WO2022235044A1 - Her2 백신 조성물 - Google Patents

Her2 백신 조성물 Download PDF

Info

Publication number
WO2022235044A1
WO2022235044A1 PCT/KR2022/006314 KR2022006314W WO2022235044A1 WO 2022235044 A1 WO2022235044 A1 WO 2022235044A1 KR 2022006314 W KR2022006314 W KR 2022006314W WO 2022235044 A1 WO2022235044 A1 WO 2022235044A1
Authority
WO
WIPO (PCT)
Prior art keywords
her2
vaccine composition
vaccine
icd
breast cancer
Prior art date
Application number
PCT/KR2022/006314
Other languages
English (en)
French (fr)
Inventor
엘 디시스마리
Original Assignee
주식회사 애스톤사이언스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 애스톤사이언스 filed Critical 주식회사 애스톤사이언스
Publication of WO2022235044A1 publication Critical patent/WO2022235044A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents

Definitions

  • the present invention relates to a HER2 vaccine composition.
  • DFC Disease Free Survival
  • ER-targeted therapeutics such as tamoxifen, which inhibit the activation of estrogen receptors
  • HER2-positive patients various targeted therapies such as using a HER2-targeting antibody such as Trastuzumab are used to treat breast cancer or to slow the progression of breast cancer.
  • Cancer vaccines are designed to activate cytotoxic T cells, causing the activated T cells to recognize and act against certain types of cancer cells, or to induce the production of antibodies that bind antigens present on the surface of cancer cells.
  • prostate cancer vaccine sipuleucel-T Provenge®
  • antigens are specifically expressed in certain types of tumor cells, each individual expresses antigens at a low level, or in the case of metastatic tumors, the antigen profile may change between the initially occurring tumor and metastatic tumor.
  • the immune evasion mechanism of tumor cells is also explained as the cause of some low success rates.
  • HER2/neu (hereinafter referred to as 'HER2') is a family of epidermal growth factor receptor (EGFR2), and overexpression of EGFR is observed in many carcinomas. In particular, HER2 overexpression is observed in 15-30% of all breast cancer patients, and HER2 expression is known to be associated with recurrence and poor prognosis in breast cancer patients.
  • HER2 is a transmembrane protein having the amino acid sequence of SEQ ID NO: 1, an intracellular domain (ICD, HER2 aa 676-1255) having protein tyrosine kinase activity, a transmembrane domain: TM, HER2 aa 653-675 ) and an extracellular domain (ECM, HER2 aa 22-652).
  • HER2 in breast cancer has been studied quite extensively, and several immunogenic peptides have been discovered.
  • immunotherapy is attempted, such as re-injection after loading into dendritic cells.
  • no clinically significant therapeutic or protective effects were reported in women with advanced breast cancer.
  • the recent large-scale Phase 3 clinical trial was discontinued because there was no difference in disease-free survival (DFS) compared to the placebo group.
  • DFS disease-free survival
  • Examples of another HER2 peptide vaccine include HER2-ICD peptide vaccine AE37 (LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790)), HER2-TM peptide vaccine GP2 (HER2 aa 654-662), and the like.
  • HER2-ICD peptide vaccine AE37 LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790
  • HER2-TM peptide vaccine GP2 HER2 aa 654-662
  • a DNA vaccine composition comprising a plasmid comprising a nucleic acid sequence encoding HER2-ICD can stably increase immunogenicity against HER2-ICD without side effects in breast cancer patient groups.
  • the present invention was completed.
  • An object of the present invention is to provide a vaccine composition (hereinafter referred to as “HER2-ICD DNA vaccine composition”) comprising a plasmid comprising a nucleic acid sequence encoding HER2-ICD.
  • An object of the present invention is to provide a HER2-ICD DNA vaccine composition having a single dose of 10 ⁇ g to 10000 ⁇ g.
  • An object of the present invention is to provide a method of inhibiting breast cancer recurrence and/or progression by administering the vaccine composition to a subject.
  • the present invention provides a DNA vaccine composition comprising a plasmid comprising a nucleic acid sequence encoding HER2-ICD.
  • a single dose of the vaccine composition may be 10 ⁇ g to 10000 ⁇ g.
  • the vaccine composition can be used in a group of patients expressing HER2 protein.
  • the vaccine composition may additionally include an adjuvant.
