a first reactive moiety, e.g., in a first moiety of interest, with a second agent comprising a second reactive moiety.
  • a first reactive moiety is in a first moiety of interest, e.g., which can be incorporated through a method described herein (e.g., via contacting with a compound having the structure of formula R-l or a salt thereof).
  • a second moiety of interest is in a compound which comprises no target binding moieties.
  • a second moiety of interest is in a compound of formula P-l or P-ll, or a salt thereof.
  • a second moiety of interest is in a compound of R-l or a salt thereof.
  • a second agent has the structure of formula P-l or P-ll, or a sat thereof.
  • a second reactive moiety is in a moiety of interest of a second agent.
  • a second agent comprises a target agent moiety as described herein.
  • a target agent moiety in a second agent is or comprises a peptide moiety.
  • a target agent moiety in a second agent is or comprises an antibody agent moiety as described herein. In some embodiments, it comprises a scFv moiety.
  • a target agent moiety in a second agent provides different specificity compared to that of a first agent.
  • such first and second agents react with each other to provide various product agents comprising moieties having different specificities as described herein.
  • a reaction between a first reactive moiety and a second reactive moiety is a bioorthogonal reaction.
  • a reaction is a cycloaddition reaction.
  • a reaction is a [3+2] reaction. Suitable such reactions and corresponding first and second reactive moieties are widely known in the art and can be utilized in accordance with the present disclosure.
  • a first reactive moiety is or comprises -IM3, and a second reactive moiety is or comprises - o- (e.g., an alkyne moiety suitable for click chemistry, including those suitable for metal-free click chemistry).
  • a second reactive moiety is or comprises -IM3, and a first reactive moiety is or comprises - o- (e.g., an alkyne moiety suitable for click chemistry, including those suitable for metal-free click chemistry).
  • a reaction between a first reactive moiety and a second reactive moiety is an enzymatic reaction.
  • a reaction is a sortase-mediated reaction.
  • each of the first and second reactive moiety independently is or comprises a substrate moiety for a reaction, e.g., an enzymatic reaction.
  • a reactive moiety is or comprises (G)n (e.g., n is 3, 4, 5, etc.), and a reactive moiety is or comprises LPXTG (e.g., LPETG).
  • a reactive moiety is or comprises LPXTG- (X)n (e.g., LPETG-(X)n, LPETG-XX, etc.).
  • LPXTG- (X)n e.g., LPETG-(X)n, LPETG-XX, etc.
  • a second agent is or comprises a second moiety of interest which is a moiety of interest as described herein.
  • a second reactive moiety and a second moiety of interest is connected through a linker (e.g., a linker as described herein (e.g., L PM , L, etc. as described herein).
  • a second moiety of interest is as described herein (e.g., a detection moiety, a therapeutic moiety, a moiety of interest which can interact, recognize and/or bind proteins, nucleic acids, immune cells, disease cells, etc.).
  • a second moiety of interest is or comprises an antibody agent.
  • a second moiety of interest is or comprises a scFv antibody agent. In some embodiments, such an antibody agent has different specificity compared to the initial target antibody agent.
  • the present disclosure provides bispecific antibody agents, compositions, and methods thereof.
  • a target agent is or comprises a first antibody agent, and it is conjugated with a moiety of interest comprising a first reactive moiety.
  • an agent comprising a first antibody agent and a first reactive moiety is reacted with a second agent comprising a second reactive moiety and a second moiety of interest which is or comprises a second antibody agent to provide an agent comprising a first and a second antibody agents.
  • a first and a second antibody agents are different. In some embodiments, they are the same.
  • an agent comprises two or more antibody agent moieties. In some embodiments, antibody agent moieties in a single agent molecule have different target specificity. In some embodiments, some or all antibody agent moieties in a single agent molecule have the same target specificity. In some embodiments, an agent as described herein is or comprises moieties having different target specificity (e.g., antibody moieties having different target specificity). In some embodiments, an agent is a bispecific antibody agent.
  • an agent comprises a first moiety (e.g., a first antibody agent moiety) and a second moiety (e.g., a second antibody agent moiety).
  • a first moiety e.g., a first antibody agent moiety
  • a second moiety e.g., a second antibody agent moiety
  • a second moiety is or comprises an antibody agent moiety or a fragment thereof (e.g., Fc region or a fragment thereof) to which a target binding moiety may bind.
  • an antibody agent moiety e.g., a second antibody agent moiety
  • an antibody agent moiety e.g., a second antibody agent moiety
  • an antibody agent moiety, e.g., a second antibody agent moiety is or comprises scFv.
  • a first moiety is or comprises an agent moiety of a first agent.
  • a second moiety is or comprises a moiety of interest of a second agent.
  • a first agent e.g., one comprising a first antibody agent moiety
  • a second agent e.g., one comprising a second antibody agent moiety
  • a moiety e.g., a first moiety
  • a target e.g., a protein, lipid, carbohydrate, object, etc.
  • a moiety, e.g., a first moiety is or comprises a moiety of an antibody agent suitable for preventing or treating a condition, disorder or disease, e.g., cancer.
  • a moiety, e.g., a first moiety is or comprises a moiety of an antibody agent which targets cancer cells, tissues, organs, etc.
  • a first moiety is or comprises a moiety of an anti-CD20 antibody or a fragment thereof.
  • a first moiety is or comprises rituximab or a fragment thereof.
  • a moiety, e.g., a second moiety is a second moiety of interest.
  • a moiety, e.g., a second moiety is or comprises an antibody agent moiety that can recruit and/or activate an immune activity, e.g. one or more immune cells.
  • a moiety, e.g., a second moiety is or comprises an antibody agent moiety which can recruit and/or activate T cells.
  • a moiety e.g., a second moiety is or comprises a moiety of an anti-CDB antibody or fragment thereof.
  • an atnti-CDB antibody is a CD3-directed scFv.
  • a moiety, e.g., a first moiety is a target agent moiety.
  • a provided agent comprises an anti-CD20 moiety and an anti-CD3 moiety.
  • a provided agent comprises an anti-CD20 moiety and an anti-CD3 moiety, wherein the two moieties are linked by a linker.
  • a linker comprises moieties that are not amino acid residues.
  • a linker comprises moieties that are not natural proteinogenic amino acid residues.
  • a linker is a linker moiety as described herein.
  • agents comprising two or more target-specific moieties e.g., antibody agent moieties
  • ком ⁇ онентs can readily conjugate antibody agents, e.g., those readily available (e.g., "off-the-shelf” therapeutic antibodies) with other moieties, e.g., in some embodies other antibody agents, to, e.g., produce bispecific agents.
  • a first and a second moiety is linked by a linker as described herein.
  • a provided product agent comprises a linker moiety connecting a target agent moiety and a second moiety of interest (e.g., two antibody agent moieties).
  • a linker is or comprises one or more of L RG2 , L PM or fragments thereof, and one or more moiety formed by a first and second reactive moieties (e.g., for click chemistry, a triazole moiety).
  • a linker is or comprises a product linker moiety, e.g., one formed by a reaction between a first and a second reactive moiety.
  • a product linker moiety is or comprise LPXTG.
  • a product linker moiety is or comprise LPXT(G)n, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • a product linker moiety is or comprises a bioorthogonal reaction product moiety, e.g., a click chemistry reaction product moiety.
  • an agent comprising a second reactive moiety and a second moiety of interest is prepared using a technology provided herein.
  • a second moiety of interest is or comprises a protein agent moiety.
  • a second moiety of interest is or comprises an antibody agent moiety.
  • a second moiety of interest e.g., a protein agent (e.g., an antibody agent)
  • a second reactive moiety can serve as a moiety of interest (e.g., MOI in a compound of formula R-l or a salt thereof), for utilization of certain provided methods (e.g., comprising reacting target agents (e.g., protein agents (e.g., antibody agents, etc.)) with reaction partners comprising moieties of interest (e.g., those that are or comprise second reactive moieties), reactive groups and target binding moieties that can bind to target agents to provide second agents).
  • target agents e.g., protein agents (e.g., antibody agents, etc.
  • reaction partners comprising moieties of interest (e.g., those that are or comprise second reactive moieties), reactive groups and target binding moieties that can bind to target agents to provide second agents).
  • each of a first agent and a second agent is independently and optionally an agent of formula P-l or P-ll, or a salt thereof. In some embodiments, each of a first agent and a second agent is independently an agent of formula P-l or P-ll, or a salt thereof. In some embodiments, at least one of a first agent and a second agent is prepared using a method of the present disclosure. In some embodiments, each of a first agent and a second agent is independently prepared using a method of the present disclosure. In some embodiments, a target agent moiety of a first agent is an antibody agent. In some embodiments, a moiety of interest of a first agent is or comprises a first reactive moiety.
  • a target agent moiety of a second agent is an antibody agent.
