WO2022238459A1 - Nouveaux anticorps anti-vegfc humanisés et leurs utilisations - Google Patents

Nouveaux anticorps anti-vegfc humanisés et leurs utilisations Download PDF

Info

Publication number
WO2022238459A1
WO2022238459A1 PCT/EP2022/062731 EP2022062731W WO2022238459A1 WO 2022238459 A1 WO2022238459 A1 WO 2022238459A1 EP 2022062731 W EP2022062731 W EP 2022062731W WO 2022238459 A1 WO2022238459 A1 WO 2022238459A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
sequence
chain variable
variable region
antibody
Prior art date
Application number
PCT/EP2022/062731
Other languages
English (en)
Inventor
Gilles PAGES
Original Assignee
Centre National De La Recherche Scientifique (Cnrs)
INSERM (Institut National de la Santé et de la Recherche Médicale)
Universite Cote D'azur
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Centre National De La Recherche Scientifique (Cnrs), INSERM (Institut National de la Santé et de la Recherche Médicale), Universite Cote D'azur filed Critical Centre National De La Recherche Scientifique (Cnrs)
Publication of WO2022238459A1 publication Critical patent/WO2022238459A1/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/04—Antineoplastic agents specific for metastasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507—Comprising a combination of two or more separate antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention concerns new humanized monoclonal anti-VEGFC antibodies and their uses, in particular in the prevention and treatment of cancers and disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation (lymphangiogenesis) and/or autocrine proliferation loops mediated by overexpression of VEGFC by tumor cells expressing their receptors/co-receptors.
  • lymphatic endothelial cell migration and/or proliferation characterized by undesirable lymphatic endothelial cell migration and/or proliferation (lymphangiogenesis) and/or autocrine proliferation loops mediated by overexpression of VEGFC by tumor cells expressing their receptors/co-receptors.
  • angiogenesis the formation of new blood vessels from a pre existing vasculature, has emerged as a major target in age-related pathologies (including cancer, retinopathies, psoriasis, arthritis, and rheumatoid arthritis).
  • Several therapeutic agents targeting the VEGFA165, the main pro-angiogenic factor and its associated receptors have been approved for cancer treatment (e.g.
  • Bevacizumab (BVZ, Avastin®), a recombinant humanized monoclonal antibody, or sunitinib (Sutent®), a small-sized kinase inhibitor which targets specific VEGF receptors (Flt-1, Flk-1, Flt-4 as well as PDGF-R, CSFR1, c-KIT).
  • these conventional drugs lead to an indisputable initial period of clinical benefit, however they fail to definitively cure cancers.
  • the treated primary tumors relapse and the remaining malignant cells disseminate to distant healthy tissues inducing metastases.
  • This invention aims at developing a new strategy to tackle concomitantly the proangiogenic and the pro-lymphangiogenic pathways that are involved in tumor growth and metastatic dissemination.
  • VEGFC expression is induced following administration of bevacizumab or sunitinib in experimental models of RCC in mice (Dufies et al. 2017; Grepin et al. 2012).
  • the direct exposure of tumor cells to different anti- angiogenic compounds stimulates expression of VEGFC by tumor cells.
  • head and neck tumor cells overexpress VEGFC (Lupu-Plesu et al Oncogenesis 2017). Therefore, the expression of VEGFC can be considered as a factor of response to treatment-induced stresses.
  • RCC also known as hypernephroma
  • ccRCC Clear cell metastatic renal cell carcinoma
  • Initial treatment is most commonly a radical or partial nephrectomy and remains the mainstay of curative treatment.
  • the 5-year survival rate is 60-70%, but this is lowered considerably where metastases have spread. It is resistant to radiation therapy and chemotherapy, but some cases respond to “old-fashion “ immunotherapies including interferon alpha and interleukin 2.
  • Anti-angiogenic therapies such as sunitinib, axitinib, lenvatinib, pazopanib, temsirolimus, bevacizumab, , and sorafenib have improved the outlook for RCC (progression-free survival), although they have not yet demonstrated improved survival.
  • Anti-angiogenic therapies have been used in clear cell renal cancers (ccRCC, the most common renal cancer) with mitigated results (Escudier et al., 2010). Although these treatments increase progression-free survival of patients, they do not impact the overall survival except in some extremely rare cases.
  • One hypothesis that could explain this semi failure is the production by the tumor cells or cells of the tumor microenvironment of angiogenesis factors redundant to VEGFA.
  • ccRCC The new standard of care for ccRCC is a combination of immunotherapies (nivolumab ipilimumab) or a combination of anti-angiogenic drugs plus an immunotherapies
  • the invention now provides new humanized monoclonal antibodies directed against the part of VEGFC that specifically binds to and activates the VEGF receptor 3 (VEGF-R3), to specifically target the development of lymphatic vessels that occur following anti- angiogenic therapy.
  • VEGF-R3 VEGF receptor 3
  • these antibodies also inhibited the autocrine proliferation loop occurring on tumor cells expressing VEGFC and their receptors/co receptors neuropilin 1 and 2 (Dumond A et al JECCR 2021).
  • murine anti-VEGFC antibodies inhibit the growth of experimental kidney tumors in nude mice. These murine antibodies inhibited the activation of VEGFR3 signaling and therefore the proliferation and the migration of VEGFC-stimulated endothelial cells.
  • anti-VEGFA antibodies have no effect or even favor experimental tumor growth in this model, the combination of an anti-VEGFA and an anti-VEGFC have an additive effect on the inhibition of tumor growth. Therefore, these new antibodies may constitute a new therapeutic strategy for cancers and disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation, in particular a new therapeutic strategy for RCC or for tumors characterized by an overexpression of VEGFC by tumors cells and cells of the microenvironment.
  • a first object of the present invention is a humanized anti-vascular endothelial growth factor- C (VEGFC) antibody or a functional fragment thereof, said antibody comprising:
  • Another object of the present invention is a humanized monoclonal anti-vascular endothelial growth factor-C (VEGFC) antibody or a functional fragment thereof, comprising
  • a heavy chain variable domain of sequence selected in the group consisting of consensus sequence SEQ ID NO: 144 QX1QLVQX2GAEVKKPGASVKVSCKASGYTFX3SYWMHWVRQAPGQGLEWX4GEINP S N G RTN YN E KF KS RX5TX6TVDX7SX8STX9YM E LSX10 LRSX11 DTAVYYCASTSLFYYA M N YWGQGTLVTVSS wherein X1: A or V X2: S or P
  • Another object is a polynucleotide encoding a variable heavy chain (VH) for a humanized monoclonal anti-VEGFC antibody according to the invention, a variable light chain (VL) for a humanized monoclonal anti- VEGFC antibody according to the invention, or both a variable heavy chain (VH) and a variable light chain (VL) for a humanized monoclonal anti- VEGFC antibody according to the invention.
  • the invention also relates to a combination of two polynucleotides encoding a variable heavy chain (VH) and a variable light chain (VL) for a humanized monoclonal anti- VEGFC antibody according to the invention.
  • the present invention also concerns an expression vector comprising the polynucleotide or combination of polynucleotides of the invention, a non-human host cell transformed with a polynucleotide or a combination of two polynucleotides suitable for expressing an humanized monoclonal anti-VEGFC according to the invention, and a method of producing an humanized monoclonal anti-VEGFC antibody of the invention comprising: culturing the non-human host cell transformed with a polynucleotide according to the invention or a combination of two polynucleotides suitable for expressing an anti-VEGFC according to the invention, in particular non-human fibroblasts, under suitable conditions and recovering the anti-VEGFC antibody from the culture medium or from the said cultured cells.
  • Another object of the present invention is a combination of a humanized monoclonal antibody anti-VEGFC according to the invention and an anti-angiogenic compound, in particular selected from the group consisting antibodies anti-VEGF distinct from the anti- VEGFC antibody of the invention, inhibitors of receptors involve in angiogenesis including VEGFR1, 2, 3, CSFR, PDGFR, inhibitors of m-TOR, preferably an anti-VEGF antibody distinct from the anti-VEGFC antibody of the invention.
  • the invention also concerns a pharmaceutical composition comprising a humanized monoclonal antibody according to the invention or a combination according to the invention and an excipient, carrier, and/or diluent.
  • the present invention also relates to a humanized monoclonal antibody as defined in the invention, or a combination of the invention or a pharmaceutical composition of the invention, for use as a medicament.
  • the present invention also relates to a humanized monoclonal antibody as defined in the invention, or a combination of the invention or a pharmaceutical composition of the invention, for use in therapy or diagnosis, in particular in the treatment of cancers or disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation, or in an in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound.
  • the said humanized monoclonal antibody or the said combination or the said pharmaceutical composition are used in the treatment of cancers or disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation, in particular renal cancer carcinoma (RCC), breast cancer, head and neck cancers, retinopathies, arthritis or rheumatoid arthritis, preferably renal cancer carcinoma (RCC).
  • RCC renal cancer carcinoma
  • RCC renal cancer carcinoma
  • the said humanized monoclonal antibody or the said combination or the said pharmaceutical composition are used in a subject who is relapsed from or refractory to its conventional treatment, and/or who is developing or is at risk of developing tumor metastasis.
  • Another object of the invention is an in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, characterized in that said method comprises a step of contacting a biological sample of said subject with a humanized monoclonal anti-VEGFC antibody of the invention, it being possible for said antibody to be, if necessary, labelled.
  • the present invention also relates to a kit for carrying out the in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, the said kit comprising at least one humanized monoclonal anti-VEGFC antibody and/or a functional fragment thereof according to the invention and optionally at least one reagent for detecting said anti-VEGFC antibody.
  • VEGFC Vascular endothelial growth factor C
  • human gene Gene ID: 7424, RefSeq mRNA NM_005429
  • PDGF/VEGF platelet-derived growth factor/vascular endothelial growth factor family.
  • the encoded protein promotes endothelial cell proliferation and angiogenesis, and can also affect the permeability of blood vessels. It can also promote the proliferation of lymphatic endothelial cells and lymphangiogenesis.
  • the proprotein is further cleaved into a fully processed form that can bind and activate VEGFR-2 and VEGFR-3 receptors.
  • VEGFC (Uniprot P49767, RefSeq protein NP_005420, amino-acid sequence represented by SEQ ID NO: 12) is proteolytically matured along a complex mechanism.
  • the entire VEGFC molecule can stimulate both the VEGF receptor 2 (KDR) and VEGF receptor 3 (FLT 4) whereas the proteolytically cleaved form of VEGFC stimulates only VEGFR3 (Joukov et al. 1996).
  • mice immunized mice with the VEGFC form that only stimulates VEGFR3 according to the protocol described in Figure 1. They obtained two monoclonal antibodies with a high specificity to VEGFC. The variable regions of these antibodies were sequenced (heavy and light chains as illustrated in Figure 7). The CDR of these two antibodies were fused to human lgG1 light and heavy chains to obtain chimeric antibodies that can be used in the clinic. Expression vectors were transfected in CHO cells to obtain stable clones expressing the chimeric antibodies. The chimeric antibodies recognized with a high affinity the human VEGFC. As illustrated in the examples below, they inhibit the growth of experimental kidney tumors in nude mice. Whereas anti- VEGF antibodies have no effect or even favor experimental tumor growth in this model, the combination of anti VEGF and anti-VEGFC of the invention have an additive effect on the inhibition of tumor growth.
  • a first object of the invention concerns a humanized anti-vascular endothelial growth factor-C (VEGFC) antibody or a functional fragment thereof, said antibody comprising: (i) the three heavy-chain CDRs of sequences SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8 under Kabat nomenclature,
  • the murine antibody was obtained by using an immunogen comprising a peptide antigen having an amino acid sequence corresponding to SEQ ID NO: 1 ( Figure 1).
  • the humanized antibody of the invention is able to compete with or inhibit the binding of VEGFC to VEGF-R3.
  • an antibody or “immunoglobulin” consists of a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain comprises a heavy chain variable region (or domain) (abbreviated herein as VH) and a heavy chain constant region (hereafter CH).
  • VH heavy chain variable region
  • CH heavy chain constant region
  • Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, and define the antibody's isotype as IgG, IgM, IgA, IgD, and IgE, respectively.
  • the heavy chain constant region of the immunoglobulin IgG, IgD, and IgA (g, d and a chains respectively) comprises three domains (CH1, CH2, and CH3) and a hinge region for added flexibility, and the heavy chain constant region of the immunoglobulin IgM and IgE contains 4 domains (CH1, CH2, CH3, and CH4).
  • the antibody of the invention can be of the IgG, IgM, IgA, IgD, and IgE isotype, depending on the structure of its heavy chain. However, in a preferred embodiment, the antibody of the invention is of the IgG isotype, i.e. , its heavy chain is of the gamma (y) type.
  • IgG antibodies are classified in four distinct subtypes, named lgG1, lgG2, lgG3 and lgG4 in order of their abundance in serum (lgG1 being the most abundant).
  • the structure of the hinge regions in the g chain gives each of these subtypes its unique biological profile (even though there is about 95% similarity between their Fc regions, the structure of the hinge regions is relatively different).
  • the antibody of the invention can be of the lgG1, lgG2, lgG3 or lgG4 subtype.
  • the antibody of the invention is of the lgG1 subtype or of the lgG2 subtype, preferably of the lgG1 subtype.
  • Each light chain comprises a light chain variable region (abbreviated herein as VL) and a light chain constant region comprising only one domain, CL.
  • VL light chain variable region
  • CL light chain constant region
  • the antibody of the invention has a Kappa light chain.