  • the adjuvant may be GM-CSF.
  • the vaccine composition according to the present invention is a vaccine composition comprising a plasmid comprising a nucleic acid sequence encoding HER2-ICD, and by stably increasing immunogenicity against HER2-ICD and HER2-ECD in breast cancer patients without special side effects, breast cancer recurrence can be usefully used to suppress
  • FIG. 1 shows the results of immunogenicity analysis of HER2-ICD DNA vaccine and HER2-ICD peptide vaccine.
  • prevent refers to the success or signs of success in preventing breast cancer recurrence/relapse when a patient in clinical remission is examined by radiation or physical methods.
  • no recurrence refers to a state in which there is no recurrence of cancer in breast cancer or other sites when a patient in clinical remission is examined by radiation or physical methods.
  • cancer to breast cancer or other sites after a period of improvement, remission, or remission by breast cancer treatment. means a sign or symptom of an outbreak.
  • protective immunity means that a subject initiates an immune response against a HER2-ICD antigen so that the subject's immune system can target and destroy cells expressing the same antigen, thereby causing cancer recurrence or It is meant to reduce cancer progression.
  • protective immunity is conferred by, but not limited to, T lymphocytes.
  • the amount of IFN- ⁇ produced by peripheral blood mononuclear cells (PBMC) of a subject stimulated by HER2-ICD is measured by the Elispot method (Enzyme- When measured by linked immuno-spot assay: ELISpot), it was considered that the HER2-ICD-specific T cell response was increased when the HER2-ICD-specific IFN- ⁇ production was more than doubled compared to the baseline.
  • booster refers to a dose of an immunogen administered to a patient to enhance, prolong or maintain protective immunity and to overcome down-regulation of T-cell responses mediated by regulatory T-cells.
  • pharmaceutically acceptable refers to a substance that is acceptable to a patient from a pharmacological/toxicological point of view with respect to composition, formulation, safety, etc.
  • pharmaceutically acceptable carrier refers to the biological activity of the active ingredient(s). It refers to a medium that does not interfere with the effect and is nontoxic to the subject upon administration.
  • patient refers to a living organism suffering from, treated, or susceptible to a condition for which the disease can be prevented or treated by administration of a vaccine composition of the present invention, such as breast cancer, includes both humans and animals.
  • Subjects include, but are not limited to, mammals (eg, mice, monkeys, horses, cattle, pigs, dogs, cats, etc.), preferably humans.
  • patient or “subject” in the present invention includes, without distinction, a breast cancer patient or a breast cancer patient expressing HER2.
  • administering refers to introducing a vaccine composition to a subject using any of a variety of methods and delivery systems known in the art.
  • routes of administration include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal, or other parenteral routes of administration, such as by injection or infusion.
  • administration refers to an intradermal mode of administration generally by injection, including intravenous, intramuscular, intraarterial, intrathecal, or intralymphatic injection and infusion, but It is not limited.
  • Other parenteral routes include topical, epithelial, or mucosal routes of administration, such as intranasal, vaginal, rectal, or sublingual routes.
  • the terms “vaccine injection”, “treatment” and “vaccination” to a subject are used without distinction.
  • the term “immune anticancer agent” refers to a therapeutic agent that induces immune cells to selectively attack only cancer cells by stimulating the immune system by injecting artificial immune proteins into the body, unlike conventional anticancer agents that attack cancer itself. It is an anticancer drug with a mechanism to restore or strengthen the tumor recognition or destruction ability of the immune system in order to overcome the immunosuppression or immune evasion mechanism acquired by spores.
  • the immune anticancer agent includes, but is not limited to, an immune checkpoint inhibitor, an immune cell therapeutic agent, and an immunoviral therapeutic agent.
  • the term “immune checkpoint inhibitor” refers to an immune checkpoint protein involved in T cell suppression when some cancer cells avoid immunity while utilizing the immune checkpoint of T cells, which are immune cells in the body. It is a type of immunotherapy that blocks activation to activate T cells to attack cancer cells, including CTLA-4 inhibitors, PD-1 inhibitors, LAG-3 inhibitors, TIM-3 inhibitors, TIGIT inhibitors, and VISTA inhibitors. It is not limited thereto.
  • the immune checkpoint inhibitor is an antagonist, and may be an antagonist antibody or a small molecule compound.