  • a moiety of interest of a second agent is or comprises a second reactive moiety.
  • a first reactive moiety and a second reactive moiety can react with each to provide a product agent.
  • a reaction between a first and a second reactive moieties is or comprises a reaction compatible with target agents in the first and second agents, e.g., compatible with protein agents (e.g., antibody agents).
  • a reaction is a bioorthogonal reaction.
  • such a reaction is a cycloaddition reaction.
  • such a reaction is a click reaction.
  • a reaction is a metal free click reaction.
  • a product agent is of formula P-l or P-ll, or a salt thereof.
  • a target agent moiety is a protein agent (e.g., an antibody agent), and in some embodiments, a target agent moiety of a first agent.
  • a moiety of interest is a protein agent (e.g., an antibody agent), and in some embodiments, a target agent moiety of a second agent.
  • a product agent comprises two or more antibody agents.
  • the two or more antibody agents have different antigen specificity. In some embodiments, the two or more antibody agents are toward different antigens. In some embodiments, a provided method comprises: reacting a first agent which has the structure of formula P-l or P-ll, or a salt thereof with a second agent which has the structure of formula P-l or P-ll, or a salt thereof to provide a product agent.
  • provided technologies comprise contacting a target agent (e.g., to which a moiety of interest is to be attached) with a reaction partner.
  • a target agent e.g., to which a moiety of interest is to be attached
  • contact is performed under conditions and for a time so that a target agent react with a reaction partner to form an agent as a product.
  • a target agent e.g., to which a moiety of interest is to be attached
  • contact is performed under conditions and for a time so that a target agent react with a reaction partner to form an agent as a product.
  • an agent formed comprises a target agent moiety, a moiety of interest and optionally a linker moiety connecting a target agent moiety and a moiety of interest.
  • a target agent moiety is derived from a target agent (e.g., by removing one or more -H from a target agent).
  • a target agent moiety maintains one or more, most, or substantially all structural features and/or biological functions of a target agent.
  • a target agent is an antibody agent
  • a target agent moiety in a formed agent is a corresponding antibody agent moiety and maintains major functions of the antibody agent, e.g., interacting with various receptors (e.g., Fc receptors such as FcRn), recognizing antigen with specificity, triggering, promoting, and/or enhancing immunological activities toward diseased cells, etc., as the antibody agent.
  • a formed agent provides one or more functions beyond those of a target agent, for example, from a moiety of interest and/or a formed agent as a whole.
  • an agent formed has the structure of formula P-l or P-ll, or a salt thereof.
  • a moiety of interest in a formed agent e.g., MOI of formula P-l or P-ll, or a salt thereof
  • a reaction partner e.g., MOI of formula R-l or a salt thereof
  • P is a protein moiety.
  • P is an antibody moiety.
  • linker moieties (or a part thereof) connected to moieties of interest may also be transferred from reaction partners (e.g., L RM of formula R-l or a salt thereof).
  • a linker moiety in a formed agent e.g., L PM
  • a linker moiety in a reaction partner e.g., one between a reactive group and a moiety of interest, e.g., L RM ).
  • L PM is or comprises L RM .
  • L PM is _I_RM_
  • L RG2 is -C(O)-.
  • L RG2 is -C(O)-, and is bonded to -NH- of a target agent moiety, e.g., -NH- in a side chain of a lysine residue of a protein moiety, which in some embodiments, is an antibody moiety.
  • Reaction partners typically do not contain moieties that can react with reactive groups under conditions under which reactive groups react with target agents.
  • moieties in reaction partners may react with reactive groups under conditions under which reactive groups react with target agents, reactions between such moieties and reactive groups are significantly slower and/or less efficient compared to reactions between reactive groups and target agents.
  • reactions between such moieties and reactive groups do not significantly reduce (e.g., no more than about 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, etc.
  • reactive groups e.g., ester groups, activated carboxylic acid derivatives, etc.
  • amino groups e.g., -IMH2 groups
  • target agents e.g., protein agents such as antibody agents.
  • reaction partners e.g., compounds of formula R-l or salts thereof, do not contain amine groups.
  • compounds of formula R-l or salts thereof do not contain amine groups. In some embodiments, they do not contain primary amine groups (-NH2). In some embodiments, they do not contain -CH 2 NH2. In some embodiments, they do not contain -CH 2 CH 2 NH2. In some embodiments, they do not contain -CH 2 CH 2 CH 2 NH2. In some embodiments, they do not contain -CH 2 CH 2 CH 2 NH2. In some embodiments, they do not contain -CH 2 CH 2 CH 2 CH 2 NH2.
  • amine groups e.g., primary amine groups
  • acyl groups e.g., R-C(O)- (e.g., acetyl)
  • amide groups e.g., amide groups
  • a buffer is a phosphate buffer.
  • a buffer is a PBS buffer.
  • a buffer is a borate buffer.
  • buffers of the present disclosure provide and optionally maintain certain pH value or range.
  • a useful pH is about 7-9, e.g., 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 9.0, etc.
  • a pH is 7.4. In some embodiments, a pH is 7.5. In some embodiments, a pH is 7.8. In some embodiments, a pH is 8.0. In some embodiments, a pH is 8.2. In some embodiments, a pH is 8.3.
  • connection of a moiety of interest in a provided reaction partner e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-l or a salt thereof)
  • a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-l or a salt thereof)
  • a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-l or a salt thereof)
  • a target agent e.g., a compound comprising a reactive group located between a first group and a moiety of interest (e.g., a compound of formula R-l or a salt thereof)
  • no separate reactions/steps are performed to remove target binding moieties.
  • target binding moiety removal can improve overall efficiency (e.g., by simplify operations, increasing overall yield, etc.), reduce manufacturing cost, improve product purity (e.g., by avoiding exposure to target binding moiety removal conditions, which typically involve one or more of reduction, oxidation, hydrolysis (e.g., of ester groups), etc., conditions and may damage target agent moieties (e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post- translational modifications (e.g., glycans of antibodies) thereof.
  • target agent moieties e.g., for protein agent moieties, protein amino acid residues, overall structures, and/or post- translational modifications (e.g., glycans of antibodies) thereof.
  • provided technologies among other things can provided improved efficiency (e.g., in terms of reaction rates and/or conversion percentages), increased yield, increased purity/homogeneity, and/or enhanced selectivity, particularly compared to reference technologies wherein a reaction partner containing no target binding moieties is used, without introducing step(s) for target binding moiety removal (e.g., target binding moiety is removed in the same step as moiety of interest conjugation).
  • improved efficiency e.g., in terms of reaction rates and/or conversion percentages
  • increased yield increased purity/homogeneity
  • enhanced selectivity particularly compared to reference technologies wherein a reaction partner containing no target binding moieties is used, without introducing step(s) for target binding moiety removal (e.g., target binding moiety is removed in the same step as moiety of interest conjugation).
  • the present disclosure provides products of provided processes, which, among other things, contain low levels of damage to target agent moieties compared to processes comprising steps which are performed for target binding moiety removal but not for substantial moiety of interest conjugation.
  • provided product compositions have high homogeneity compared to reference product compositions (e.g., those from technologies without using target binding moieties, or utilizing extra step(s) for target binding moiety removal (e.g., not utilizing reaction partners described herein which comprise a reactive group located between a target binding moiety and a moiety of interest).
  • a product agent is an agent comprising: a target agent moiety; a moiety of interest, such as MMAD; and optionally one or more linker moieties.
  • a target agent moiety is a protein agent moiety.
  • a target agent moiety is an antibody agent moiety.
  • an antibody agent moiety comprises IgG Fc region.
  • a target agent moiety is connected to a moiety of interest through an amino group optionally through a linker. In some embodiments, it is through a lysine residue wherein the amino group of the side chain is connected to a moiety of interest optionally through a linker (e.g., forming -NH-C(O)- as part of an amide group, a carbamate group, etc.).
  • K246 or K248 of an antibody agent are conjugation locations.
  • a conjugation location is K246 of heavy chain (unless otherwise specified, locations herein include corresponding residues in, e.g., modified sequence (e.g., longer, shorter, rearranged, etc., sequences)).
  • a location is K248 of heavy chain.
  • a location is K288 or K290 of heavy chain.
  • a location is K288 of heavy chain.
  • a location is K290 of heavy chain.
  • a location is K317.
  • target agents are antibody agents
  • heavy chains are selectively labeled over light chains.
  • a ratio is about 0.5-6, e.g., 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, etc.).
  • a ratio is about 0.5-2.5.
  • a ratio is about 0.5-2.
  • a ratio is about 1-2.