  • V H and V L regions can be further subdivided into regions of hypervariability, termed “Complementarity Determining Regions” (CDR), which are primarily responsible for binding an epitope of an antigen, and which are interspersed with regions that are more conserved, termed “Framework Regions” (FR).
  • CDR Complementarity Determining Regions
  • FR Framework Regions
  • Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4.
  • the assignment of amino acid sequences to each domain is in accordance with well-known conventions (Chothia et al. 1989; Chothia et al. 1987).
  • variable region of the heavy chain differs in antibodies produced by different B cells but is the same for all antibodies produced by a single B cell or B cell clone (or hybridome).
  • CDR refers to one of three hypervariable regions (H1, H2 or H3) within the non-framework region of the immunoglobulin (Ig or antibody) VH b-sheet framework, or one of three hypervariable regions (L1, L2 or L3) within the non-framework region of the antibody VL b-sheet framework. Accordingly, CDRs are variable region sequences interspersed within the framework region sequences. CDR regions are well known to those skilled in the art and have been defined by, for example, Kabat as the regions of most hypervariability within the antibody variable (V) domains (Kabat et al. (1977) J. Biol. Chem. 252:6609-6616; Kabat (1978) Adv. Prot.
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34). Both terminologies are well recognised in the art.
  • CDR region sequences have also been defined by AbM, Contact and IMGT. The AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modelling software.
  • the “contact” hypervariable regions are based on an analysis of the available complex crystal structures. Recently, a universal numbering system has been developed and widely adopted, ImMunoGeneTics (IMGT) Information System ® (Lefranc et al. (2003) Dev. Comp. Immunol. 27(1):55-77). The IMGT universal numbering has been defined to compare the variable domains whatever the antigen receptor, the chain type, or the species [Lefranc M.-P. (1997) Immunol. Today 18: 509; Lefranc M.-P.
  • the IMGT universal numbering provides a standardised delimitation of the framework regions (FR1-IMGT: positions 1 to 26, FR2-IMGT: 39 to 55, FR3-IMGT: 66 to 104 and FR4-IMGT: 118 to 128) and of the complementarity determining regions: CDR1-IMGT: 27 to 38, CDR2-IMGT: 56 to 65 and CDR3-IMGT: 105 to 117. As gaps represent unoccupied positions, the CDR-IMGT lengths (shown between brackets and separated by dots, e.g. [8.8.13]) become crucial information.
  • the IMGT universal numbering is used in 2D graphical representations, designated as IMGT Colliers de Perles [Ruiz, M.
  • the constant regions of the antibodies mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • antibody fragment refers to a molecule comprising only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen.
  • antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CHI domains; (ii) the Fab' fragment, which is a Fab fragment having one or more cysteine residues at the C- terminus of the CH 1 domain; (iii) the Fd fragment having VH and CH 1 domains; (iv) the Fd' fragment having VH and CH 1 domains and one or more cysteine residues at the C-terminus of the CH 1 domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment which consists of a VH domain; (vii) isolated complementarity determining regions (CDRs); (viii) F(ab')2 fragments, a bivalent fragment
  • the resulting F(ab')2 fragment can be treated to reduce disulfide bridges to produce Fab' fragments. Papain digestion can lead to the formation of Fab fragments.
  • Fab, Fab' and F(ab')2, scFv, dsFv, ds-scFv, dimers, minibodies, diabodies, bispecific antibody fragments and other fragments can also be synthesized by recombinant techniques.
  • the humanized antibody or a functional fragment thereof, which is directed to the human proteolytically cleaved form of VEGFC, according to the invention comprises
  • the humanized monoclonal antibody comprises
  • the humanized monoclonal antibody comprises
  • the humanized monoclonal antibody comprises
  • the percentages of identity to which reference is made in the present invention are determined on the basis of a global alignment of sequences to be compared, that is to say, on an alignment of sequences taken in their entirety over their entire length, using any algorithm well-known to a person skilled in the art, for example the algorithm of Needleman and Wunsch 1970.
  • This sequence comparison may be performed using any software well- known to a person skilled in the art, for example using the needle software by using the "Gap open” parameter equal to 10.0, the "Gap Extend” parameter equal to 0.5, and a "BLOSUM 62" matrix.
  • the Needle software is for example available on the website ebi.ac.uk worldwide, under the name "Align”.
  • an amino acid sequence that is not 100% identical to one of those described above and in the sequence listing (reference sequences) but that has at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identity with one such reference sequence, it may have insertions, deletions or substitutions with regard to the reference sequence.
  • the substitution is preferably made with an “equivalent” amino acid, i.e., any amino acid whose structure is similar to that of the original amino acid and therefore unlikely to change the biological activity of the antibody.
  • substitutions are also named ‘conservative mutation’. Examples of such substitutions are presented in Table 2 below:
  • the CDRs sequences of the heavy chain variable region and/or of the light chain variable region have 100% identity with the SEQ ID NO:6 to SEQ ID NO: 11.
  • the CDRs sequences of the heavy chain variable region and/or of the light chain variable region may contain one or two mutations, in particular one or two conservative substitutions as disclosed above.
  • the antibody of the invention is a monoclonal antibody.
  • a “monoclonal antibody”, as used herein, means an antibody arising from a nearly homogeneous antibody population. More particularly, the subject antibodies of a population are identical except for a few possible naturally occurring mutations which can be found in minimal proportions.
  • a monoclonal antibody consists of a homogeneous antibody arising from the growth of a single cell clone (for example a hybridoma, a eukaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody, a prokaryotic host cell transfected with a DNA molecule coding for the homogeneous antibody, etc.) and is generally characterized by heavy chains of one and only one isotype and subtype, and light chains of only one type.
  • each monoclonal antibody is directed against a single epitope of an antigen.
  • antibody producing cells can be harvested from the immunized animal as described above and fused with myeloma cells by standard somatic cell fusion procedures thus immortalizing these cells and yielding hybridoma cells.
  • Such techniques are well known in the art (e. g. the hybridoma technique originally developed by Kohler and Milstein (1975) as well as other techniques such as the human B-cell hybridoma technique (Kozbor et al_, 1983), the EBV-hybridoma technique to produce human monoclonal antibodies (Roder et al., 1986), and screening of combinatorial antibody libraries (Huse et al. 1989).
  • Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with the target polypeptide(s) so that only monoclonal antibodies binding to said polypeptide(s) are isolated.
  • Humanized forms of antibodies of the invention are chimeric antibodies that contain minimal sequence derived from non- human immunoglobulin.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • framework region (FR) residues of the human immunoglobulin (recipient antibody) are replaced by corresponding non-human residues of the donor antibody.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody.
  • the humanized antibody may comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin (donor antibody having the desired specificity, affinity, and capacity) and all or substantially all of the FRs are those of a human immunoglobulin sequence.
  • humanized antibodies comprise a humanized FR that exhibits at least 65% sequence identity with an acceptor (non-human) FR, e.g., murine FR.
  • the humanized antibody also may comprise at least a portion of an immunoglobulin constant region (Fc), particularly a human immunoglobulin.
  • a humanized antibody has one or more amino acid residues introduced into it from a source, which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain. Humanization may be essentially performed by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • variable domains both light and heavy
  • Other methods generally involve conferring donor CDR binding affinity onto an antibody acceptor variable region framework.
  • One method involves simultaneously grafting and optimizing the binding affinity of a variable region binding fragment.
  • Another method relates to optimizing the binding affinity of an antibody variable region.
  • Humanization by CDR grafting is a proven, successful technique to take antibodies originating from murine, other xenogenic species or hybridomas and reduce the potential immunogenicity whilst retaining the binding and functional activity of the Parental antibody.
  • the aim is to remove the foreign framework regions (FR) in the variable domains that can evoke an immune response (Bruggemann et al. 1987).
  • CDRs complementarity determining regions
  • a human Acceptor framework Jones et al., 1986.
  • CDR-grafting alone can lead to a significant reduction or complete loss of binding affinity, as a set of supporting framework residues in the Vernier zone are important for maintaining the conformation of the CDRs (Foote and Winter 1992).
  • This problem can be solved by reintroducing murine residues into the human framework (Queen et al. , 1989); such substitutions are commonly called back-mutations.
  • corresponding humanized V H and V L peptide sequences were determined by: identifying the CDR and framework regions in the murine sequences using the IMGT-ONTOLOGY database (Duroux et al. 2008 ; Giudicelli et al_ 1999) and IMGT® databases and tools (Ehrenmann et al., 2010;
  • nucleotide and amino acid sequences of murine V H and V L domains were analyzed using IMGT/V-QUEST and IMGT/ DomainGapAlign to delimit the murine CDRs and framework regions, define CDR lengths and identify anchor amino acids.
  • Anchor amino acids are residues at position 26, 39, 55, 66, 104 and 118 of IMGT “Collier de Perles” that support the CDR1-IMGT, CDR2-IMGT, CDR3-IMGT (Lefrancetal. 2007; Kaas et al., 2007).
  • the closest human V (variable) and J (joining) genes to the murine sequences were identified and the most suitable genes chosen.
  • Individual amino acids in the murine framework region were maintained if they were considered to possibly contribute to the specificity of the antibody by comparison with known 3D structures (Kaas et al. , 2007) using IMGT Collier de Perles on two layers.
  • the humanization procedure is performed as outlined below and based on Kabat nomenclature:
  • Antibody Fv have a number of critical positions that make up the VH/VL inter chain interface or are responsible for the discrete set of canonical structures that has been defined for 5 of the CDRs (Chothia and Lesk 1987; Martin and Thornton 1996; Al Laziniki et al. 1997): these positions should be considered in detail before substitutions are proposed for them.
  • optimal Acceptor human germline sequences are selected for each chain: based on the Parental mouse antibody sequence alignment to the human germlines, the closest matching entries are identified; the identification of the optimal human germlines as Acceptor is based on the ordered criteria listed below:
  • positions are categorised as Neutral Contributing or Critical;
  • the CDR-grafting is performed by analyzing positions differing between the Parental mouse and Acceptor human sequences. All substitutions in Neutral positions were performed. For the design phase of a humanized antibody, the procedure is more accurately defined as germlining - replacing amino acids in the Parental mouse framework that differ from the chosen Acceptor with the corresponding human amino acid;
  • the selection of the best humanized heavy and light chain combination between the different versions is performed by assessing the following criteria: a) The level of transient expression of the humanized versions produced in mammalian cells (HEK 293 or preferably CHO) as human lgG1/Kappa (as compared to the chimeric version).
  • tissue culture supernatant from transfected cells before harvest for purification using ELISA or measurement by protein A using Octet label-free detection systems b) The binding capacity (EC50 by ELISA or FACS; or preferably Kd by Biacore or Octet) as compared to the chimeric human lgG1/Kappa version (chimeric meaning the combination of the parental murine VH and VL fused to human constant regions); c) The biological activity of the humanized versions in a relevant in vitro cellular assay compared with that of the reference chimeric antibody; d) The cross-reactivity with relevant orthologue species (in vitro binding activity); e) A determination of the biophysical properties of the humanized versions as compared with chimeric:
  • step 3 of the method of immunization optimal Acceptor human germline sequences are selected for each chain.
  • Table 3 summarizes examples of heavy and light variable chains from murine and selected human germlines for designing the humanized antibodies of the present invention. This table also discloses consensus sequence for each group and sub-group of sequences VH and VL
  • Another object of the present invention is a humanized monoclonal anti-vascular endothelial growth factor-C (VEGFC) antibody or a functional fragment thereof, comprising (i) the three heavy-chain CDRs of sequences SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8 under Kabat (ii) the three light-chain CDRs of sequences SEQ ID NO: 9, SEQ ID NO: 10 and SEQ ID NO: 11 under Kabat,
  • VEGFC monoclonal anti-vascular endothelial growth factor-C
  • X5 V or A X6: L or M X7: K or R X8: I or T X9: A or V
  • the antibody of the invention comprises: (i) the three heavy-chain CDRs of sequences SEQ ID NO: 6, SEQ ID NO: 7 and SEQ
  • a heavy chain variable domain comprising a consensus sequence selected in the groups consisting of SEQ ID NO: 14, SEQ ID NO: 47, SEQ ID NO: 81, SEQ ID NO:
  • a light chain variable domain comprising a consensus sequence SEQ ID NO: 129.
  • its heavy chain variable domain comprises a sequence selected in the groups consisting of SEQ ID NO: 15 to 46, SEQ ID NO:48 to 79, SEQ ID NO: 82 to 89, SEQ ID NO: 91 to 98, SEQ ID NO: 150, and SEQ ID NO: 152 to 159 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences
  • its light chain variable domain comprises a sequence selected in the group consisting of SEQ ID NO: 130 to 133, and SEQ ID NO: 151 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 15 to 46, SEQ ID NO:48 to 79, SEQ ID NO: 82 to 89, SEQ ID NO: 91 to 98, SEQ ID NO: 150, and SEQ ID NO: 152 to 159 and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO: 130 to 133 and SEQ ID NO: 151.