  • compositions disclosed herein are prepared as DNA vaccines.
  • a DNA vaccine comprises a plasmid having a promoter, appropriate transcriptional and translational control elements and a nucleic acid sequence encoding one or more polypeptides of the present invention.
  • the plasmid may additionally contain enhancement sequences, eg, sequences that enhance expression levels, intracellular targeting, and the like.
  • the antigen of the vaccine composition of the present invention is an intracellular domain (ICD) of aa 676-1255 of the HER2 gene (HER2-ICD).
  • the polypeptide sequence of HER2-ICD has 100% homology to the amino acid sequence of SEQ ID NO: 2, or, otherwise, 99% or more, 95% or more, 90% or more, 85% or more, or 80% or more homology can have However, in the case of homology limited to the above specific value, immunogenicity against HER2-ICD due to vaccination has the same or equivalent effect as a sequence having 100% homology.
  • the DNA vaccine comprises a plasmid vector comprising a nucleic acid sequence encoding the HER2-ICD of the present invention.
  • the plasmid is a pUMVC3 (conventional name is 'pNGVL3', so the two names may be used interchangeably) plasmid.
  • the nucleic acid sequence encoding the HER2-ICD has 100% homology to the nucleic acid sequence of SEQ ID NO: 3 or, otherwise, 99% or more, 95% or more, 90% or more, 85% or more, 80% or more homology can have However, in the case of homology limited to the above specific value, immunogenicity against HER2-ICD due to vaccination has the same or equivalent effect as a sequence having 100% homology.
  • the DNA vaccine may additionally encode immunomodulatory molecules that modulate the resulting immune response, such as enhancing the efficacy of the vaccine, stimulating the immune system or reducing immunosuppression. have.
  • the patient group to which the HER2-ICD DNA vaccine composition is administered is a group of patients with stage 3 or 4 breast cancer, and is a group of patients expressing HER2.
  • Each patient was in complete remission after completing standard breast cancer treatment, or only stable bone only diseas (SBO) was allowed in the stage 4 breast cancer patient group.
  • the present invention can be administered on any schedule suitable for inducing and/or maintaining a cytotoxic T cell response to HER2-ICD.
  • the vaccine composition of the invention may be administered to a patient.
  • a vaccine composition as described and exemplified herein as a primary vaccination may be administered to a patient on a schedule, followed by administration of a booster to induce and/or maintain protective immunity.
  • the vaccine composition may be administered to the patient once, twice or more times per month.
  • the booster may be administered singly or multiple times at regular intervals, for example, at intervals of 1 month, and may be administered singly or multiple times with a period of 6 months or more.
  • the HER2-ICD vaccine was administered three times once a month as the primary inoculation, but an additional booster may be administered after 6 months or 1 year.
  • the booster may have the same dose and composition as the vaccine composition used for the primary inoculation, or the dose and/or composition may be changed.
  • dose refers to the total amount of the active ingredient (HER2-ICD plasmid DNA) of the vaccine composition administered once to a subject.
  • the dose of the HER2-ICD DNA vaccine composition was selected and administered to three arms of 10 ⁇ g, 100 ⁇ g, and 500 ⁇ g per arm (22 patients group). In each arm, immunogenicity against HER2-ICD was observed to increase with vaccine administration, and all vaccine-related adverse events occurring in each arm were Grade 1 and 2 (extremely low grade), and Grade 3-5 serious adverse events. was not found There was no statistically significant difference between each arm regarding side effects.
  • the DNA vaccine composition of the present invention is a vaccine using HER2-ICD as an antigen, and is different from the sequence of HER2-ECD or peptide, but it is not effective against HER2-ECD in the patient group administered with the vaccine composition of the present invention, especially in the Arm 2 and Arm 3 patient groups. Immune reactivity was also increased.
  • the immunoreactivity to HER2-ICD persists for a long time even after vaccine administration is finished, and the vaccine composition of the present invention has an excellent effect in preventing recurrence or metastasis of breast cancer in the patient group in remission with breast cancer treatment.