  • a ratio is about 1.5-2. In some embodiments, a ratio is of moieties of interest conjugated to target agent moieties and target agent moieties conjugated to moieties of interest. In some embodiments, a ratio is of moieties of interest conjugated to target agent moieties and all target agent moieties in a composition.
  • agents e.g., agents of formula P-l or P-ll, or a salt thereof
  • substantially all conjugation sites of target agent moieties have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties). In some embodiments, no conjugation sites bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
  • compositions comprising a plurality of provided agents (e.g., agents of formula P-l or P-ll, or a salt thereof) substantially all conjugation sites of target agent moieties have the same modifications (e.g., all share the same moieties of interest optionally connected through the same linker moieties).
  • no conjugation sites bear different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
  • such compositions do not contain agents that share the same (or substantially the same) target agent moieties but different modifications (e.g., different moieties of interest and/or no moieties of interest and/or different linker moieties).
  • agents that share the same (or substantially the same) target agent moieties but different modifications are intermediates of multiple-step preparations (e.g., comprising steps for removal of target binding moieties in addition to steps for moiety of interest conjugation) of final product agents.
  • the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: a target agent moiety, a moiety of interest, and optionally a linker moiety linking a target agent moiety and a moiety of interest; wherein agents of the plurality share the same or substantially the same target agent moiety, and a common modification independently at at least one common location; and wherein about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality.
  • a target agent moiety is or comprises a protein moiety.
  • agents of the plurality share common modifications (e.g., conjugations of moieties of interest optionally through linker moieties) independently at at least one amino acid residues.
  • agents of the plurality are each independently of formula P-l or P-ll, or a salt thereof.
  • the present disclosure provides a composition comprising a plurality of agents each of which independently comprising: a protein agent moiety, a moiety of interest, and optionally a linker moiety linking the protein agent moiety and a moiety of interest; wherein protein agent moieties of agents of the plurality comprise a common amino acid sequence, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality.
  • agents of the plurality are each independently of formula
  • each protein agent moiety is independently an antibody agent moiety.
  • the present disclosure provides a composition
  • a composition comprising a plurality of agents each of which independently comprising: an antibody agent moiety, a moiety of interest, and optionally a linker moiety linking an antibody agent moiety and a moiety of interest; wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence or can bind to a common antigen, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality.
  • agents of the plurality are each independently of formula
  • antibody agent moieties of agents of the plurality comprise a common amino acid sequence. In some embodiments, antibody agent moieties of agents of the plurality comprise a common amino acid sequence in a Fc region. In some embodiments, antibody agent moieties of agents of the plurality comprise a common Fc region. In some embodiments, antibody agent moieties of agents of the plurality can bind a common antigen specifically. In some embodiments, antibody agent moieties are monoclonal antibody moieties. In some embodiments, antibody agent moieties are polyclonal antibody moieties. In some embodiments, antibody agent moieties bind to two or more different antigens. In some embodiments, antibody agent moieties bind to two or more different proteins. In some embodiments, antibody agent moieties are IVIG moieties.
  • "at least one" or “one or more” is 1-1000, 1-500, 1-200, 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more.
  • it is one. In some embodiments, it is two or more. In some embodiments, it is about 3. In some embodiments, it is about 4. In some embodiments, it is about 5. In some embodiments, it is about 6. In some embodiments, it is about 7. In some embodiments, it is about 8. In some embodiments, it is about 9. In some embodiments, it is about 10. In some embodiments, it is about 10 or more.
  • a common amino acid sequence comprises 1-1000, 1-
  • a length is at least 5 amino acid residues. In some embodiments, a length is at least 10 amino acid residues. In some embodiments, a length is at least 50 amino acid residues. In some embodiments, a length is at least 100 amino acid residues. In some embodiments, a length is at least 150 amino acid residues. In some embodiments, a length is at least 200 amino acid residues. In some embodiments, a length is at least 300 amino acid residues. In some embodiments, a length is at least 400 amino acid residues. In some embodiments, a length is at least 500 amino acid residues. In some embodiments, a length is at least 600 amino acid residues.
  • a common amino acid sequence is at least 10%-100%
  • a target agent moiety 50%-100%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of an amino acid sequence of a target agent moiety, a protein agent moiety, an antibody agent moiety, etc. In some embodiments, it is 100%.
  • protein agent moieties share a high percentage of amino acid sequence homology. In some embodiments, it is 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%.
  • it is at least 80%. In some embodiments, it is at least 90%. In some embodiments, it is at least 91%. In some embodiments, it is at least 50%. In some embodiments, it is at least 92%. In some embodiments, it is at least 93%. In some embodiments, it is at least 94%. In some embodiments, it is at least 95%. In some embodiments, it is at least 96%. In some embodiments, it is at least 97%. In some embodiments, it is at least 98%. In some embodiments, it is at least 99%.
  • a protein agent moiety or an antibody agent moiety is or comprises a protein complex.
  • at least one or each individual chain shares a common amino acid sequence and/or has a homology as described herein.
  • agents of a plurality share a common moiety of interest.
  • each agent of a plurality is independently an agent of formula P-l or P-ll, or a salt thereof. In some embodiments, each agent of a plurality is independently an agent of formula P-l or P-ll, or a salt thereof, wherein MOI is the same for each agent of the plurality. In some embodiments, agents of a plurality are products of methods described herein. In some embodiments, compositions comprising agents of a plurality are products of methods described herein.
  • a modification is or comprises a moiety of interest and optionally a linker. In some embodiments, a modification is or comprises -L PM -MOI.
  • agents of the plurality share a common modification independently at at least one location.
  • a modification is or comprises a moiety of interest and optionally a linker connecting the moiety of interest.
  • each location independently has its common modification.
  • common modifications at two or more or all locations comprise a common moiety of interest.
  • common modifications are the same.
  • agents of the plurality share a common modification at each location which has a modification that is or comprises a moiety of interest and optionally a linker.
  • agents of the plurality share a common modification at each location which has a modification that is or comprises -L PM -MOI.
  • protein agents e.g., antibody agents
  • a common modification at least one amino acid residue In some embodiments, agents of the plurality share a common modification at each location which has a modification that is or comprises a moiety of interest and optionally a linker. In some embodiments, agents of the plurality share a common modification at each location which has a modification that is or comprises -L PM -MOI.
  • a location is selected from K246, K248, K288, K290, K317 of antibody agents and locations corresponding thereto. In some embodiments, a location is selected from K246 and K248, and locations corresponding thereto.
  • a location is selected from K288 and K290, and locations corresponding thereto.
  • a location is K246 or a location corresponding thereto.
  • a location is K248 or a location corresponding thereto.
  • a location is K288 or a location corresponding thereto.
  • a location is K290 or a location corresponding thereto.
  • a location is K317 or a location corresponding thereto.
  • a location is K185 of light chain or a location corresponding thereto.
  • a location is K187 of light chain or a location corresponding thereto.
  • a location is K133 of heavy chain or a location corresponding thereto. In some embodiments, a location is K246 or K248 of heavy chain or a location corresponding thereto. In some embodiments, a location is K414 of heavy chain or a location corresponding thereto.
  • about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality. In some embodiments, about 1%- 100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality. In some embodiments, about 1%- 100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality. In some embodiments, about 1%-100% of all agents that comprise a target agent moiety are agents of the plurality.
  • about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence are agents of the plurality. In some embodiments, about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen are agents of the plurality. In some embodiments, it is 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%.