  • Each combination of one heavy chain variable domain sequence of each sub-group and one light chain variable domain sequence of the group of SEQ ID NO: 130 to 133 is encompassed by the present invention.
  • the antibody of the invention comprises:
  • a heavy chain variable domain comprising a consensus sequence selected in the groups consisting of SEQ ID NO: 14, SEQ ID NO: 47, SEQ ID NO: 81 , SEQ ID NO: 90 and SEQ ID NO: 147 and
  • a light chain variable domain comprising a consensus sequence SEQ ID NO: 135.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 15 to 46, SEQ ID NO:48 to 79, SEQ ID NO: 82 to 89, SEQ ID NO: 91 to 98 and SEQ ID NO: 150, and SEQ ID NO: 152 to 159 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO: 136 to 143 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 15 to 46, SEQ ID NO:48 to 79, SEQ ID NO: 82 to 89, SEQ ID NO: 91 to 98 and SEQ ID NO: 150, and SEQ ID NO: 152 to 159 and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO: 136 to 143.
  • Each combination of one heavy chain variable domain sequence of each sub-group and one light chain variable domain sequence of the group of SEQ ID NO: 136 to 143 is encompassed by the present invention.
  • the antibody of the invention comprises:
  • a light chain variable domain comprising a consensus sequence SEQ ID NO: 129.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 101 to 108, SEQ ID NO: 111 to 118 and SEQ ID NO: 120 to 127 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ I D NO: 130 to 133 and SEQ ID NO: 151, or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 101 to 108, SEQ ID NO: 111 to 118 and SEQ ID NO: 120 to 127 and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO:130 to 133 and SEQ ID NO: 151.
  • Each combination of one heavy chain variable domain sequence of each sub-group and one light chain variable domain sequence of the group of SEQ ID NO: 130 to 133 is encompassed by the present invention.
  • the antibody of the invention comprises:
  • a heavy chain variable domain comprising a consensus sequence selected in the groups consisting of SEQ ID NO: 100, SEQ ID NO: 110 and SEQ ID NO: 119 and
  • a light chain variable domain comprising a consensus sequence SEQ ID NO: 135.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 101 to 108, SEQ ID NO: 111 to 118 and SEQ ID NO: 120 to 127 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO: 136 to 143 or any sequence exhibiting at least 80%, 85%, 90%, 95% or 98% identity with said sequences.
  • its heavy chain variable domain (iii) comprises a sequence selected in the groups consisting of SEQ ID NO: 101 to 108, SEQ ID NO: 111 to 118 and SEQ ID NO: 120 to 127 and its light chain variable domain (iv) comprises a sequence selected in the group consisting of SEQ ID NO: 136 to 143.
  • Each combination of one heavy chain variable domain sequence of each sub-group and one light chain variable domain sequence of the group of SEQ ID NO: 136 to 143 is encompassed by the present invention.
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO: 15 to 46 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO: 15 to 46 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:48 to 79 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:48 to 79 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:82 to 89 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:82 to 89 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO:
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:91 to SEQ ID NO: 98 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:91 to SEQ ID NO: 98 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO: 101 to SEQ ID NO: 108 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:101 to SEQ ID NO: 108 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:111 to SEQ ID NO: 118 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:111 to SEQ ID NO: 118 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:120 to SEQ ID NO: 127 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 129, in particular a sequence of SEQ ID NO: 130 to SEQ ID NO: 133.
  • VH heavy chain variable region
  • VL light chain variable region
  • the humanized antibody of the present invention comprises a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:120 to SEQ ID NO: 127 and a light chain variable region (VL) comprising a consensus sequence SEQ ID NO: 135, in particular a sequence of SEQ ID NO: 136 to SEQ ID NO: 143.
  • VH heavy chain variable region
  • VL light chain variable region
  • the present invention encompasses any humanized antibody comprising a heavy chain variable region (VH) comprising a sequence as disclosed above and a light chain variable region (VL) comprising a sequence as disclosed above, meaning that all combinations 2 to 2 are encompassed by the present invention.
  • VH heavy chain variable region
  • VL light chain variable region
  • the table 5 discloses the amino acids sequences of each variable heavy chain (VH) and variable light chain (VL) for the murine chimeric antibody (SEQ ID NO: 148) and the humanized anti- VEGFC antibodies illustrated in the following examples.
  • the humanized monoclonal anti-vascular endothelial growth factor-C (VEGFC) antibody of the present invention is selected in the group consisting of: a humanized anti- VEGFC antibody comprising a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:150 and a light chain variable region
  • VL comprising a sequence of SEQ ID NO: 151; a humanized anti- VEGFC antibody comprising a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:152 and a light chain variable region (VL) comprising a sequence of SEQ ID NO:151; a humanized anti- VEGFC antibody comprising a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:153 and a light chain variable region (VL) comprising a sequence of SEQ ID NO:151; a humanized anti- VEGFC antibody comprising a heavy chain variable region (VH) comprising a sequence of SEQ ID NO: 154 and a light chain variable region (VL) comprising a sequence of SEQ ID NO:151; a humanized anti- VEGFC antibody comprising a heavy chain variable region (VH) comprising a sequence of SEQ ID NO:155 and a light chain variable region (VL) comprising a sequence of SEQ ID NO:151; a humanized
  • Antibodies may be isolated after production (e.g., from the blood or serum of the animals) or synthetized and further purified by well-known techniques. Antibodies specific for a protein can be selected or purified by affinity chromatography, ELISPOT or ELISA.
  • the proteolytically cleaved form of VEGFC can be covalently or non-covalently coupled to a solid support such as, for example, a chromatography column. The column can then be used to purify antibodies directed to the proteolytically cleaved form of VEGFC, from a sample containing antibodies directed against a large number of different epitopes, thereby generating a substantially purified antibody composition, i.e., one that is substantially free of contaminating antibodies.
  • substantially purified antibody composition it is meant, in this context, that the antibody sample contains at most only 30% (by dry weight) of contaminating antibodies directed against epitopes other than those of the Strep-Tag II sequence, and preferably at most 20%, yet more preferably at most 10% and most preferably at most 5% (by dry weight) of the sample is contaminating antibodies.
  • a “purified antibody composition” means that at least 99% of the antibodies in the composition are directed to the proteolytically cleaved form of VEGFC.
  • the humanized antibodies of the invention may be administered in their "naked” or unconjugated form or may have other agents conjugated to them.
  • the humanized antibodies may be in detectably labelled form.
  • Antibodies can be detectably labelled through the use of radioisotopes, affinity labels (such as biotin, avidin, etc.), enzymatic labels (such as horseradish peroxidase, alkaline phosphatase, etc.) fluorescent labels (such as FITC or rhodamine, etc.), paramagnetic atoms, and the like. Procedures for accomplishing such labelling are well known in the art.
  • the humanized antibody of the invention is lyophilized.
  • the lyophilized antibody is admixed with a carrier or diluent such as those hereinabove described at the time of administration.
  • the humanized antibody of the invention is conjugated to a compound such as a polymer.
  • the polymer is a polyalkylene glycol.
  • the polyalkylene glycol is polyethylene glycol, or PEG.
  • the humanized antibody(ies) will be suitably formulated together with pharmaceutically acceptable excipients.
  • suitable formulations for the preventive or therapeutical treatment can be administered parenterally, preferably intra-arterially, intraperitoneally, intravenously, subcutaneously, intramuscularly or via an aerosol, and they will contain an effective amount of the antibody(ies). Said amount will vary depending on the general conditions of the patient, the progression of the disease and other factors. Production of the said antibodies
  • the murine antibody 1E9 was previously obtained by immunizing mice, with peptides specific for human proteolytically cleaved form of VEGFC, particularly with the mature peptide of sequence
  • AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEG LQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR (SEQ ID NO: 1) of the VEGFC human protein ((NCBI Reference Sequence NP_005420), following by screening methods to isolate antibody. Different screening methods to isolate antibody can be used including ELISA tests on said peptide.
  • the antibody of the invention is produced by the hybridoma.
  • the hybridoma has been obtained by immunization of mice with a peptide specific for human proteolytically cleaved form of VEGFC i.e. , the peptide of sequence AHYNTEILKSIDNEWRKTGCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEG LGCMNTSTSYLSKTLFEITVPLSGGPKPVTISFANHTSCRCMSKLDVYRGVHSIIRR (SEQ ID NO: 1) of the VEGFC human protein ((NCBI Reference Sequence NP_005420).
  • This strategy was developed to obtain specific hybridoma producing anti-VEGFC antibodies.
  • the screening was based on the ability of the hybridoma to recognize the VEGFC antigen used in the immunization protocol by ELISA.
  • the flow-chart of the experiment is described in Figure 2. Thirteen clones were selected for their ability to produce specific antibodies and the six best were amplified.
  • This hybridoma produces high yields of antibodies of the invention.
  • the humanized antibodies of the present invention may be produced accordingly by using the sequences of heavy and light variable chains as disclosed above in an expression vector under the control of a promoter which is effective in cells of non-human animal.
  • the antibodies of the invention inhibit tumors growth;
  • the humanized antibodies of the invention target specifically the lymphatic pathway different of the classical angiogenic pathway. Hence by inhibiting lymphatic pathway, proliferation and/or migration of tumor cells (metastases) are prevented or inhibited by the antibodies of the invention.
  • the present invention also relates to a polynucleotide encoding a variable heavy chain (VH) for a humanized anti-VEGFC antibody according to the invention and a variable light chain (VL) for an anti- VEGFC antibody according to the invention, or both a variable heavy chain (VH) and a variable light chain (VL) for a humanized monoclonal anti- VEGFC antibody according to the invention.
  • the invention also relates to a combination of two polynucleotides encoding a variable heavy chain (VH) and a variable light chain (VL) for a humanized monoclonal anti- VEGFC antibody according to the invention.
  • polynucleotide refers to a polymeric form of nucleotides, either deoxyribonucleotides or ribonucleotides, or analogues thereof.
  • the table 6 discloses the nucleotididic sequences encoding variable heavy chain (V H ) and variable light chain (VL) for the murine chimeric antibody and for the humanized anti- VEGFC antibodies illustrated in the following examples. Table 6
  • the polynucleotide or combination of two polynucleotides encoding a variable heavy chain (VH) for a humanized anti-VEGFC antibody and a variable light chain (VL) for an anti- VEGFC antibody according to the invention is selected in the group consisting of: a polynucleotide or combination of two polynucleotides comprising a sequence of SEQ ID NO: 162 encoding for a heavy chain variable region (VH) and a sequence of SEQ ID NO:163 encoding a light chain variable region (VL); a polynucleotide or combination of two polynucleotides comprising a sequence of SEQ ID NO:164 encoding for a heavy chain variable region (VH) and a sequence of SEQ ID NO:163 encoding a light chain variable region (VL); a polynucleotide or combination of two polynucleotides comprising a sequence of SEQ ID NO:165
  • Another object of the invention is an expression vector comprising the polynucleotide or combination of two polynucleotides encoding a humanized antibody or a fragment thereof according to the invention.
  • the vectors can be viral vectors such as bacteriophages or non-viral such as plasmids.
  • the present invention also concerns a non-human host cell transformed with a polynucleotide ora combination of two polynucleotides suitable forexpressing a humanized anti-VEGFC according to the invention.
  • the invention also relates to a host cell comprising the polynucleotide or a combination of two polynucleotides encoding a humanized antibody or a functional fragment thereof according to the invention or a vector comprising the polynucleotide or a combination of two polynucleotides.
  • Another object of the invention is a method of producing a humanized anti-VEGFC antibody according to the invention comprising: culturing the non-human host cell of the invention transformed with a polynucleotide according to the invention or a combination of two polynucleotides suitable for expressing an anti-VEGFC according to the invention, in particular non-human fibroblasts, under suitable conditions and recovering the humanized anti-VEGFC antibody from the culture medium or from the said cultured cells.
  • Another object of the invention is a combination of a humanized monoclonal antibody anti- VEGFC according to the invention and an anti-angiogenic compound.
  • combination refers to simultaneous (concurrent) or consecutive administration in any order.
  • the combined administration includes co- administration, using separate formulations or a single pharmaceutical formulation or composition, and consecutive administration in any order. Thanks to the present invention, the subject receiving the combined treatment will be completely treated (cured), i.e., the subject will survive to the cancer [beneficial impact on the "overall survival” (OS)], or will have a much longer disease- free survival (DFS) or metastasis free survival chance than a subject who does not receive said combined treatment.
  • OS overall survival
  • DFS disease- free survival
  • anti-angiogenic compound refers to any compound that inhibits the development of a pathological vascular network.
  • the anti-angiogenic compound can inhibit receptors of pro-angiogenic factors like VEGF receptors and receptors of CXCL/ELR+ chemokines (e.g., CXCR1 and CXCR2).