  • the total amount of HER2-ICD plasmid DNA contained in the vaccine administered once is 10 ⁇ g to 1000 ⁇ g, 20 ⁇ g to 1000 ⁇ g, 30 ⁇ g to 1000 ⁇ g, 40 ⁇ g to 1000 ⁇ g, 50 ⁇ g to 1000 ⁇ g, 60 ⁇ g to 1000 ⁇ g, 70 ⁇ g to 1000 ⁇ g, 10 ⁇ g to 900 ⁇ g, 20 ⁇ g to 900 ⁇ g, 30 ⁇ g to 900 ⁇ g, 40 ⁇ g to 900 ⁇ g, 50 ⁇ g to 900 ⁇ g, 60 ⁇ g to 900 ⁇ g, 70 ⁇ g to 900 ⁇ g, 10 ⁇ g to 800 ⁇ g, 20 ⁇ g to 800 ⁇ g, 30 ⁇ g to 800 ⁇ g, 40 ⁇ g to 800 ⁇ g, 50 ⁇ g to 800 ⁇ g, 60 ⁇ g to 800 ⁇ g , 70 ⁇ g to 800 ⁇ g, 10 ⁇ g to 700 ⁇ g, 20 ⁇ g to
  • the desired immune response may not occur. Rather, it may decrease.
  • the vaccine composition described in the specification of the present invention is a pharmaceutically acceptable excipient, carrier, diluent, buffer, stabilizer, preservative, adjuvant ( adjuvant) or other substances well known in the art. These substances are non-toxic and do not interfere with the pharmaceutical activity of the active ingredient(s).
  • the pharmaceutical carrier or diluent may be, for example, an aqueous solution.
  • the carrier or other material that may be included in the vaccine composition of the present invention may be selected differently depending on the route of administration (eg, oral, intravenous, dermal or subcutaneous, nasal, intramuscular, intradermal and intraperitoneal administration).
  • the vaccine composition of the present invention may include one or more “pharmaceutically acceptable carriers”. These typically include proteins, saccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose, and trehalose. Such carriers are well known in the art.
  • the vaccine composition may also contain a diluent such as water, saline, glycerol, and the like.
  • auxiliary substances such as wetting or emulsifying agents, pH buffer substances and the like may be present.
  • Phosphate-buffered saline without sterile pyrogens and tromethamine (Tris) are typical carriers.
  • One aspect of the present invention relates to a vaccine composition or kit as described above comprising one or more plasmid DNAs as an active ingredient. They may be for use in a method of inducing an immune response in a subject, or providing treatment, vaccination or immunotherapy, and the vaccine composition may be a vaccine or immunotherapeutic composition. Such treatment or vaccination comprises administering to the subject a vaccine composition of the present invention.
  • the vaccine composition may be administered to a subject on a fixed schedule.
  • the vaccine composition of the present invention may be lyophilized or may be in aqueous form, for example an aqueous solution or suspension. Liquid formulations of this type are ideal for injection as they can be administered directly in packaged form without the need for the composition to be reconstituted in an aqueous medium.
  • the vaccine composition may be provided in vials or may be provided in a prefilled syringe. The syringe may be supplied with or without a needle. A syringe contains a single dose, whereas a vial may contain a single dose or multiple doses.
  • the vaccine composition of the present invention may be administered using a microneedle.
  • the vaccine composition of the present invention may be formulated as a delayed release vehicle or depot preparation.
  • Such long acting formulations may be administered by inoculation or implantation (eg subcutaneously or intramuscularly) or by injection.
  • a vaccine composition may be formulated with a suitable polymeric or hydrophobic material (e.g., an emulsion in an acceptable oil) or ion exchange resin, or as a sparingly soluble derivative (e.g., a sparingly soluble salt).
  • a suitable polymeric or hydrophobic material e.g., an emulsion in an acceptable oil
  • ion exchange resin e.g., a sparingly soluble derivative
  • Liposomes and emulsions are well-known examples of delivery vehicles suitable for use as carriers.
  • the vaccine composition of the present invention may contain an antimicrobial agent when packaged in a multiple dose format.
  • the antibacterial agent may be selected from 2-phenoxyethanol or parabens (methyl, ethyl, propyl paraben).
  • Optional preservatives are preferably present at low levels.
  • a preservative may be added exogenously and/or may be a component of the bulk antigen that is mixed to form the composition.
  • the vaccine composition of the present invention may be provided in the form of a kit including instructions and the like.
  • the vaccine composition of the present invention may contain one or more adjuvants to increase the immunogenicity of the composition.