  • it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%. In some embodiments, it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%. In some embodiments, it is at least 90%. In some embodiments, it is at least 91%. In some embodiments, it is at least 50%. In some embodiments, it is at least 92%. In some embodiments, it is at least 93%. In some embodiments, it is at least 94%. In some embodiments, it is at least 95%. In some embodiments, it is at least 96%. In some embodiments, it is at least 97%. In some embodiments, it is at least 98%. In some embodiments, it is at least 99%.
  • provided agents, compounds, etc. e.g., those of formula
  • R-l, P-l, P-ll, etc. and salts thereof have high purity. In some embodiments, it is 50%-100%. In some embodiments, it is 50%. In some embodiments, it is 60%. In some embodiments, it is 70%. In some embodiments, it is 80%. In some embodiments, it is 90%. In some embodiments, it is 91%. In some embodiments, it is 50%. In some embodiments, it is 92%. In some embodiments, it is 93%. In some embodiments, it is 94%. In some embodiments, it is 95%. In some embodiments, it is 96%. In some embodiments, it is 97%. In some embodiments, it is 98%. In some embodiments, it is 99%. In some embodiments, it is 100%.
  • it is at least 50%. In some embodiments, it is at least 60%. In some embodiments, it is at least 70%. In some embodiments, it is at least 80%. In some embodiments, it is at least 90%. In some embodiments, it is at least 91%. In some embodiments, it is at least 50%. In some embodiments, it is at least 92%. In some embodiments, it is at least 93%. In some embodiments, it is at least 94%. In some embodiments, it is at least 95%. In some embodiments, it is at least 96%. In some embodiments, it is at least 97%. In some embodiments, it is at least 98%. In some embodiments, it is at least 99%.
  • a product agent composition comprising product agents (e.g., agents of formula P-l or P-ll, or a salt thereof).
  • a product agent composition e.g., a formed agent composition from certain methods
  • released target binding moieties may bind to target agent moieties in target agents and/or formed product agents.
  • Various technologies are available to separate released target binding moieties from target agent moieties in accordance with the present disclosure, for example, in some embodiments, contacting a composition with a composition comprising glycine at certain pH.
  • ABT is an antibody binding moiety as described herein.
  • an ABT is an ABT of a compound selected from MMAE-1, MMAE-2, MMAE-3, MMAE-4, MMAE-5, MMAE-6, and MMAE-7. In some embodiments, an ABT is a moiety selected from Table A-l.
  • L is a linker moiety of a compound selected from those depicted in compounds MMAE-1, MMAE-2, MMAE-3, MMAE-4, MMAE-5, MMAE-6, and MMAE- 7.
  • LG or transformation condition
  • other protecting groups, leaving groups, and transformation conditions are also suitable and are contemplated.
  • Such groups and transformations are described in detail in March's Advanced Organic Chemistry: Reactions, Mechanisms, and Structure, M. B. Smith and J. March, 5 th Edition, John Wiley & Sons, 2001, Comprehensive Organic Transformations, R. C. Larock, 2 nd Edition, John Wiley & Sons, 1999, and Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of each of which is hereby incorporated herein by reference.
  • leaving groups include but are not limited to, halogens
  • sulfonates e.g. mesylate, tosylate, benzenesulfonate, brosylate, nosylate, triflate
  • diazonium e.g. fluoride, chloride, bromide, iodide
  • fluoride e.g. fluoride, chloride, bromide, iodide
  • sulfonates e.g. mesylate, tosylate, benzenesulfonate, brosylate, nosylate, triflate
  • diazonium e.g. fluoride, chloride, bromide, iodide
  • an oxygen protecting group includes, for example, carbonyl protecting groups, hydroxyl protecting groups, etc.
  • Hydroxyl protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
  • suitable hydroxyl protecting groups include, but are not limited to, esters, allyl ethers, ethers, silyl ethers, alkyl ethers, arylalkyl ethers, and alkoxyalkyl ethers.
  • esters include formates, acetates, carbonates, and sulfonates.
  • Specific examples include formate, benzoyl formate, chloroacetate, trifluoroacetate, methoxyacetate, triphenylmethoxyacetate, p-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate, 4,4-(ethylenedithio)pentanoate, pivaloate (trimethylacetyl), crotonate, 4-methoxy-crotonate, benzoate, p-benylbenzoate, 2,4,6- trimethylbenzoate, carbonates such as methyl, 9-fluorenylmethyl, ethyl, 2,2,2-trichloroethyl, 2- (trimethylsilyl)ethyl, 2-(phenylsulfonyl)ethyl, vinyl, allyl, and p-nitrobenzyl.
  • silyl ethers examples include trimethylsilyl, triethylsilyl, t-butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and other trialkylsilyl ethers.
  • Alkyl ethers include methyl, benzyl, p- methoxybenzyl, 3,4-dimethoxybenzyl, trityl, t-butyl, allyl, and allyloxycarbonyl ethers or derivatives.
  • Alkoxyalkyl ethers include acetals such as methoxymethyl, methylthiomethyl, (2- methoxyethoxy)methyl, benzyloxymethyl, beta-(trimethylsilyl)ethoxymethyl, and tetrahydropyranyl ethers.
  • arylalkyl ethers include benzyl, p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p- cyanobenzyl, and 2- and 4-picolyl.
  • Amino protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, the entirety of which is incorporated herein by reference.
  • Suitable amino protecting groups include, but are not limited to, aralkylamines, carbamates, cyclic imides, allyl amines, amides, and the like.
  • Examples of such groups include t-butyloxycarbonyl (BOC), ethyloxycarbonyl, methyloxycarbonyl, trichloroethyloxycarbonyl, allyloxycarbonyl (Alloc), benzyloxocarbonyl (CBZ), allyl, phthalimide, benzyl (Bn), fluorenylmethylcarbonyl (Fmoc), formyl, acetyl, chloroacetyl, dichloroacetyl, trichloroacetyl, phenylacetyl, trifluoroacetyl, benzoyl, and the like.
  • compounds/agents may contain one or more stereocenters, and may be present as a racemic or diastereomeric mixture.
  • One of skill in the art will also appreciate that there are many methods known in the art for the separation of isomers to obtain stereoenriched or stereopure isomers of those compounds, including but not limited to HPLC, chiral HPLC, fractional crystallization of diastereomeric salts, kinetic enzymatic resolution (e.g. by fungal-, bacterial-, or animal-derived lipases or esterases), and formation of covalent diastereomeric derivatives using an enantioenriched reagent.
  • compositions may be provided as in various forms according to desired uses. In some embodiments, they are provided as pharmaceutical compositions. As appreciated by those skilled in the art, in many instances, pharmaceutical compositions comprise controlled amounts and are manufactured for administration to subjects such as human patients. In some embodiments, the present disclosure provides a composition comprising a compound, an agent, and/or a composition described herein or a pharmaceutically acceptable derivative thereof and a pharmaceutically acceptable carrier. In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound, agent or composition of the present disclosure and a pharmaceutically acceptable carrier.
  • the present disclosure provides a pharmaceutical composition comprising a therapeutically effective amount of a compound, an agent or a composition of the present disclosure and a pharmaceutically acceptable carrier.
  • a pharmaceutical composition is packaged for storage, transportation, administration, etc.
  • a pharmaceutical composition does not contain a significant amount of organic solvents (e.g., total amount of organic solvents no more than 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, or 1% of weight and/or volume of a pharmaceutical composition).
  • a pharmaceutically acceptable carrier is or comprises a non-toxic carrier, adjuvant, or vehicle that does not destroy the pharmacological activity of the compound with which it is formulated.
  • Pharmaceutically acceptable carriers, adjuvants or vehicles that may be include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat
  • a pharmaceutically acceptable derivative is a non-toxic salt, ester, salt of an ester or other derivative of a compound that, upon administration to a recipient, is capable of providing, either directly or indirectly, a compound or an active metabolite or residue thereof.
  • compositions may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
  • parenteral administration includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques.
  • compositions are administered orally, intraperitoneally or intravenously.
  • Sterile injectable forms of compositions may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3- butanediol.
  • a non-toxic parenterally acceptable diluent or solvent for example as a solution in 1,3- butanediol.
  • acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • a bland fixed oil may be employed including synthetic mono- or di-glycerides.
  • Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
  • These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
  • Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.
  • compositions may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
  • carriers commonly used include lactose and corn starch.
  • Lubricating agents such as magnesium stearate, are also typically added.
  • useful diluents include lactose and dried cornstarch.
  • aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
  • compositions may be administered in the form of suppositories for rectal administration.
  • these can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug.
  • suitable non-irritating excipient include cocoa butter, beeswax and polyethylene glycols.
  • pharmaceutically acceptable compositions may be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs.
  • Topical application for the lower intestinal tract can be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used.
  • compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers.