  • the anti-angiogenic compound is selected from the group consisting of:
  • Antibodies anti-VEGFA like bevacizumab, aflibercept (particularly for the treatment and/or prevention of cancers, in particular colorectal cancer);
  • Inhibitors of receptors involved in angiogenesis including VEGFR1, 2, 3, CSFR, PDGFR, like sunitinib, sorafenib, axitinib, cabozantinib, pazopanib, lenvatinib, regorafenib;
  • Inhibitors of m-TOR like everolimus, temsirolimus; - And mixtures thereof.
  • the anti-angiogenic compound is selected from the group consisting of antibodies anti-VEGF distinct from the anti-VEGFC humanized antibody of the invention, inhibitors of receptors involve in angiogenesis including VEGFR1, 2, 3, CSFR, PDGFR, inhibitors of m-TOR, preferably an anti-VEGF antibody distinct from the anti- VEGFC antibody of the invention.
  • the anti-angiogenic compound is an anti-VEGF antibody distinct from the humanized anti-VEGFC antibody of the invention.
  • the anti-VEGF antibody distinct from the humanized anti- VEGFC antibody of the invention is selected from the group consisting of bevacizumab and aflibercept.
  • the combination may further comprise another anti-angiogenic compound selected from inhibitors of receptors involved in angiogenesis including VEGFR1 , 2, 3, CSFR, PDGFR, in particular selected from the group consisting of sunitinib, sorafenib, axitinib, carbozantinib, pazopanib, lenvatinib, and regorafenib.
  • another anti-angiogenic compound selected from inhibitors of receptors involved in angiogenesis including VEGFR1 , 2, 3, CSFR, PDGFR, in particular selected from the group consisting of sunitinib, sorafenib, axitinib, carbozantinib, pazopanib, lenvatinib, and regorafenib.
  • the combination may also comprise at least another compound of interest (e.g. an anti tumor agent, an anti-inflammatory compound).
  • an anti tumor agent e.g. an anti tumor agent, an anti-inflammatory compound.
  • anti-tumor agent refers to any compound that prevents tumor growth or promotes tumor shrinking.
  • Anti-tumor agents can be anti-angiogenic compounds, DNA intercalators/ Cross-linkers (like oxaliplatin, mitoxantrone), DNA synthesis inhibitors (like cytosine b-D-arabinofuranoside, 5-Fluorouracil), DNA-RNA Transcription Regulators (doxorubicin, actinomycin D), Microtubule Inhibitors (paclitaxel, nocodazole).
  • anti-inflammatory compound refers to any compound that reduces inflammation.
  • anti-inflammatory compound can be corticoid and non steroid anti-inflammatory agent ibuprofen derivative. So, the invention also relates to a combination product, which comprises:
  • compositions Another object of the invention is a pharmaceutical composition comprising a humanized anti-VEGFC antibody according to the invention ora combination according to the invention and an excipient, carrier, and/or diluent.
  • Such humanized antibody or combination can be present in the pharmaceutical composition or medicament according to the invention in a therapeutically effective amount (active and non-toxic amount).
  • a therapeutically effective amount refers to that amount of compound which ameliorates the symptoms or condition.
  • Therapeutic efficacy and toxicity may be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., ED50 (the amount therapeutically effective in 50% of the population) and LD50 (the dose lethal to 50% of the population). The amount ratio of toxic to therapeutic effects is the therapeutic index and it can be expressed as the ratio, LD50/ED50.
  • compositions which exhibit large therapeutic indices are preferred.
  • the antibody according to the invention can be administered to a patient, in particular intravenously, in an amount, within the range from 0.1 pg/kg to 100 mg/kg, particularly from 1 mg/kg to 50 mg/kg of body weight of said patient at least every month, particularly at least every three weeks, more particularly at least every two weeks.
  • the humanized anti-VEGFC antibody, or functional fragment thereof is administered to the subject in a therapeutically effective amount [amount effective to reduce the number of cancer cells, kill cancer cells, reduce the tumor volume/size, or inhibit tumor growth, in particular when the anti-VEGFC humanized antibody is used in combination with the conventional treatment] or prophylactically effective amount [amount effective to reduce or suppress lymphatic vessels formation or development and/or reduce or prevent the occurrence of new metastasis(es) or the development of existing metastasis(es)], typically at a concentration range from about 2 to 20 mg/kg of body weight, preferably from about 5 to 15 mg/kg of body weight, for example 6, 7, 8, 9, 10, 11, 12, 13 or 14 mg/kg of body weight, preferably 10 mg/kg of body weight.
  • composition according to the invention may be administered by any number of routes including, but not limited to, oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intraventricular, transdermal, subcutaneous, intraperitoneal, intranasal, enteral, topical, sublingual, rectal means or ocular.
  • the pharmaceutical composition of the invention may contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations which can be used pharmaceutically.
  • suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations which can be used pharmaceutically.
  • the pharmaceutical composition according to the invention is formulated in a pharmaceutical acceptable carrier.
  • Pharmaceutical acceptable carriers are well known by one skilled in the art. Further details on techniques for formulation and administration may be found in the latest edition of Remington’s Pharmaceutical Sciences (Maack Publishing Co., Easton, Pa.).
  • the pharmaceutical acceptable carrier comprises or is an isotonic solution.
  • a further object herein described is a kit or composition, comprising (i) a conventional treatment, and (ii) a humanized anti-VEGFC antibody, or functional fragment thereof as herein described.
  • a "conventional treatment of cancer” may be selected from a chemotherapy, a radiotherapy, an hormonotherapy, an immunotherapy, a specific kinase inhibitor-based therapy, an antiangiogenic compound based-therapy, an antibody-based therapy, in particular a monoclonal antibody-based therapy, and surgery.
  • the conventional treatment comprises an anti-angiogenic compound.
  • the present invention also relates to a humanized monoclonal antibody as defined in the invention, or a combination of the invention or a pharmaceutical composition of the invention, for use in therapy or diagnosis, in particular in the treatment of cancers or disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation, or in an in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound
  • the present invention also relates to a humanized antibody as defined in the invention, or a combination of the invention or a pharmaceutical composition of the invention, for use as a medicament.
  • the patient or subject is a mammal.
  • the mammal may be a primate, particularly a human being (also herein identified as "human”).
  • the mammal is a human being, whatever its age or sex.
  • the subject has a tumor or cancer, typically a malignant tumor, in particular a metastatic (malignant) tumor, or a pathological characterized by exacerbated lymphangiogenesis and/or VEGFC-dependent fibrosis.
  • the cancer or "malignant tumor” may be any kind of cancer or neoplasia, typically metastatic cancer or neoplasia.
  • the cancer or tumor can be selected from a carcinoma, a sarcoma, and a.
  • the cancer is preferably selected from a renal or kidney cancer, preferably a renal cancer carcinoma (RCC), in particular a clear cell renal cancer carcinoma (ccRCC); a breast cancer; ovarian cancers, lung cancers, head and neck cancer, pancreatic cancers and colon cancers.
  • RCC renal cancer carcinoma
  • ccRCC clear cell renal cancer carcinoma
  • the said antibody or the said combination or the said pharmaceutical composition are used in the treatment of cancers or disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation, in particular renal cancer carcinoma (RCC), breast cancer, head and neck cancers, , retinopathies, arthritis or rheumatoid arthritis, preferably renal cancer carcinoma (RCC).
  • RCC renal cancer carcinoma
  • RRC renal cancer carcinoma
  • treat refers to both therapeutic treatment and prophylactic or preventative measures, wherein the aim is to prevent or ameliorate cancer or prevent or slow down cancer progression or metastases appearance, development or multiplication.
  • Those in need of treatment include those already with the disorder as well as those in which the disorder is to be prevented.
  • preventing refers to keeping from occurring, or to hinder, defend from, or protect from the occurrence of a condition, disease, disorder, or phenotype, including an abnormality or symptom.
  • a subject in need of prevention may be prone to develop the condition.
  • disorders characterized by undesirable lymphatic endothelial cell migration and/or proliferation means in particular disorders selected from the group consisting of: cancers with abnormal angiogenesis, in particular solid tumors with abnormal angiogenesis, more particularly renal cancers including clear cell renal cell carcinoma, breast cancers, head and neck cancers, ovarian cancers, lung cancers, pancreatic cancers and colon cancers; ophthalmological diseases with abnormal angiogenesis, in particular age-related macular degeneration, diabetic retinopathy, retinitis pigmentosa and uveitis; rheumatoid arthritis;
  • said pathological angiogenesis disease is a cancer, and preferably a clear cell renal cell carcinoma.
  • the said humanized antibody or the said combination or the said pharmaceutical composition are used in a subject who is relapsed from or refractory to its conventional treatment, and/or who is developing or is at risk of developing tumor metastasis.
  • the subject is typically a subject undergoing a treatment of cancer, in particular a conventional treatment of cancer (for example chemotherapy and/or radiotherapy).
  • a treatment of cancer for example chemotherapy and/or radiotherapy.
  • conventional treatment means that the therapy is applied or, if not routinely applied, is appropriate and at least recommended by health authorities.
  • the "conventional” treatment is selected by the cancerologist depending on the specific cancer to be prevented or treated.
  • a "conventional treatment of cancer” may be selected from a chemotherapy, a radiotherapy, a hormonotherapy, an immunotherapy, a specific kinase inhibitor-based therapy, an antiangiogenic compound based-therapy, an antibody- based therapy, in particular a monoclonal antibody-based therapy, and surgery.
  • the invention also relates to a method of treatment of diseases characterized by undesirable lymphatic endothelial cell migration and/or proliferation, said method comprises the step of administering to a patient in need thereof a therapeutically or prophylactic amount of at least one humanized anti-VEGFC antibody or a functional fragment thereof according to the invention, a combination according to the invention or a pharmaceutical composition according to the invention, as disclosed above.
  • Another object of the invention is an in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, characterized in that said method comprises a step of contacting a biological sample of said subject with a humanized anti- VEGFC antibody of the invention, it being possible for said antibody to be, if necessary, labelled.
  • the subject is affected by a cancer or a disease related to undesirable lymphatic cell proliferation and/or migration and is treated by a conventional treatment.
  • a conventional treatment comprises an anti-angiogenic treatment, in particular an anti-VEGF antibody distinct from a humanized anti-VEGFC antibody according to the invention.
  • the method comprises a step of determining the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample, by detecting and/or quantifying the binding of said antibody according to the invention with the mature form of VEGFC that specifically binds to VEGF-R3 expressed on lymphatic endothelial cells.
  • the invention also relates to an in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, said method comprising: i) determining the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject using at least one humanized anti-VEGFC antibody and/or a functional fragment thereof according to the invention; ii) comparing said level of expression determined at step i) to a control level and determining if said subject has a risk to relapse and/or to develop a tumor metastasis.
  • step i) can be performed by an ELISA assay, wherein the humanized anti- VEGFC antibody or a functional fragment thereof of the invention is immobilized on a microtiter plate, said plate being thereafter incubated with at least one labelled secondary antibody directed proteolytically cleaved form of VEGFC, which recognize the antibody and/or a functional fragment thereof according to the invention, in appropriate conditions well-known in the art.
  • the method of the invention comprises the step ii) of comparing said level of expression determined at step i) to a control level and determining if said level of expression determined at step i) is significantly higher than said control level; said significantly higher level of expression indicates that the subject is has a risk to relapse and/or to develop a tumor metastasis; wherein said control level is the expression level of said proteolytically cleaved form of VEGFC determined in at least a biological sample from an healthy subject, or from a subject who is not affected with a disease related to undesirable lymphatic cell proliferation and/or migration or a cancer.
  • biological sample encompasses a variety of sample types obtained from an organism that may be used in a diagnostic or prognostic assay.
  • the term encompasses blood and other liquid samples of biological origin, solid tissue samples, such as a biopsy specimen, or tissue cultures or cells derived there from and the progeny thereof. Additionally, the term may encompass circulating tumors or other cells.
  • the term specifically encompasses a clinical sample, and further includes cells in cell culture, cell supernatants, cell lysates, serum, plasma, urine, amniotic fluid, biological fluids including aqueous humour and vitreous for eyes samples, and tissue samples.
  • the term also encompasses samples that have been manipulated in any way after procurement, such as treatment with reagents, solubilisation, or enrichment for certain components.
  • the biological sample can be selected from the group comprising a bodily fluid, a fraction thereof, tissue extract and, cell extract.
  • the biological sample can be selected from the group comprising plasma sample and tumor extract.
  • the method for detecting in a sample the proteolytically cleaved form of VEGFC that specifically binds to VEGF-R3 according to the invention can be based on various techniques, well known by one skilled in the art, including, but not limited to:
  • an ELISA assay (the proteolytically cleaved form of VEGFC being immobilized on a microtiter plate, the said plate being thereafter incubated with the antibody of the invention, preferably labelled, in appropriate conditions well-known in the art),