  • Such suitable adjuvants include aluminum salts such as aluminum hydroxide or aluminum phosphate, but may be salts of calcium, iron or zinc or may be insoluble suspensions of acylated tyrosine or acylated sugars, or may be cationic or anionic It may be selected from derivatized saccharides and the like, but is not limited thereto.
  • the adjuvant may contain cytokines used as immunomodulatory agents.
  • Cytokines suitable for use as the immunomodulatory agent include interleukins (eg, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.); Although it can be selected from macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), granulocyte macrophage colony stimulating factor (GM-CSF), etc. , but not limited thereto.
  • interleukins eg, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.
  • M-CSF macrophage colony stimulating factor
  • TNF tumor necrosis factor
  • GM-CSF granulocyte macrophage colony stimulating factor
  • GM-CSF may be included as an adjuvant.
  • the adjuvant may be added in an amount of 0.075 mg to 0.2 mg, or 0.08 mg to 0.12 mg per dose.
  • the vaccine composition of the present invention may be administered in combination with one or more anticancer agents selected from chemical anticancer agents, targeted anticancer agents, and immune anticancer agents.
  • One or more anticancer agents selected from chemical anticancer agents, targeted anticancer agents, and immune anticancer agents that can be administered in combination with the vaccine composition of the present invention may be administered simultaneously or sequentially with a time difference, and may be selected according to an appropriate time and cycle. .
  • the chemical anticancer agent is also called a cytotoxic anticancer agent or a chemical anticancer agent.
  • the chemical anticancer agent for example, gemcitabine (Gemcitabine) (jecitabine), cytarabine (Cytarabine), carboplatin (Carboplatin) (paraplatin), cisplatin (Cisplatin) (platinol, platinum-AQ) ), Crizotinib (Zalkori), Cyclophosphamide (Cytoxane, Neosar), Docetaxel (Taxotere), Doxorubicin (Adriamycin), Etoposide ) (bepeside), fluorouracil (5-fluorouracil, 5-FU), irinotecan (camptosar), liposome-encapsulated doxorubicin (doxyl), methotrexate (polex, mexate, ametope) Terine), Paclitaxel (Taxol,
  • the target anticancer agent is trametinib, vemurafenib, alpelisib, dactolisib, gefitinib, erlotinib, lapatinib ( Lapatinib), Sunitinib, Sorafenib, Crizotinib, Dabrafenib, Trastuzumab, Cetuximab, Bevacizumab , Panitumumab, Ipilimumab, Pertuzumab, Tofacitinib, Imatinib, Bortezomib, Ofatumumab and Alemtuzumab ( Alemtuzumab) may be one or more targeted therapeutic agents selected from the group consisting of, but is not limited thereto.
  • the immunocancer agent is CTLA-4 (cytotoxic Tlymphocyte-associated protein 4), PD-1 (Programmed cell death protein 1), LAG3 (Lymphocyte Activation Gene-3), TIM-3 (T-cell Immunoglobulin and Mucin-domain containing-3), TIGIT (T-cell Immunoreptor with IG and ITIM domain), and VISTA (Vdomain Ig Suppressor of T cell Activation) to any one selected from the group consisting of an immune checkpoint inhibitor (immune checkpoint inhibitor)
  • an immune checkpoint inhibitor immunoreconstituted thereto.
  • the composition may further include an anticancer adjuvant, and more preferably, the anticancer adjuvant may be a STimulator of InterferoN Gene (STING) agonist, but is not limited thereto.
  • STING STimulator of InterferoN Gene
  • administration of the HER2-ICD DNA vaccine composition may be performed simultaneously with treatment with other cancer therapeutic agents.
  • the cancer treatment agents include anticancer agents such as fluorouracil, doxorubicin, and paclitaxel that are standardly used for breast cancer treatment, Trastuzumab, Herceptin®, an antibody treatment for HER2, and tamoxifen, an Estrogen receptor (ER) targeted treatment ) or bisphosphonates may be used, but are not limited thereto.
  • stage 3 or 4 breast cancer patients who met the following criteria.
  • stage IV patients (2) Cases that are found to overexpress HER2 gene or protein in the primary tumor or metastasis stage through immunohistochemistry (IHC) or fluorescence in situ hybridization (FISH).
  • ECOG performance score is 0 (ECOG Performance Score O).
  • WBC White Blood Cell
  • WBC Do not receive chemotherapy or other immunosuppressive drugs such as steroids for 30 days prior to clinical trial enrollment.