  • Carriers for topical administration of compounds of this disclosure include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
  • provided pharmaceutically acceptable compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers.
  • Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
  • compositions may be formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride.
  • the pharmaceutically acceptable compositions may be formulated in an ointment such as petrolatum.
  • compositions may also be administered by nasal aerosol or inhalation.
  • Such compositions are prepared according to techniques well-known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.
  • compositions are formulated for oral administration. Such formulations may be administered with or without food. In some embodiments, pharmaceutically acceptable compositions are administered without food. In other embodiments, pharmaceutically acceptable compositions are administered with food.
  • Amounts of compounds that may be combined with the carrier materials to produce a composition in a single dosage form will vary depending upon the host treated, the particular mode of administration. In some embodiments, provided compositions are formulated so that a dosage of between 0.01 - 100 mg/kg body weight/day of the inhibitor can be administered to a patient receiving these compositions.
  • the present invention is directed to compositions that include therapy enhancer agents containing moieties of interest conjugated to target agent moieties at specific locations.
  • composition including: a first compound having the structure of formula (P-ll):
  • P-N is a protein agent moiety including a lysine residue
  • L PM is a linker
  • MOI is a moiety of interest comprising monomethyl auristatin E (MMAE); and a second compound having the structure:
  • LG-OH (LG-I) wherein LG is a group including a target binding moiety that binds to a target agent.
  • composition further includes: a third compound having the formula (R-l):
  • LG is a group including a target binding moiety that binds to a target agent, which is identical to LG in formula (LG-I);
  • RG is a reactive group
  • L RM is a linker, which is identical to in formula (P-ll); and MOI is a moiety of interest comprising monomethyl auristatin E (MMAE).
  • MMAE monomethyl auristatin E
  • the compositions may include the first and second compounds in equimolar amount.
  • the amount of the second compound may be 50 mole percent (mole%) or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 50 mole% or less, 45 mole% or less, 40 mole% or less, 35 mole% or less, 30 mole% or less, 25 mole% or less, 20 mole% or less, 15 mole% or less, 10 mole% or less, or 5 mole% or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 5% or less, 4% or less, 3% or less, 2% or less, or 1% or less based on the total number of moles of the first and second compounds in the composition. In some embodiments, the amount of the second compound may be 1.0% or less, 0.9% or less, 0.8% or less, 0.7% or less, 0.6% or less, 0.5% or less, 0.4% or less, 0.3% or less, 0.2% or less, 0.1% or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 0.10% or less, 0.09% or less, 0.08% or less, 0.07% or less, 0.06% or less, 0.05% or less, 0.04% or less, 0.03% or less, 0.02% or less, 0.01% or less based on the total number of moles of the first and second compounds in the composition. In some embodiments, the amount of the second compound may be 0.010% or less, 0.009% or less, 0.008% or less, 0.007% or less, 0.006% or less, 0.005% or less, 0.004% or less, 0.003% or less, 0.002% or less, 0.001% or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 0.0010% or less, 0.0009% or less, 0.0008% or less, 0.0007% or less, 0.0006% or less, 0.0005% or less, 0.0004% or less, 0.0003% or less, 0.0002% or less, 0.0001% or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 0.00010% or less, 0.00009% or less, 0.00008% or less, 0.00007% or less, 0.00006% or less, 0.00005% or less, 0.00004% or less, 0.00003% or less, 0.00002% or less, 0.00001% or less based on the total number of moles of the first and second compounds in the composition.
  • the amount of the second compound may be 0.000010% or less, 0.000009% or less, 0.000008% or less, 0.000007% or less, 0.000006% or less, 0.000005% or less, 0.000004% or less, 0.000003% or less, 0.000002% or less, 0.000001% or less based on the total number of moles of the first and second compounds in the composition.
  • the compositions may further include a third compound, a fourth compound, or a combination thereof.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 5% or less, 4% or less, 3% or less, 2% or less, or 1% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 1.0% or less, 0.9% or less, 0.8% or less, 0.7% or less, 0.6% or less, 0.5% or less, 0.4% or less, 0.3% or less, 0.2% or less, 0.1% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 0.10% or less, 0.09% or less, 0.08% or less, 0.07% or less, 0.06% or less, 0.05% or less, 0.04% or less, 0.03% or less, 0.02% or less, 0.01% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 0.010% or less, 0.009% or less, 0.008% or less, 0.007% or less, 0.006% or less, 0.005% or less, 0.004% or less, 0.003% or less, 0.002% or less, 0.001% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 0.0010% or less, 0.0009% or less, 0.0008% or less, 0.0007% or less, 0.0006% or less, 0.0005% or less, 0.0004% or less, 0.0003% or less, 0.0002% or less, 0.0001% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 0.00010% or less, 0.00009% or less, 0.00008% or less, 0.00007% or less, 0.00006% or less, 0.00005% or less, 0.00004% or less, 0.00003% or less, 0.00002% or less, 0.00001% or less based on the number of moles of the first compound in the composition.
  • the amount of the third compound, the fourth compound, or the combination thereof may be 0.000010% or less, 0.000009% or less, 0.000008% or less, 0.000007% or less, 0.000006% or less, 0.000005% or less, 0.000004% or less, 0.000003% or less, 0.000002% or less, 0.000001% or less based on the number of moles of the first compound in the composition.
  • a specific dosage and treatment regimen for any particular patient will depend upon a variety of factors, including the activity of the specific compound employed, the age, body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, and the judgment of the treating physician and the severity of the particular disease being treated.
  • the amount of a compound of the present disclosure in the composition will also depend upon the particular compound in the composition.
  • Technologies e.g., compounds, agents, compositions
  • provided technologies are useful for treating conditions, disorders or diseases, e.g., various cancers.
  • provided technologies comprise target binding moieties, e.g., antibody agent moieties, that can bind antigens of cancer cells.
  • a target binding moiety is an antibody agent moiety.
  • an antibody agent is a therapeutic agent.
  • various antibody agents including many developed and/or approved (e.g., by FDA, EMA, etc.) as therapeutics can be utilized in accordance with the present disclosure to provide therapeutics for various diseases.
  • LG is R LG -L lg ;
  • R LG is , R c -(Xaa)z-, a nucleic acid moiety, or a small molecule moiety; each Xaa is independently a residue of an amino acid or an amino acid analog; t is 0-50; z is 1-50; each R c is independently -L a -R'; each of a and b is independently 1-200; each L a is independently a covalent bond, or an optionally substituted bivalent group selected from C1-C20 aliphatic or C1-C20 heteroaliphatic having 1-5 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with -C(R')2-, -Cy-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -N(R')C(O
  • L LG is — L lg1 — -L LG1 -L LG2 - —
  • RG is -L RG1 -L RG2 - — L LG4 — L RG1 — L RG2 — -L LG3 -L LG4 -L RG1 -L RG2 - -
  • MOI is a moiety of interest that is or comprises vedotin (MMAD, MMAE, or MMAF), vedotin, ozogamicin, mafodotin, deruxtecan, emtansine, govitecan, tesirine, duocarmazine, soravtansine, ravtansine.
  • MMAD vedotin
  • MMAE vedotin
  • MMAF vedotin
  • ozogamicin mafodotin
  • deruxtecan emtansine
  • govitecan tesirine
  • duocarmazine soravtansine
  • soravtansine ravtansine.
  • LG is or comprises a target binding moiety that binds to a target agent, wherein a target agent is a protein agent.
  • LG is or comprises a target binding moiety that binds to a target agent, wherein the target agent is an antibody agent.
  • LG is or comprises a target binding moiety that binds to a Fc region or an antibody agent.
  • LG is or comprises a target binding moiety that binds to a target agent
  • the target agent is an antibody agent that is or comprises enfortumab, brentuximab, belantamab, vorsetuzumab, inotuzumab, trastuzumab, gemtuzumab, polatuzumab, Sacituzumab, tisotumab, loncastuximab, datopotamab, depatuxizumab, mirvetuximab, tusamitamab, anetumab, camidanlumab, coltuximab, disitamab, labetuzumab, ladiratuzumab, lifastuzumab, naratuximab, cirmtuzumab, patritumab, pinatuzumab, polatuzumab, , enapotamab,
  • each L is independently a covalent bond, or a bivalent optionally substituted, linear or branched aliphatic group or heteroaliphatic group having 1-10 heteroatoms, wherein one or more methylene units of the group are optionally and independently replaced with — CoC— ; -Cy-, -C(R')2-, -O-, -S-, -S-S-, -N(R')-, -C(O)-, -C(S)-, -C(NR')-, -C(O)N(R')-, -C(O)C(R') 2 N(R')-, -N(R')C(O)N(R')-, -N(R')C(O)0- -S(O)-, -S(O) 2 -, -S(O) 2 N(R')-, -C(O)S- -C-C—C—
  • LG is R LG -L lg -, wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 , wherein L LG1 is L.
  • RG is or comprises -L LG2 -L LG3 -L LG4 -L RG1 -L RG2 -, wherein each of L LG2 , L LG3 , L LG4 , L RG1 , L RG2 is independently L.
  • LG is R LG -L lg -, wherein R LG is or comprises a target binding moiety, wherein L LG is
  • RG is or comprises _L LG3 _L LG4 _L RG1 — L RG2 —
  • LG is R LG -L lg -, wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 — L LG2 — L LG3 — .