  • an immunohistochemistry assay (the recombinant antibody, preferably labelled, being used to stain a sample containing fixed cells or tissues expressing the VEGFC),
  • the recombinant antibody preferably labelled, being used to stain a sample containing fixed or living cells expressing the VEGFC, in appropriate conditions well-known in the art.
  • the antibody of the invention is coated on a solid support.
  • any other detection techniques requiring the use of an antibody are herein encompassed.
  • the presence and eventually the amount of said cells expressing proteolytically cleaved form of VEGFC in said sample can be determined thanks to these techniques.
  • Some of these techniques require labelling the antibody of the invention with a detectable marker, preferably a fluorescent or a luminescent marker, as disclosed above.
  • a detectable marker preferably a fluorescent or a luminescent marker
  • the invention also relates to in vitro or ex vitro diagnostic and/or prognostic method of a disease related to undesirable lymphatic cell proliferation and/or migration, in particular of clear cell renal cell carcinoma, in a subject, said method comprising: i) determining the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject using at least one humanized anti-VEGFC antibody and/or a functional fragment thereof according to the invention; ii) comparing said level of expression determined at step i) to a control level and determining if said subject is affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly with a clear cell renal cell carcinoma.
  • step i) can be performed by further using at least one labelled secondary antibody directed to proteolytically cleaved form of VEGFC that recognizes the humanized anti-VEGFC antibody and/or a functional fragment thereof of the invention.
  • step i) can be performed by an ELISA assay, wherein the humanized anti-VEGFC antibody or a functional fragment thereof of the invention is immobilized on a microtiter plate, said plate being thereafter incubated with at least one labelled secondary antibody directed proteolytically cleaved form of VEGFC, which recognize the humanized antibody and/or a functional fragment thereof according to the invention, in appropriate conditions well-known in the art.
  • the method of the invention comprises the step ii) of comparing said level of expression determined at step i) to a control level and determining if said level of expression determined at step i) is significantly higher than said control level; said significantly higher level of expression indicates that the subject is affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly with clear cell renal cell carcinoma; wherein said control level is the expression level of said proteolytically cleaved form of VEGFC determined in at least a biological sample from an healthy subject, or from a subject who is not affected with a disease related to undesirable lymphatic cell proliferation and/or migration, particularly with clear cell renal cell carcinoma.
  • the invention also relates to in vitro or ex vitro method to determine a bad outcome of a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, in a subject, said method comprising: a) determining the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject using at least one antibody and/or a functional fragment thereof according to the invention.
  • the method of the invention can further comprise the step b) of comparing said level of expression determined at step a) to a control level and determining if said subject is or not undergoing a bad outcome of a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of a clear cell renal cell carcinoma.
  • control level include the expression level of said proteolytically cleaved form of VEGFC determined in at least one reference sample and a reference threshold value.
  • a “reference sample” is a biological sample from a subject with a known state of disease related to undesirable lymphatic cell proliferation and/or migration, more particularly a known clear cell clear cell renal cell carcinoma state, or from a healthy subject, or from a subject who is not affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly with clear cell renal cell carcinoma.
  • control level is the mean expression levels of said proteolytically cleaved form of VEGFC determined in several reference samples, from several subjects.
  • the reference sample is the same type of biological sample (i. e. a biological sample of corresponding physiological nature) than said biological sample of step i) or a).
  • the method of the invention comprises the step b) of comparing said level of expression determined at step a) to a control level and determining if said level of expression determined at step a) is significantly higher than said control level; said significantly higher level of expression indicates a bad outcome of disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma in said subject; wherein said control level is the expression level of said proteolytically cleaved form of VEGFC determined in at least a biological sample from a healthy subject, or from an subject who is not affected with a disease related to undesirable lymphatic cell proliferation and/or migration,, particularly with a pathological angiogenesis disease, more particularly with clear cell renal cell carcinoma.
  • control level include the expression level of said proteolytically cleaved form of VEGFC determined in the same type of biological sample of a healthy subject, of a subject who is not affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly with clear cell renal cell carcinoma.
  • control level is the mean expression levels of said proteolytically cleaved form of VEGFC determined in the same type of biological sample of several healthy subjects, of several subjects who are not affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly with clear cell renal cell carcinoma.
  • Said significant higher level of expression of said proteolytically cleaved form of VEGFC can corresponds to an increase of expression of at least more than 10 %, more than 15 %, more than 20 %, more than 25 %, more than 30 %, preferably more than 35 % of said control level.
  • Such a reference threshold value may vary depending on the type of tested biological sample and the method used for determining the level of expression of said proteolytically cleaved form of VEGFC. However, for particular experimental conditions (same type of tested biological sample, same method for determining the level of expression of said at least one chemokine), said threshold value may be determined based on a reference pool of patients comprising both a population of patients with stable disease related to undesirable lymphatic cell proliferation and/or migration, more particularly stable clear cell renal cell carcinoma (alive patients) and a population of patients undergoing a bad outcome of disease related to undesirable lymphatic cell proliferation and/or migration, in particular clear cell renal cell carcinoma (deceased patients).
  • a reference threshold value T can be determined by the following features: all or most reference patients with stable disease related to undesirable lymphatic cell proliferation and/or migration, more particularly stable clear cell renal cell carcinoma (alive patients) have at least proteolytically cleaved form of VEGFC expression level values inferior to T; and all or most reference patients undergoing a bad outcome of disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma (deceased patients) have at least proteolytically cleaved form of VEGFC expression level values superior to T.
  • said level of expression determined at step i) is significantly higher than said threshold value T, it indicates a bad outcome of disease related undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma in said subject.
  • expression generally refers to the process by which a polynucleotide sequence undergoes successful transcription and translation such that detectable levels of the amino acid sequence or protein are expressed.
  • expression refers to the production of mRNA.
  • expression refers to the production of protein or fragments thereof. The functional fragments may be produced via enzymatic cleavage or biological processes characteristic of normal or diseased conditions.
  • any of a variety of known methods may be used for detection of said proteolytically cleaved form of VEGFC in said biological sample of said individual, including, but not limited to, immunoassay, using antibody or a functional fragment thereof according to the invention, e.g., by enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and the like.
  • immunoassay using antibody or a functional fragment thereof according to the invention, e.g., by enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and the like.
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • the invention also relates to a kit for carrying out the in vitro method for diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, said kit comprises at least one humanized anti-VEGFC antibody and/or a functional fragment thereof according to the invention.
  • the invention also relates to a kit for carrying out the in vitro diagnostic and/or prognostic method of a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, in a subject, said kit comprises at least one humanized anti-VEGFC antibody and/or a functional fragment thereof according to the invention.
  • kits may provide additional components that are useful in methods of the invention, including, but not limited to, buffers, developing reagents, labels, reacting surfaces, means for detection, control samples, standards, instructions, and interpretive information for determining if a subject is affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma.
  • the kit can also comprise: at least one reagent for detecting said humanized anti-VEGFC antibody or a functional fragment thereof according to the invention.
  • the invention also relates to a method comprising: G) diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, in particular according to the method of the invention disclosed above; and ii”) treating subject having the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, with a pharmaceutical composition or combination of the invention as disclosed above.
  • said method comprises:
  • G diagnosing or predicting the risk to relapse and/or to develop a tumor metastasis in a subject treated by its said conventional treatment, comprising the determination of the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject, and ii”) treating a subject having the risk to relapse and/or to develop a tumor metastasis in a subject treated by its conventional treatment comprising an anti-angiogenic compound, with a pharmaceutical composition or combination of the invention, comprising the administration of at least an humanized anti-VEGFC antibody or a functional fragment thereof according to the invention; or a combination of said humanized anti-VEGFC antibody with at least an anti-angiogenic compound and optionally another compound selected from anti-tumor compound and anti-inflammatory compound, for simultaneous, separate or sequential administration.
  • the invention also relates to a method comprising:
  • said method comprises: i") diagnosing a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, in a subject, comprising the determination of the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject; and ii”) treating a subject affected with a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, with a pharmaceutical composition or combination of the invention, comprising the administration of at least a humanized anti-VEGFC antibody or a functional fragment thereof according to the invention; or a combination of said humanized anti-VEGFC antibody with at least an anti-angiogenic compound and optionally another compound selected from anti-tumor compound and anti-inflammatory compound, for simultaneous, separate or sequential administration.
  • the invention also relates to a method comprising:
  • G determining a bad outcome of a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma in a subject, in particular according to the method of the invention; li’”) treating a subject who is undergoing a bad outcome of a disease related to disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, with a pharmaceutical composition or combination of the invention, comprising the administration of at least a humanized anti-VEGFC antibody or a functional fragment thereof according to the invention; or a combination of said humanized anti-VEGFC antibody with at least an anti-angiogenic compound and optionally another compound selected from anti-tumor compound and anti-inflammatory compound, for simultaneous, separate or sequential administration.
  • said method comprises:
  • G determining a bad outcome of a disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma in a subject, comprising the determination of the expression and/or the level of expression of at least one human proteolytically cleaved form of VEGFC in a biological sample of said subject; and li’”) treating a subject who is undergoing a bad outcome of a disease related to disease related to undesirable lymphatic cell proliferation and/or migration, more particularly of clear cell renal cell carcinoma, with a pharmaceutical composition or combination of the invention, comprising the administration of at least a humanized antibody or a functional fragment thereof according to the invention; or a combination of said humanized antibody with at least an anti-angiogenic compound and optionally another compound selected from anti-tumor compound and anti-inflammatory compound, for simultaneous, separate or sequential administration.
  • a pharmaceutical composition or combination of the invention comprising the administration of at least a humanized antibody or a functional fragment thereof according to the invention; or a combination of said humanized antibody with at least an anti-ang
  • Figure 2 Flow chart of the selection of anti-VEGFC hybridomas.
  • Figure 4 Effect of antibodies 1 E9 on the phosphorylation of VEGFR3 and VEGFR2 in endothelial cells: ELISA assay forVEGFR3 (a) or immunobloting for VEGFR2 activation (b).
  • Figure 5 Effect of antibodies 1E9 on the viability of vascular endothelial cells HuVEC ( Figure 5a) and on the migration of lymphatic endothelial cells (LEC) ( Figure 5b).
  • Figure 6 Effect of antibodies 1 E9 on the proliferation of kidney and breast tumor cells expressing VEGFC and its receptor/co-receptor through NRP2 signaling: effect on proliferation of kidney and breast tumor cells - Figure 6a, and proliferation curves of 786-0 and 786-0_K0_NRP2- Figure 6b.
  • Figure 7 The nucleotide and the protein sequences of the variable regions of the light and heavy chains of the chimeric antibodies: nucleic sequence of the variable region heavy chain of the 1 E9 antibodies (SEQ ID NO: 2); nucleic sequence of the variable region light chain of the 1E9 antibodies (SEQ ID NO: 3); amino acid sequence of the heavy chain variable region (VH) of the 1E9 antibodies (SEQ ID NO: 4) and amino acid sequence of the light chain variable region (VL) of the 1 E9 antibodies (SEQ ID NO:5).