  • LVEF Left Ventricular Ejection Fraction
  • Standard of care including bisphosphonates, anti-estrogens and Trastuzumab therapy, was permitted during the vaccine administration period. All patients provided written informed consent in accordance with institutional and USA regulations. 66 patients were enrolled from May 2004 to August 2007 and 64 patients completed all three vaccinations. Two patients enrolled in Arm 1 discontinued the study due to disease progression after one dose of vaccine.
  • Toxicity was graded according to CTCAE v 3.0 and vaccine-related toxicity was defined as an Adverse Effect, regardless of severity, definitely, probably or possibly. Long-term adverse events were assessed through an annual medical record review of surviving patients.
  • PBMCs were evaluated at baseline and after the third vaccine administration (12 weeks) and 1, 3, 6 and 12 months after the last vaccination (after clinical enrollment, respectively) to evaluate the induced immune responses to HER2-ICD and HER2-ECD. 16, 24, 36, and 60 weeks).
  • PBMCs were assessed for the presence of plasmid DNA at baseline and 1 month after the last vaccine.
  • the HER2-ICD sequence (SEQ ID NO: 2) was inserted into pNGVL3 and confirmed by DNA sequencing.
  • the plasmid DNA vaccine, pNGVL3-HER2-ICD was amplified, quantified and prepared in vials under GMP conditions.
  • Single dose vials contained 10 ⁇ g, 100 ⁇ g or 500 ⁇ g plasmid DNA (pNGVL3-HER2-ICD) suspended in Tromethamine/EDTA as stabilization buffer (1.2 ml) and commonly 100 ⁇ g GM-CSF.
  • Vials were tested for microbial, sterility, and stability and stored between -25 o C and -10 o C at the University of Washington Investigational Drug Services Pharmacy according to US Pharmacopoeia standards.
  • PBMC samples from all patients were processed and cryopreserved using standardized methods that have been demonstrated to preserve lymphocyte function. All samples for each patient were thawed and analyzed simultaneously to reduce experimental variability. Specificity for HER2 through the IFN- ⁇ Elispot method stimulated by an antigen (stimulator) to be described later according to the previously known method of Disis et al. (J Clin Oncol. 2009 Oct 1; 27(28): 4685-92) negative response was measured. For the HER2-ICD or HER2-ECD antigen (stimulator), an overlapping 15 amino acid peptide pool (1 mg/mL) in which 11 amino acids overlap was used as an antigen.
  • a patient was considered to have an increased HER2-ICD-specific T cell response if the HER2-ICD-specific IFN- ⁇ production in PBMCs measured by the Elispot method after vaccination was increased by 2 times from baseline.
  • Arm 1 and Arm 3 each consisted of 22 patients, each containing 10 ⁇ g, 100 ⁇ g, and 500 ⁇ g of HER2-ICD plasmid DNA, and a vaccine composition containing 100 ⁇ g of GM-CSF in common. It was administered intradermally. The patient characteristics for each arm are listed in Table 1.
  • Estrogen Receptor PR Progesterone Receptor
  • the side effects caused by the administration of the vaccine composition of the present invention cannot be said to be of concern when administered to a subject at an extremely low grade, and no signs of autoimmune disease or the occurrence of diseases were observed.
  • the vaccine composition of the present invention was not observed to be inserted into the genome of the subject, it is judged that there is no problem in safety in clinical application.
  • Anti-ds DNA anti-double strand DNA antibody
  • Immune response enhancement effect against antigen in HER2-ICD peptide vaccine (aa 971-984: ELVSEFSRMARDP) targeting 38 patients with stage 3 or 4 breast cancer (NCT00343109) that had been studied before this project and the results of this study
  • the effect of enhancing the immune response to the antigen in the HER2-ICD DNA vaccine was compared.
  • Immune responses to each antigen were analyzed 1 month post final vaccine, 40 weeks after the last vaccine administration (Long-term follow up; LTFU), the antigen for each vaccine, that is, HER2-ICD
  • the antigen for each vaccine that is, HER2-ICD
  • HER2-ICD was used as an antigen
  • the ELVSEFSRMARDP polypeptide was used as an antigen, and the amount of IFN- ⁇ was measured by the Elispot method.