  • LG is R LG -L lg -, wherein R LG is or comprises a target binding moiety, wherein L LG is L LG1 — L LG2 — L LG3 — L LG4 — .
  • R LG is or comprises WXL, wherein X is an amino acid residue.
  • R LG is or comprises AWXLGELVW (SEQ ID NO:16), wherein X is an amino acid residue.
  • R LG is or comprises DpLpAWXLGELVW (SEQ ID NO:20), wherein X is an amino acid residue.
  • R LG is or comprises DCAWXLGELVWCT (SEQ ID NO:18), wherein the two cysteine residues optionally form a disulfide bond, and X is an amino acid residue.
  • R LG is or comprises DpLpDCAWXLGELVWCT (SEQ ID NO:23), wherein the two cysteine residues optionally form a disulfide bond, and X is an amino acid residue.
  • R LG is or comprises CDCAWXLGELVWCTC (SEQ ID NO:26), wherein the first and the last cysteines, and the two cysteines in the middle of the sequence, are each independently and optionally form a disulfide bond, and X is an amino acid residue.
  • L LG1 is or comprises -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently 1-10, and each - CH 2 - is independently optionally substituted.
  • L LG2 is or comprises -(CH 2 )n-OC(O)N(R')-, wherein -(CH 2 )n- is optionally substituted.
  • L LG3 is ( RS ) s , wherein s is 0-4, each R s is independently halogen, -NO2, -L-R', -C(O)-L-R', -S(O)-L-R', -S(O) 2 -L-R', or -P(O)(-L-R') 2 .
  • L PM is or comprises -(CH 2 )n-O-(CH 2 CH 2 0)n-(CH 2 )n-, wherein each n is independently 1-10, and each - CH 2 - is independently optionally substituted.
  • a moiety of interest is or comprises a cytotoxic agent, such as MMAD, MMAE, and MMAF.
  • a method comprising steps of:
  • reaction partner comprising: a first group comprising a target binding moiety that binds to a target agent, a reactive group; a moiety of interest that is or comprises MMAD, MMAE, or MMAF; and optionally one or more linker moieties;
  • an agent comprising: a target agent moiety; the moiety of interest; and optionally one or more linker moieties.
  • P is a target agent moiety
  • L PM is a linker
  • MOI is a moiety of interest that is or comprises MMAD, MMAE, or MMAF. comprising steps of:
  • LG is a group comprising a target binding moiety that binds to a target agent
  • RG is the reactive group
  • L RM is a linker
  • MOI is the moiety of interest that is or comprises MMAD, MMAE, or MMAF;
  • P-N is a protein agent moiety comprising a lysine residue
  • L PM is a linker
  • MOI is the moiety of interest that is or comprises MMAD, MMAE, or MMAF; the method comprising: contacting P-N with a reaction partner having a structure of formula R-l:
  • LG is a group comprising a protein-binding moiety that binds to P-N, RG is a reactive group;
  • L RM is a linker
  • MOI is the moiety of interest that is or comprises MMAD, MMAE, or MMAF.
  • a target agent is or comprises a protein agent.
  • a target agent is or comprises an antibody agent, such as enfortumab, brentuximab, belantamab, vorsetuzumab, inotuzumab, trastuzumab, gemtuzumab, polatuzumab, Sacituzumab, tisotumab, loncastuximab, datopotamab, depatuxizumab, mirvetuximab, tusamitamab, anetumab, camidanlumab, coltuximab, disitamab, labetuzumab, ladiratuzumab, lifastuzumab, naratuximab, cirmtuzumab, patritumab, pinatuzumab, polatuzumab, , enapotamab, anetumab, or omburtamab.
  • an antibody agent such as enfortumab, brentux
  • a target agent is or comprise an IgG antibody agent.
  • a target agent is or comprises an Fc region.
  • reaction partner is a compound of any one embodiments 1-98.
  • a target agent moiety is a protein agent moiety.
  • a target agent moiety is an antibody agent moiety.
  • a second agent comprises a second reactive moiety and a peptide moiety.
  • a second agent comprises a second reactive moiety and a protein moiety.
  • a second agent comprises a second reactive moiety and an antibody agent moiety.
  • a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein the first agent is prepared by a method of any one of embodiments 99-131.
  • a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein the second agents is prepared by a method of any one of embodiments 99- 131.
  • a method comprising reacting a first agent comprising a first reactive moiety in a first moiety of interest with a second agent comprising a second reactive moiety in a second moiety of interest, wherein each of the first and the second agents is independently prepared by a method of any one of embodiments 99-131.
  • each of the first and the second agents independently has the structure of formula P-l or P-ll, or a salt thereof.
  • the first agent comprises an anti CD30 antibody, such as brentuximab, or an anit-nectin-4-monoclonal antibody, such as enfortumab.
  • a composition provides a plurality of agents each of which independently comprising: a target agent moiety, a moiety of interest that is or comprises MMAD, MMAE, or MMAF, and optionally a linker moiety linking a target agent moiety and a moiety of interest; wherein agents of the plurality share the same or substantially the same target agent moiety, and a common modification independently at at least one common location; and wherein about 1%-100% of all agents that comprise a target agent moiety and a moiety of interest are agents of the plurality.
  • a composition provides a plurality of agents each of which independently comprising: a protein agent moiety, a moiety of interest that is or comprises MMAD, MMAE, or MMAF, and optionally a linker moiety linking a protein agent moiety and a moiety of interest; wherein protein agent moieties of agents of the plurality comprise a common amino acid sequence, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise a protein agent moiety that comprise the common amino acid sequence and a moiety of interest are agents of the plurality.
  • a composition provides a plurality of agents each of which independently comprising: an antibody agent moiety, a moiety of interest, e.g. that is or comprises MMAD, MMAE, or MMAF, and optionally a linker moiety linking an antibody agent moiety and a moiety of interest; wherein antibody agent moieties of agents of the plurality comprise a common amino acid sequence or can bind to a common antigen, and agents of the plurality share a common modification independently at at least one common amino acid residue of protein agent moieties; and wherein about 1%-100% of all agents that comprise an antibody agent moiety that comprise the common amino acid sequence or can bind to the common antigen and a moiety of interest are agents of the plurality.
  • composition of embodiment 157, wherein antibody agent moieties of agents of the plurality can bind to two or more different antigens.
  • composition of any one of the preceding embodiments, wherein a target, protein or antibody agent moiety is or comprises bentuximab or enfortumab.
  • a therapeutic agent moiety such as a cytotoxic moiety, such as MMAD, MMAE, or MMAF.
  • composition of any one of embodiments 155-173, wherein a linker comprises one or more -CH 2 -CH 2 -O-.
  • composition or embodiment 174 wherein a linker is or comprises -(Cl-hCI-hOjn- where n is independently selected at each occurrence from integers 2, 3, 4, 5, 6, 7, and 8.
  • composition or embodiment 174 wherein a linker is or comprises -(CH 2 CH 2 0)n-(CH 2 )n-NHC(O)-(CH 2 )n-, -[(CH 2 CH 2 0)n-(CH 2 )n-NHC(O)]m-(CH 2 )n-, and - (CH 2 CH 2 0)n-(CH 2 )n-N((CH 2 CH 2 0)n-(CH 2 )n-)((CH 2 CH 2 0)n-(CH 2 )n-) where m is independently selected at each occurrence from integers 1, 2, 3, and 4.
  • composition of any one of embodiments 156-176 wherein the common amino acid sequence of the protein agent moiety comprises one or more amino acid residues selected from K246 and K248 of an IgGl heavy chain and amino acid residues corresponding thereto, K251 and K253 of an lgG2 heavy chain and amino acid residues corresponding thereto, and K239 and K241 of an lgG4 heavy chain and amino acid residues corresponding thereto.
  • composition of any one of the preceding embodiments, wherein all common modifications comprises a common moiety of interest and optionally a common linker.
  • composition of any one of embodiments 156-186, wherein a common amino acid residue is K288 of an antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-187, wherein a common amino acid residue is K290 of an antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-188, wherein a common amino acid residue is K317 of an antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-189, wherein a common amino acid residue is K133 of an antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-190, wherein a common amino acid residue is K144 of an antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-193, wherein a common amino acid residue is K187 of an antibody light chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-194, wherein a common amino acid residue is K251 of an lgG2 antibody heavy chain or an amino acid residue corresponding thereto.
  • composition of any one of embodiments 156-196, wherein a common amino acid residue is K239 of an lgG4 antibody heavy chain or an amino acid residue corresponding thereto.
  • agent wherein the agent is an agent of the plurality of any one of embodiments 155- 211.
  • a pharmaceutical composition comprising an agent of embodiment 213 and a pharmaceutically acceptable carrier.
  • composition of embodiment 212 or 214, wherein the composition is in a solid form.
  • each heteroatom is independently selected from oxygen, nitrogen, sulfur, phosphorus and silicon.
  • An agent comprising an amino acid residue of a of any of the following compounds, or an amino acid residue of an ester of any of the following compounds:
  • a polypeptide agent comprising an amino acid residue of a compound of any one of embodiments 221.
  • a method for preparing a compound comprising providing a compound of any one of embodiments 221.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Molecular Biology (AREA)
  • Urology & Nephrology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2022/030070 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents Ceased WO2022246086A1 (en)