  • Figure 8 Effect of antibodies 1 E9 alone or in combination with Bevacizumab (BVZ) on experimental RCC: effect on the growth ( Figure 8a) and on the tumor weight ( Figure 8b).
  • Figure 9 Effect of bevacizumab on the expression of VEGFC on 786-0 and A498 cells.
  • Figure 10 Purification profile of the 10 antibodies. Non-reduced SDS-PAGE with Coomassie blue staining. IN. Input sample. FT. Flow through. W. Wash step. E. Eluted fractions. MW. Molecular weight marker (kDa).
  • FIG 11 Anti-VEGFC antibodies inhibit the metabolism of breast and kidney cancer cells.
  • A breast (MDA-MB231) and
  • B Kidney (786-0) cancer cells’ metabolism was assessed by XTT assays after 48 h of incubation with 10 pg/mL of purified antibodies in DM EM medium containing 1% fetal bovine serum. The results are presented as the means ⁇ SEM * p ⁇ 0.05, ** p ⁇ 0.01 , ***p ⁇ 0.001 , **** pO.0001.
  • Figure 12 consensus of heavy sequence of the humanized antibodies of 1E9.
  • CHO expressing the VH and VL chains are cultivated in F12 medium with 5% low IgG serum. Cells were cultivated until they reached confluency. Then medium was replaced by a production medium containing 1.25% low IgG serum. The conditioned medium is recovered 20 days after for antibody purification. Cell supernatant is loaded on a HiTrapiM Protein G HP- column (flow 0.2 to 1 ml/minute for a 5 ml column). Fixed antibodies were desorbed in the elution buffer (1 M Tris-HCI pH 2.7) and immediately neutralized in neutralizing buffer (1 M Tris pH 9), 100 mI per ml of fraction).
  • the immunogen comprising the sequence coding for the mature peptide (SEQ ID NO:1) of the VEGFC that specifically stimulates VEGFR3, was subcloned in the pGEX6P3 vector.
  • the Figure 1 presents the sequence of VEGF-C with the mature peptide in bold characters.
  • This plasmid was transformed in BL21 bacteria for the production of a GST-VEGFC fusion protein.
  • mice were injected several times with the immunogen comprising the sequence coding for the mature peptide (SEQ ID NO:1) of the VEGFC.
  • Serum from each mouse was tested by ELISA against the VEGFC antigen harvested from the mice with the strongest immune response.
  • HuVECs Human umbilical vein endothelial cells
  • LECs Longer cells
  • 786- O, A498 and MDA-MB231 were purchased from the American Tissue Culture Collection (ATCC).
  • ATCC American Tissue Culture Collection
  • 786-0_#NRP2 knock-out (KO) cells were generated in the laboratory as previously described in Dumond, A (2021). Cells were cultured as indicated by ATCC and as already described in Signoretti, S et al. (2016) and Grepin, R et al. (2014).
  • the different antibodies were tested for their ability to inhibit the phosphorylation of VEGFR3 but not of VEGFR2 in endothelial cells (Figure 4), the viability of endothelial cells (HuVEC) expressing VEGFR2 ( Figure 5a), the migration of lymphatic endothelial cells (LECs) expressing VEGFR3 ( Figure 5b) and the proliferation of tumor cells ( Figure 6) considering that aggressive cancer cells, including RCC cells, express VEGFC and their receptors (VEGFR2/3) or their co-receptors the neuropilins especially neuropilin 2.
  • VEGFR2 and VEGFR3 can be stimulated by VEGFC.
  • HuVECs and LECs cells were starved for 2h and then treated for 20 min with VEGFC (100 ng/mL) in presence or not of 1E9 antibodies (10 pg/mL).
  • Cells were lysed in Laemmli buffer containing 2% SDS, 10% Glycerol, 60mM Tris-HCI, 1X HaltTM phosphatase inhibitor cocktail (Thermo Fischer). DNA was fragmented by sonification. Lysates supplemented with 0.002% bromophenol blue and 100mM DTT were heated to 96°C, separated by SDS-PAGE, and transferred to PVDF membranes (Millipore).
  • Membranes were probed with the following antibobies (pVEGFR2 (Tyr1175), CST, 2478S; VEGFR2, CST, 2479S and b-actin (D6A8) CST, 8457.
  • VEGFC following bevacizumab exposure was determined in vitro in 786- O and A498 cells by ELISA using R&D systems ELISA kit.
  • Cells were plated in 6-well plates and treated with bevacizumab (10 pg/mL) for 48h. Supernatants were collected and ELISA performed according to the manufacturer recommendations. Results are expressed as pg/mL/millions of cells.
  • the activation of VEGF receptor 3 (VEGFR3) was performed by ELISA using Human phospho-VEGFR3 DuoSet IC ELISA, R&D systems).
  • HuVECs and LECs cells were starved for 2h and then treated for 20 min with VEGFC (100 ng/mL) in presence or not of 1 E9 antibodies (10 pg/mL). Results are expressed as pg of phospho- VEGFR3/ pg of proteins
  • Human vascular endothelial cells (HUVEC) viability was assessed as already described using the ADAM technology (Giuliano et al. 2015). Cells were incubated during the indicated times in a medium specific for endothelial cells (Promocell) without growth factor (-ser), in the presence of 2% fetal bovine serum (-2%), in the presence of 50 ng/ml of the non- maturated form of VEGFC that can stimulate VEGFR2 and VEGFR3 (VC 50), in the presence of 10 mg/ml of 1E9 antibodies (1E9) and 50 ng/ml of VEGFC plus 10mg/ml of 1E9 antibodies (Vc 50 n 1 E9). **p ⁇ 0.01.
  • Human endothelial cells kept in low concentration of serum (0.1%) were stimulated or not with serum (2%) or VEGFC (50 ng/ml) in the presence or not of 1E9 antibodies.
  • 1 E9 antibodies decreased the basal and VEGFC-stimulated viability of HuVEC cells (p ⁇ 0.01).
  • a confluent LEC monolayer was scratched with a yellow tip.
  • the wound closure was assessed after 10 hours in absence of growth factors (CT), in the presence of 50 ng/ml of VEGFC (VEGFC), in control condition plus 5 pg/ml of 1 E9 (1 E9), and in the presence of 5 or 10 pg/ml 1 E9 plus 50 ng/ml of VEGFC (1 E9 5 or 10 VC). ** p ⁇ 0.01.
  • CT growth factors
  • 1E9 antibodies inhibit the migration of lymphatic endothelial cells. Therefore, 1E9 antibodies inhibited the VEGFC-dependent migration of lymphatic endothelial cells. Effect of antibodies 1E9 on the proliferation of kidney and breast tumor cells expressing VEGFC and its receptor/co-receptor.
  • ccRCC tumor cells aberrantly overexpress VEGF and VEGFC and their receptors (VEGFR1, VEGFR2) creating autocrine proliferation loops.
  • ccRCC cells do not exert these autocrine loops via VEGFR2 or VEGFR3 but depend on their respective co-receptors Neuropilin 1 and Neuropilin 2.
  • Triple negative breast cancer cells overexpress VEGF and VEGFC but do not express VEGFR. Their proliferation greatly depends on a VEGF/VEGFC/NRP1/NRP2 autocrine proliferation loops.
  • Considering the potent effects of the 1E9 antibodies on the VEGFC-dependent signaling we hypothesized that they should inhibit the proliferation of tumor cells presenting such autocrine loops. Therefore, we tested the 1E9 antibodies on ccRCC (A498 and 786-0, Neuropilin 1 and 2 positive) and breast (MDA-MB231, VEGFR2 and Neuropilin 1 positive) tumor cells.
  • Kidney (A498, 786-0) and breast (MDA-MB231) cancer cells proliferation was assessed by MTT assays after 48h of incubation with 10pg/ml of purified 1E9 antibodies in DM EM medium containing 2% fetal bovine serum.
  • the three independent cell lines express high amounts of VEGFC (around 1 ng/ml/10 6 cells).
  • Kidney cells only express the VEGFC co receptor neuropilin 2 and the MDA-MB231 only express the VEGFC receptor VEGFR3. *** p ⁇ 0.001.
  • variable region of the light and heavy chain of these antibodies were sequenced and cloned in the pFUSE2ss-CLIg-hk and pFUSEss-CHIg-hG1 vectors (In vivoGen San Diego, CA 92121 - USA) respectively.
  • the murine parts of the monoclonal antibodies were fused to the constant light and heavy chain of human lgG1 antibodies.
  • the vectors were transfected in CHO cells sequentially. CHO clones thank can grow in suspension and that produced the VEGFC antibodies were obtained. The yield of production is about 10mg of chimeric antibodies per liter of medium without serum. Equivalent results for anti-proliferation and anti-migration abilities were obtained with the murine monoclonal antibodies and the chimeric antibodies.
  • the nucleotide and the protein sequences of the variable regions of the light and heavy chains are the following ( Figure 7).
  • SEQ ID NO: 2 nucleic sequence of the variable region heavy chain
  • SEQ ID NO: 3 nucleic sequence of the variable region light chain
  • SEQ ID NO: 4 amino acid sequence of the variable region heavy chain
  • SEQ ID NO: 5 amino acid sequence of the variable region light chain
  • 3x10 6 786-0 RCC cells were subcutaneously injected in the flank of nude mice. Tumor growth was evaluated with a caliper as already described [5] 28 days after tumor cell injection, the average tumor size in each group was determined and used as the reference tumor size before treatments (100 %). Treatments started at 28 days for mice bearing tumors ranging between 70 and 100 mm 3 in size (5 mg/kg twice a week during the indicated times). Tumor size in mm 3 was then evaluated for the indicated time points and reported to the reference size at 28 days for each tumor (10 per group). The fold increase for each tumor was reported in the figure. High and low thresholds were indicated by black (plain dotted) lines respectively. Statistics are indicated; *, p ⁇ 0.05; ***, p ⁇ 0.001.
  • Figure 9 shows that the treatment of 786-0 and A498 cells in vitro with bevacizumab for 48 h significantly increased the expression of VEGFC. *, p ⁇ 0.05.
  • the anti-VEGFC antibodies of the invention inhibit the growth of experimental kidney tumors in nude mice. Whereas anti-VEGF antibodies have no effect or even favor experimental tumor growth in this model, the anti-VEGF plus anti-VEGFC combination have an additive effect on the inhibition of tumor growth. Therefore, these antibodies may constitute a new therapeutic strategy for metastatic kidney tumors.
  • tyrosine kinase inhibitors TKI or anti-VEGF reduced transiently the size of distant metastasis, they promote at the same time the development of an alternative vessel network participating in further metastatic dissemination. It was also observed that one common denominator of the response of tumor cells to several types of treatments was the induction of VEGFC; i) platinum salts for lung cancer cells, oral squamous cell carcinoma, melanoma, MOB ii) taxanes for breast or prostate cancers; iii) radiotherapy for oral squamous cell carcinoma (OSCC) (Lupu-Plesu et al. , 2017). Hence, a bundle of evidence links tumor resistance to a VEGFC-dependent lymphangiogenesis and further metastatic dissemination.
  • anti- VEGFC antibodies of the invention combined with the reference treatment of a specific tumor, may be proposed in the first line or at relapse.
  • bevacizumab was also approved for the treatment of breast cancers, but it lost its FDA approval for insufficient benefits.
  • MDA-MB231 overexpress VEGF and VEGFC.
  • combining anti-VEGF and anti-VEGFC appears relevant for the treatment of could triple negative breast cancer for which the VEGFC/VEGFR3/NRP2 signaling is detrimental.
  • Example 4 In silico humanization from 1E9 murine antibody
  • the humanization procedure was performed as outlined below:
  • optimal Acceptor human germline sequences were selected for each chain: based on the Parental antibody sequence alignment to the human germlines, the closest matching entries were identified. The identification of the optimal human germlines as Acceptor was based on the ordered criteria listed below:
  • human germline IGKV2-30*02 and human germline IGKV2- 18*01 were selected.
  • human germline IGHV1-46*01 human germline IGHV1-2*06
  • human germline IGHV4-34*08 human germline IGHV4-34*09.
  • IGHV1-46*01 and IGHV1- 2*06, IGHV4-34*08 and IGHV’4-34*09 were used for the design of humanized versions.
  • IGHV4-34*08 and IGHV’4-34*09 were used for the design of humanized versions.
  • IGKV2-30*02 and IGKV2-18*01 were used for the design of humanized versions.
  • Combinations of the different humanized VH and VL versions are produced, purified and tested for binding and biological activity.
  • the selection of the best humanized heavy and light chain combination between the different versions is performed by assessing the following criteria: a) The level of transient expression of the humanized versions produced in mammalian cells (HEK 293 or preferably CHO) as human lgG1/Kappa (as compared to the chimeric version). Using tissue culture supernatant from transfected cells before harvest for purification using ELISA or measurement by protein A using Octet label-free detection systems. b) The binding capacity (EC50 by ELISA or FACS; or preferably Kd by Biacore or Octet) as compared to the chimeric human lgG1/Kappa version (chimeric meaning the combination of the parental murine VH and VL fused to human constant regions).
  • Example 5 Preparation of the 1E9 murine chimeric antibody (named antibody 1) and 9 “humanized” variants (named antibodies 2 to 10) of the 1E9 and evaluation of their efficiency
  • Plasmids were then transiently co-transfected in Xten CHO cells (30ml_-culture in animal product-free medium). Culture medium was collected when viability dropped ⁇ 50% (14 days post transfection), and recombinant antibodies were then purified on a Protein A/G resin using a standard method: i) Equilibration binding and wash with PBS ph7.5; ii) Elution with 20mM citric acid pH2.7; iii) Neutralization with 1M Tris HCI pH 9; iv) Pool of fraction of interest and buffer exchange with PBS pH 7.5 plus sterilization on 0.22 mm filtration; vi) Final sample QC qualitative SDS PAGE and quantification by Bradford. The results are presented in Figure 10.
  • kidney (786-0) and breast (MDA-MB231) cancer cells has been evaluated by MTT assays after 48h of incubation with 10pg/ml of the different purified antibodies in DM EM medium containing 1% fetal bovine serum.
  • the two independent cell lines express important amounts of VEGFC (superior or equal to 1 ng/ml/10 6 cells).
  • Alitalo K Tammela T, Petrova TV. Lymphangiogenesis in development and human disease. Nature 2005; 438 : 946-53. Alitalo A, Detmar M. Interaction of tumor cells and lymphatic vessels in cancer progression. Oncogene 2012; 31 : 4499-508.
  • IMGT/3Dstructure-DB and IMGT/DomainGapAlign a database and a tool for immunoglobulins or antibodies, T cell receptors, MHC, IgSF and MhcSF. Nucleic Acids Res 2010; 38 : D301-7.
  • IMGT/GENE-DB a comprehensive database for human and mouse immunoglobulin and T cell receptor genes. Nucleic Acids Res 2005; 33 : D256-61.
  • VEGFC vascular endothelial growth factor
  • IMGT the international ImMunoGeneTics information system for Immunoinformatics. Methods for querying IMGT databases, tools, and Web resources in the context of immunoinformatics. Methods Mol Biol 2007; 409 : 19-42.
  • Vargas-Madrazo E Paz-Garcia E. (2003).
  • Wang CA, Jedlicka P, Patrick AN, et al. SIX1 induces lymphangiogenesis and metastasis via upregulation of VEGFC in mouse models of breast cancer. J Clin Invest 2012; 122 : 1895-906.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Public Health (AREA)
  • Oncology (AREA)
  • Immunology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Peptides Or Proteins (AREA)