Priority Applications (11)

Application Number Priority Date Filing Date Title
CN202280034208.8A CN117412761A (zh) 2021-05-19 2022-05-19 使用mate技术的用于递送细胞毒性药剂的抗体药物缀合物
CA3219550A CA3219550A1 (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents
MX2023013270A MX2023013270A (es) 2021-05-19 2022-05-19 Conjugados anticuerpo-farmaco que usan tecnologia de mejoramiento multimodal de terapia con anticuerpos (mates) para administrar agentes citotoxicos.
PH1/2023/553153A PH12023553153A1 (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents
US18/555,858 US20250108124A1 (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents
BR112023023525A BR112023023525A2 (pt) 2021-05-19 2022-05-19 Conjugados de anticorpo-fármaco usando tecnologia mates para distribuir agentes citotóxicos
JP2023571661A JP2024521092A (ja) 2021-05-19 2022-05-19 細胞傷害性薬剤を送達するためのmates技術を使用する抗体薬物コンジュゲート
KR1020237039501A KR20240012381A (ko) 2021-05-19 2022-05-19 세포독성제를 전달하기 위한 mate 기술을 사용한 항체 약물 접합체
IL307884A IL307884A (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents
AU2022277698A AU2022277698A1 (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents
EP22805492.0A EP4340859A4 (en) 2021-05-19 2022-05-19 ANTIBODY-DRUG CONJUGATES USING COUPLING TECHNOLOGY TO DELIVER CYTOTOXIC AGENTS