Abstract

L'invention concerne un anticorps monoclonal humanisé anti-facteur C de croissance endothélial vasculaire (VEGFC) ou un fragment fonctionnel de celui-ci, comprenant (i) les trois CDR de chaîne lourde des séquences SEQ ID NO : 6, SEQ ID NO : 7 et SEQ ID NO : 8 sous la nomenclature Kabat, (ii) les trois CDR de chaîne légère des séquences SEQ ID NO : 9, SEQ ID NO : 10 et SEQ ID NO : 11 sous une nomenclature Kabat, (iii) un domaine variable de chaîne lourde de séquence choisi dans le groupe constitué par SEQ ID NO : 15 ou toute séquence présentant au moins 80 %, 85 %, 90 %, 95 % ou 98 % d'identité avec SEQ ID NO : 13 et SEQ ID NO : 101 ou toute séquence présentant au moins 80 %, 85 %, 90 %, 95 % ou 98 % d'identité avec SEQ ID NO : 99, à condition que la séquence SEQ ID NO : 4 est exclue et (iv) un domaine variable de chaîne légère de séquence SEQ ID NO : 130 ou toute séquence présentant au moins 80 %, 85 %, 90 %, 95 % ou 98 % d'identité avec SEQ ID NO 128, à condition que SEQ ID NO : 5 soit exclue.
PCT/EP2022/062731 2021-05-11 2022-05-11 Nouveaux anticorps anti-vegfc humanisés et leurs utilisations WO2022238459A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP21305606 2021-05-11
EP21305606.2 2021-05-11

Publications (1)

Publication Number Publication Date
WO2022238459A1 true WO2022238459A1 (fr) 2022-11-17

Family

ID=76217769

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2022/062731 WO2022238459A1 (fr) 2021-05-11 2022-05-11 Nouveaux anticorps anti-vegfc humanisés et leurs utilisations

Country Status (1)

Country Link
WO (1) WO2022238459A1 (fr)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110206620A1 (en) * 2010-02-25 2011-08-25 Schepens Eye Research Institute Therapeutic Compositions for the Treatment of Dry Eye Disease
US20120207671A1 (en) * 2010-04-15 2012-08-16 Vegenics Pty Limited Combination treatment with vegf-c antagonists
US20150110787A1 (en) * 2013-10-18 2015-04-23 Samsung Electronics Co., Ltd. Polypeptide specifically binding to vegf-c and use thereof
PL415392A1 (pl) * 2015-12-28 2017-07-03 Uniwersytet Jagielloński Sekwencja białkowa, zwłaszcza fragment przeciwciała, stanowiący inhibitor VEGF-C oraz jej zastosowanie
WO2021186024A1 (fr) * 2020-03-20 2021-09-23 Centre National De La Recherche Scientifique (Cnrs) Nouveaux anticorps anti-vegfc et leurs utilisations

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110206620A1 (en) * 2010-02-25 2011-08-25 Schepens Eye Research Institute Therapeutic Compositions for the Treatment of Dry Eye Disease
US20120207671A1 (en) * 2010-04-15 2012-08-16 Vegenics Pty Limited Combination treatment with vegf-c antagonists
US20150110787A1 (en) * 2013-10-18 2015-04-23 Samsung Electronics Co., Ltd. Polypeptide specifically binding to vegf-c and use thereof
PL415392A1 (pl) * 2015-12-28 2017-07-03 Uniwersytet Jagielloński Sekwencja białkowa, zwłaszcza fragment przeciwciała, stanowiący inhibitor VEGF-C oraz jej zastosowanie
WO2021186024A1 (fr) * 2020-03-20 2021-09-23 Centre National De La Recherche Scientifique (Cnrs) Nouveaux anticorps anti-vegfc et leurs utilisations

Non-Patent Citations (64)