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163190703P 2021-05-19 2021-05-19
US63/190,703 2021-05-19

Publications (1)

Publication Number Publication Date
WO2022246086A1 true WO2022246086A1 (en) 2022-11-24

Family

ID=84141792

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/030070 Ceased WO2022246086A1 (en) 2021-05-19 2022-05-19 Antibody drug conjugates using mates technology for delivering cytotoxic agents

Country Status (12)

Country Link
US (1) US20250108124A1 (cg-RX-API-DMAC7.html)
EP (1) EP4340859A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024521092A (cg-RX-API-DMAC7.html)
KR (1) KR20240012381A (cg-RX-API-DMAC7.html)
CN (1) CN117412761A (cg-RX-API-DMAC7.html)
AU (1) AU2022277698A1 (cg-RX-API-DMAC7.html)
BR (1) BR112023023525A2 (cg-RX-API-DMAC7.html)
CA (1) CA3219550A1 (cg-RX-API-DMAC7.html)
IL (1) IL307884A (cg-RX-API-DMAC7.html)
MX (1) MX2023013270A (cg-RX-API-DMAC7.html)
PH (1) PH12023553153A1 (cg-RX-API-DMAC7.html)
WO (1) WO2022246086A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024226448A1 (en) * 2023-04-23 2024-10-31 Biohaven Therapeutics Ltd. Antibody-drug conjugates for delivering cytotoxic agents
EP4351658A4 (en) * 2021-05-17 2026-04-15 Biohaven Therapeutics Ltd COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2007147901A1 (en) * 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
US7498298B2 (en) * 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2012123076A1 (en) * 2011-03-11 2012-09-20 Ruprecht-Karls-Universität Heidelberg Ferrocene-based compounds and their use as ros regulating prodrugs
US20150307587A1 (en) * 2012-10-25 2015-10-29 Zhejiang University a university RTRAIL Mutant and Monomethyl Auristatin E Conjugate Thereof
US20170340752A1 (en) * 2014-09-10 2017-11-30 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
WO2020123275A1 (en) * 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
US20200223928A1 (en) * 2015-04-07 2020-07-16 Alector Llc Anti-sortilin antibodies and methods of use thereof
WO2021102052A1 (en) * 2019-11-18 2021-05-27 Kleo Pharmaceuticals, Inc. Directed conjugation technologies

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2015339012B2 (en) * 2014-10-31 2020-11-05 Abbvie Biotherapeutics Inc. Anti-CS1 antibodies and antibody drug conjugates
AU2018259856B2 (en) * 2017-04-28 2025-05-01 Ajinomoto Co., Inc. Compound having substance that has affinity for soluble protein, cleavable moiety, and reactive group, or salt thereof
US10953107B2 (en) * 2018-06-15 2021-03-23 Trustees Of Boston University Polypeptide compositions and methods for site-specific targeting of therapeutic agents
US20230028880A1 (en) * 2019-07-03 2023-01-26 Biohaven Therapeutics Ltd. Cd38-binding agents and uses thereof

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7498298B2 (en) * 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2007147901A1 (en) * 2006-06-22 2007-12-27 Novo Nordisk A/S Production of bispecific antibodies
WO2012123076A1 (en) * 2011-03-11 2012-09-20 Ruprecht-Karls-Universität Heidelberg Ferrocene-based compounds and their use as ros regulating prodrugs
US20150307587A1 (en) * 2012-10-25 2015-10-29 Zhejiang University a university RTRAIL Mutant and Monomethyl Auristatin E Conjugate Thereof
US20170340752A1 (en) * 2014-09-10 2017-11-30 Medimmune Limited Pyrrolobenzodiazepines and conjugates thereof
US20200223928A1 (en) * 2015-04-07 2020-07-16 Alector Llc Anti-sortilin antibodies and methods of use thereof
WO2020123275A1 (en) * 2018-12-10 2020-06-18 Genentech, Inc. Photocrosslinking peptides for site specific conjugation to fc-containing proteins
WO2021102052A1 (en) * 2019-11-18 2021-05-27 Kleo Pharmaceuticals, Inc. Directed conjugation technologies

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
BRAIDY, NET ET AL.: "Mapping NAD+ metabolism in the brain of ageing Wistar rats: potential targets for influencing brain senescence", BIOGERONTOLOGY, vol. 15, 2014, pages 177 - 198, XP093011028, DOI: 10.1007/s10522-013-9489-5 *
MATAYATSUK, C ET AL.: "Quantitative determination of ortho- and meta-tyrosine as biomarkers of protein oxidative damage in beta-thalassemia", REDOX REPORT, vol. 12, no. 5, 2007, pages 219 - 228, XP093011029, DOI: 10.1179/135100007X200272 *
See also references of EP4340859A4 *
SHEN, BQ ET AL.: "Conjugation site modulates the in vivo stability and therapeutic activity of antibody-drug conjugates", NATURE BIOTECHNOLOGY, vol. 30, no. 2, 22 January 2012 (2012-01-22), pages 184 - 189, XP055417838, DOI: 10.1038/nbt.2108 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4351658A4 (en) * 2021-05-17 2026-04-15 Biohaven Therapeutics Ltd COMPOSITIONS COMPRISING COMBINED THERAPY AMPLIFIERS
WO2024226448A1 (en) * 2023-04-23 2024-10-31 Biohaven Therapeutics Ltd. Antibody-drug conjugates for delivering cytotoxic agents

Also Published As

Publication number Publication date
CA3219550A1 (en) 2022-11-24
AU2022277698A1 (en) 2023-12-14
PH12023553153A1 (en) 2024-03-11
JP2024521092A (ja) 2024-05-28
EP4340859A4 (en) 2025-07-02
IL307884A (en) 2023-12-01
KR20240012381A (ko) 2024-01-29
AU2022277698A9 (en) 2024-01-04
BR112023023525A2 (pt) 2024-01-30
CN117412761A (zh) 2024-01-16
EP4340859A1 (en) 2024-03-27
US20250108124A1 (en) 2025-04-03
MX2023013270A (es) 2023-11-30

Similar Documents

Publication Publication Date Title
US20230128688A1 (en) Directed conjugation technologies
AU2009268349C1 (en) Glycopeptide constructs and uses thereof
CN103108654A (zh) 多价糖肽构建体及其用途
EP3407916A2 (en) Phosphonate linkers and their use to facilitate cellular retention of compounds
KR20230057350A (ko) 스테이플화된 펩티드 및 이의 방법
AU2022277698A9 (en) Antibody drug conjugates using mates technology for delivering cytotoxic agents
US20230330240A1 (en) Technologies for preventing or treating infections
CN114401732A (zh) Cd38结合剂和其用途
EP4288110A2 (en) Technologies for preventing or treating infections
JP2025541246A (ja) ステープルペプチドおよびその方法
JP2025541247A (ja) ステープルペプチドおよびその方法
KR20260035134A (ko) 스테이플화 펩티드 및 이의 방법
US20240391956A1 (en) Stapled peptides and methods thereof
HK40129655A (zh) 订书钉化肽及其方法
HK40128981A (zh) 订书钉化肽及其方法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22805492

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 307884

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 202280034208.8

Country of ref document: CN

Ref document number: MX/A/2023/013270

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: P6002975/2023

Country of ref document: AE

WWE Wipo information: entry into national phase

Ref document number: 12023553153

Country of ref document: PH

Ref document number: 2023571661

Country of ref document: JP

Ref document number: 3219550

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023023525

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 805979

Country of ref document: NZ

Ref document number: 2022277698

Country of ref document: AU

Ref document number: AU2022277698

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 202393066

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 11202308277V

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 202317084706

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 523451579

Country of ref document: SA

ENP Entry into the national phase

Ref document number: 2022277698

Country of ref document: AU

Date of ref document: 20220519

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022805492

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022805492

Country of ref document: EP

Effective date: 20231219

ENP Entry into the national phase

Ref document number: 112023023525

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231109

WWE Wipo information: entry into national phase

Ref document number: 523451579

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523451579

Country of ref document: SA

WWP Wipo information: published in national office

Ref document number: 18555858

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 523451579

Country of ref document: SA