* Cited by examiner, † Cited by third party
Title
" NEJM 2018: Nivolumab plus Ipilimumab versus Sunitinib in Advanced Renal-Cell Carcinoma", N ENGL J MED., vol. 378, no. 14, 5 April 2018 (2018-04-05), pages 1277 - 1290
AI-LAZIKANI B, LESK AM, CHOTHIA C.: "Standard conformations for the canonical structures of immunoglobulins.", J. MOL. BIOL., vol. 273, 1997, pages 927 - 948, XP004461383, DOI: 10.1006/jmbi.1997.1354
ALITALO A, DETMAR M.: " Interaction of tumor cells and lymphatic vessels in cancer progression.", ONCOGENE, vol. 31, 2012, pages 4499 - 508, XP037750181, DOI: 10.1038/onc.2011.602
ALITALO K, TAMMELA T, PETROVA TV: "Lymphangiogenesis in development and human disease", NATURE, vol. 438, 2005, pages 946 - 53
ALMAGRO JC, BEAVERS MP, HERMANDEZ-GUZMAN F., MAIER J, SHAULSKY J, BUTENHOF K, LABUTE P, THORSTEINSON N, KELLY K, TEPLYAKOV A, LUO : "Antibody modelling assessment.", PROTEINS, vol. 79, 2011, pages 3050 - 3066
AMBROSETTI ET AL., BJU, 2021
AMBROSETTI: " Cancer-associated fibroblasts in renal cell carcinoma: implication in prognosis and resistance to anti-angiogenic therapy.", BJU INT., vol. 129, no. 1, 8 August 2021 (2021-08-08), pages 80 - 92
BROCHET XLEFRANC MPGIUDICELLI V: "IMGT/V-QUEST: the highly customized and integrated system for IG and TR standardized V-J and V-D-J sequence analysis", NUCLEIC ACIDS, vol. 36, 2008, pages W503 - 8, XP055217485, DOI: 10.1093/nar/gkn316
BRUGGEMANN MWILLIAMS GTBINDON CICLARK MRWALKER MRJEFFERIS RWALDMANN HNEUBERGER MS, J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
CHOTHIA C, LESK AM, TRAMONTANO A: "Conformations of immunoglobulin hypervariable regions.", NATURE, vol. 342, 1989, pages 877 - 83, XP002030586, DOI: 10.1038/342877a0
CHOTHIA C, LESK AM: "Canonical structures for the hypervariable regions of immunoglobulins.", J MOL BIOL, vol. 196, 1987, pages 901 - 17, XP024010426, DOI: 10.1016/0022-2836(87)90412-8
CHOTHIALESK, J MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
DESMET JSPRIET J.LASTERS I.: "Fast and accurate side-chain topology and energy refinement (FASTER) as a new method for protein structure optimisation", PROTEINS, vol. 48, 2002, pages 31 - 43
DUFIES M, GIULIANO S, AMBROSETTI D: "Sunitinib Stimulates Expression of VEGFC by Tumor Cells and Promotes Lymphangiogenesis in Clear Cell Renal Cell Carcinomas.", CANCER RES, vol. 77, 2017, pages 1212 - 26
DUMOND A ET AL., JECCR, 2021
DUMOND A ET AL.: "Anti-Vascular Endothelial Growth Factor C Antibodies Efficiently Inhibit the Growth of Experimental Clear Cell Renal Cell Carcinomas", CELLS, vol. 10, no. 5, 17 May 2021 (2021-05-17), pages 1222, XP055849155, DOI: 10.3390/cells10051222
DUMOND A, CELLS, 2021
DUROUX P, KAAS Q, BROCHET X: "IMGT-Kaleidoscope, the formal IMGT-ONTOLOGY paradigm", BIOCHIMIE, vol. 90, 2008, pages 570 - 83, XP022576199
EHRENMANN FKAAS QLEFRANC MP: "IMGT/3Dstructure-DB and IMGT/DomainGapAlign: a database and a tool for immunoglobulins or antibodies, T cell receptors, MHC, IgSF and MhcSF", NUCLEIC ACIDS RES, vol. 38, 2010, pages D301 - 7, XP055247165, DOI: 10.1093/nar/gkp946
ESCUDIER B, BELLMUNT J, NEGRIER S: "Phase III trial of bevacizumab plus interferon alfa-2a in patients with metastatic renal cell carcinoma (AVOREN): final analysis of overall survival", J CLIN ONCOL, vol. 28, 2010, pages 2144 - 50
EWERT S, HUBER T, HONEGGER A., PLUCKTHUN A.: " Biophysical properties of human antibody variable domains.", J. MOL. BIOL., vol. 325, 2003, pages 531 - 553, XP027180832, DOI: 10.1016/S0022-2836(02)01237-8
FOOTE J., WINTER G.: " Antibody framework residues affecting the conformation of the hypervariable loops", J. MOL. BIOL., vol. 224, 1992, pages 487 - 499, XP024011188, DOI: 10.1016/0022-2836(92)91010-M
GIUDICELLI V, LEFRANC MP.: "Ontology for immunogenetics: the IMGT-ONTOLOGY.", BIOINFORMATICS, vol. 15, 1999, pages 1047 - 54
GIUDICELLI VCHAUME DLEFRANC MP: "IMGT/GENE-DB: a comprehensive database for human and mouse immunoglobulin and T cell receptor genes", NUCLEIC ACIDS RES, vol. 33, 2005, pages D256 - 61, XP055408999, DOI: 10.1093/narigki010
GIULIANO SCORMERAIS YDUFIES M ET AL., RESISTANCE TO SUNITINIB IN RENAL CLEAR CELL CARCINOMA RESULTS FROM SEQUESTRATION IN LYSOSOMES AND INHIBITION OF THE AUTOPHAGIC FLUX, vol. 11, 2015, pages 1891 - 904
GIULIANO SPAGES G: "Mechanisms of resistance to anti-angiogenesis therapies", BIOCHIMIE, vol. 95, 2013, pages 1110 - 9, XP028593704, DOI: 10.1016/j.biochi.2013.03.002
GREPIN R, GUYOT M, JACQUIN M: " Acceleration of clear cell renal cell carcinoma growth in mice following bevacizumab/Avastin treatment: the role of CXCL cytokines.", ONCOGENE, vol. 31, 2012, pages 1683 - 94, XP055078253, DOI: 10.1038/onc.2011.360
GREPIN, R.; AMBROSETTI, D.; MARSAUD, A.; GASTAUD, L.; AMIEL, J.; PEDEUTOUR, F.; PAGES, G.: "The relevance of testing the efficacy of anti-angiogenesis treatments on cells derived from primary tumors: a new method for the personalized treatment of renal cell carcinoma.", PLOS ONE, vol. 9, 2014, pages e89449
HAMADA KOICHI ET AL: "VEGF-C signaling pathways through VEGFR-2 and VEGFR-3 in vasculoangiogenesis and hematopoiesis", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 96, no. 12, 1 December 2000 (2000-12-01), pages 3793 - 3800, XP086507705, ISSN: 0006-4971, [retrieved on 20201031], DOI: 10.1182/BLOOD.V96.12.3793 *
HONEGGER A. MALEBRANCHE AD, ROTHLISBERGER D., PLUCKTHUN A.: "The influence of the framework core residues on the biophysical properties of immunoglobulin heavy chain variable domains", PROTEIN ENG. DES SEL., vol. 22, 2009, pages 121 - 134, XP055000564, DOI: 10.1093/protein/gzn077
HUSE WDSASTRY LIVERSON SA ET AL.: "Generation of a large combinatorial library of the immunoglobulin repertoire in phage lambda", SCIENCE, vol. 246, 1989, pages 1275 - 81, XP000083689, DOI: 10.1126/science.2531466
JONES PT, DEAR PH, FOOTE J. NEUBERGER MS, WINTER G: "Replacing the complementarity-determining regions in a human antibody with those from a mouse.", NATURE, vol. 321, 1986, pages 522 - 525
JOUKOV V ET AL: "PROTEOLYTIC PROCESSING REGULATES RECEPTOR SPECIFICITY AND ACTIVITY OF VEGF-C", THE EMBO JOURNAL / EUROPEAN MOLECULAR BIOLOGY ORGANIZATION, IRL PRESS, OXFORD, vol. 16, no. 13, 2 June 1997 (1997-06-02), pages 3898 - 3911, XP002066363, ISSN: 0261-4189, DOI: 10.1093/EMBOJ/16.13.3898 *
JOUKOV V, PAJUSOLA K, KAIPAINEN A: "A novel vascular endothelial growth factor, VEGFC, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinases.", EMBO J, vol. 15, 1996, pages 290 - 98
KAAS Q, EHRENMANN F, LEFRANC MP: "IG, TR and IgSF, MHC and MhcSF: what do we learn from the IMGT Colliers de Perles?", BRIEF FUNCT GENOMIC PROTEOMIC, vol. 6, 2007, pages 253 - 64
KAAS QRUIZ MLEFRANC MP: "IMGT/3Dstructure-DB and IMGT/StructuralQuery, a database and a tool for immunoglobulin, T cell receptor and MHC structural data", NUCLEIC ACIDS, vol. 32, 2004, pages D208 - 10
KAAS, Q.LEFRANC, M.-P., CURRENT BIOINFORMATICS, vol. 2, 2007, pages 21 - 30
KAAS, Q.RUIZ, M.LEFRANC, M.-P.: "T cell receptor and MHC structural data", NUCL. ACIDS. RES., vol. 32, 2004, pages D208 - D210
KABAT ET AL., J. BIOL. CHEM., vol. 252, 1977, pages 6609 - 6616
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, PUBLIC HEALTH SERVICE
KABAT, ADV. PROT. CHEM., vol. 32, 1978, pages 1 - 75
KINASHI ET AL., INT J MOL SCI., 2018
KINASHI HITO YSUN TKATSUNO TTAKEI Y: "Roles of the TGF-WVEGF-C Pathway in Fibrosis-Related Lymphangiogenesis", INT J MOL SCI, vol. 19, no. 9, 23 August 2018 (2018-08-23), pages 2487
KOZBOR D, RODER JC.: "The production of monoclonal antibodies from human lymphocytes.", IMMUNOL TODAY, vol. 4, 1983, pages 72 - 9, XP023942945, DOI: 10.1016/0167-5699(83)90123-8
LEFRANC ET AL., DEV. COMP. IMMUNOL., vol. 27, no. 1, 2003, pages 55 - 77
LEFRANC M.-P., IMMUNOL. TODAY, vol. 18, 1997, pages 509
LEFRANC M.-P., THE IMMUNOLOGIST, vol. 7, 1999, pages 132 - 136
LEFRANC MP: "IMGT, the international ImMunoGeneTics information system for Immunoinformatics. Methods for querying IMGT databases, tools, and Web resources in the context of immunoinformatics.", METHODS MOL BIOL, vol. 409, 2007, pages 19 - 42
LUPU-PLESU M, CLAREN A, MARTIAL S: "Effects of proton versus photon irradiation on (lymph)angiogenic, inflammatory, proliferative and anti-tumor immune responses in head and neck squamous cell carcinoma.", ONCOGENESIS, vol. 6, 2017, pages e354
MARTIN AC, THORNTON JM.: "Structural families in loops of homologous proteins: automatic classification, modelling and application to antibodies", J. MOL. BIOL., vol. 263, 1996, pages 800 - 815
MOREA, METHODS, vol. 20, 2000, pages 267 - 279
MOTZER ET AL., NEJM, 2018
MOTZER: "Avelumab plus Axitinib versus Sunitinib for Advanced Renal-Cell Carcinoma", N ENGL J MED., vol. 380, no. 12, 21 March 2019 (2019-03-21), pages 1103 - 1115, XP055729412, DOI: 10.1056/NEJMoa1816047
NORTH B, LEHMANN A;, DUNBRACK RL JR.: "A new clustering of antibody CDR loop conformations", J. MOL. BIOL., vol. 234, 2011, pages 779 - 815
PAGNUZZI-BONCOMPAGNI, M.HERMINE, O.GARBAY, C. ET AL.: "Neuropilin 1 and Neuropilin 2 gene invalidation or pharmacological inhibition reveals their relevance for the treatment of metastatic renal cell carcinoma", J EXP CLIN CANCER RES, vol. 40, 2021, pages 33
QUEEN C, SCHNEIDER WP, SELICK HE, PAYNE PW, LANDOLFI NF, DUNCAN JF, AVDALOVIC NM, LEVITT M, JUNGHANS RP, WALDMANN TA.: "A humanized antibody that binds to the interleukin 2 receptor.", PROC. NATL. ACAD. SCI. USA., vol. 86, 1989, pages 10029 - 10033, XP000310534, DOI: 10.1073/pnas.86.24.10029
RINI ET AL., NEJM, 2019
RINI: "NEJM 2019: Pembrolizumab plus Axitinib versus Sunitinib for Advanced Renal- Cell Carcinoma", N ENGL J MED., vol. 380, no. 12, 21 March 2019 (2019-03-21), pages 1116 - 1127
RODER JCCOLE SPKOZBOR D: "The EBV-hybridoma technique", METHODS ENZYMOL, vol. 121, 1986, pages 140 - 67
RUIZ, M.LEFRANC, M.-P., IMMUNOGENETICS, vol. 53, 2002, pages 857 - 883
SIGNORETTI, S.FLAIFEL, A.CHEN, Y.B.REUTER, V.E: "Renal Cell Carcinoma in the Era of Precision Medicine: From Molecular Pathology to Tissue-Based Biomarkers", J CLIN ONCOL, 2018
VARGAS-MADRAZO E, PAZ-GARCIA E.: "An improved model of association for VH-VL immunoglobulin domains: asymmetries between VH and VL in the packing of some interface residues.", J. MOL. RECOGNIT., vol. 16, 2003, pages 113 - 120, XP002592198, DOI: 10.1002/JMR.613
WANG CAJEDLICKA PPATRICK AN ET AL.: "SIX1 induces lymphangiogenesis and metastasis via upregulation of VEGFC in mouse models of breast cancer", J CLIN INVEST, vol. 122, 2012, pages 1895 - 906

Similar Documents

Publication Publication Date Title
CN111630068B (zh) 抗cd47抗体及其用途
JP6513728B2 (ja) Ｈｅｒ３に特異的な結合分子及びそれらの使用
EP2997042B1 (fr) Anticorps anti-cxcl1, cxcl7 et cxcl8 et leurs applications
TWI673287B (zh) 抗b7-h3抗體、其抗原結合片段及其醫藥用途
JP7520848B2 (ja) 癌および他の疾患の治療のための、クローディン１８．２に特異的な結合分子、その組成物および方法
WO2019042285A1 (fr) Anticorps anti-cd47 et son utilisation
JP2020515247A (ja) 抗ｏｘ４０抗体およびその使用
KR20200139725A (ko) Her3 항원 결합 분자
US11820831B2 (en) Antibody binding to carbonic anhydrase and use thereof
CN112243443B (zh) 抗trop-2抗体、其抗原结合片段及其医药用途
WO2021254481A1 (fr) Anticorps anti-claudine 18.2 et son utilisation
CN113227148B (zh) 抗gpc3抗体、其抗原结合片段及其医药用途
KR102633644B1 (ko) 항-인간 gpvi 항체를 이용한 혈소판 응집의 억제
CN115298216A (zh) 抗体或其抗原结合片段、其制备方法及医药用途
US20230192833A1 (en) New anti-VEGFC antibodies and uses thereof
WO2023031435A9 (fr) Traitement et prévention du cancer à l'aide de molécules de liaison à l'antigène her3
WO2022238459A1 (fr) Nouveaux anticorps anti-vegfc humanisés et leurs utilisations
JP2022534966A (ja) Ａｃｔｒｉｉ結合性タンパク質及びその使用
JP2022534514A (ja) Ａｌｋ７結合タンパク質及びその使用
JP2024159749A (ja) 癌および他の疾患の治療のための、クローディン１８．２に特異的な結合分子、その組成物および方法
AU2022220089A1 (en) Anti-pd-l1 antibody and use thereof
JP2024506664A (ja) 抗ｖｅｇｆ抗体およびその使用

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22728574

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22728574

Country of ref document: EP

Kind code of ref document: A1