  • the immune response was still increased 1 month and 40 weeks after the last vaccine administration, but the HER2-ICD peptide vaccine showed a decreased immune response from 40 weeks after the last vaccine administration.
  • the ICD peptide vaccine seems to have inferior long-term immunity compared to the HER2-ICD DNA vaccine ( FIG. 1 ).
  • the proportion of patients with an immune response enhanced by the HER2-ICD DNA vaccine was highest in Arm 2 (73%) compared to Arm 1 (47%) and Arm 3 (45%). .
  • the immune response to HER2-ICD was increased in all patient groups.
  • the maximum observed immune response during the study period (defined as the individual's maximum immune response during the course of the study, but measured before the last immunological time point) was significantly higher in each arm compared to the pre-vaccination response (p ⁇ 0.05, p). ⁇ 0.005 and p ⁇ 0.01).
  • the immune response Long-term follow up: LTFU; 60 weeks after the last vaccination
  • the immune response after vaccination in Arm 2 maintained a maximum (see FIG. 2 ).
  • the HER2-ICD DNA vaccine of the present invention did not cause any significant side effects at the inoculation doses of 10 ⁇ g (Arm 1), 100 ⁇ g (Arm 2), and 500 ⁇ g (Arm 3). Although an immune response was shown, the increase rate of the immune response to HER2-ICD was lower than that of 100 ⁇ g (Arm 2) and 500 ⁇ g (Arm 3) when the dose of the vaccine composition was 10 ⁇ g (Arm 1), and the LTFU (1 years) showed a decreased immune response rate compared to 100 ⁇ g (Arm 2) and 500 ⁇ g (Arm 3) even at the maximum immune response.
  • SEQ ID NO: 1 (HER2 full length sequence)
  • SEQ ID NO: 2 (HER2-ICD aa sequence)

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명은 HER2-ICD DNA 백신 조성물에 관한 것으로, 본 발명에 따른 백신 조성물은 실제 유방암 환자에 투여하였을 때, 심각한 부작용이 없으며, 장기간 HER2-ICD에 대한 면역원성이 유지되므로, 화학요법 등으로 관해 상태의 유방암 환자의 재발 또는 전이를 효과적으로 예방할 수 있을 뿐 아니라, 유방암의 진행도 효과적으로 막을 수 있다.

Description

HER2 백신 조성물
본 출원은 2021년 05월 04일자 미국 특허 출원 제63/183,865호에 기초한 우선권의 이익을 주장하며, 해당 미국 특허 출원의 문헌에 개시된 모든 내용은 본 명세서의 일부로서 포함한다.
본 발명은 HER2 백신 조성물에 관한 것이다.
유방암은 여성에게서 가장 빈번하게 진단되는 암이며, 가장 흔한 암 사망의 원인일 뿐만 아니라, 발생률은 높아지고, 발병 연령대는 점차 낮아지는 경향을 보인다.
지난 20년 동안 유방암 치료에 있어서, 다양한 표적 치료 및 진단법 등으로 Disease Free Survival(DFC)를 다른 암종에 비해 상당히 개선하였다. 예를 들어, 외과적인 수술 및 파클리탁셀과 같은 화학요법 또는 방사선요법 등의 전통적인 암 치료법에 더해, 에스트로겐 수용체(Estrogen Receptor; ER) 양성 유방암 환자에는 에스트로겐 수용체의 활성화를 억제하는 타목시펜 등의 ER 표적 치료제를 사용하고, HER2 양성 환자에게는 트라스투주맙과 같은 HER2 표적 항체를 사용하는 등의 다양한 표적치료제를 이용하여 유방암을 치료하거나, 유방암 진행을 느리게 하고 있다.
하지만, 유방암 치료에 있어 치료방법의 진전에도 불구하고, 상당수의 환자는 전이 또는 재발에 의해 사망하는 경우가 많기 때문에, 유방암 재발을 낮추고 생존률(Overall Survival:OS) 또는 무질병생존률(Disease Free Survival:DFS)을 높이려는 시도가 있어왔다.
유방암 전이 또는 재발을 막기 위한 시도로서 유방암 줄기세포(breast cancer stem cell)에 대한 바이오마커를 발굴하여 이에 대한 표적치료를 하는 방법에 대한 연구와 동시에 유방암 특이 항원에 대한 백신을 이용하는 면역요법에 대해 연구되고 있다. 암 백신은 세포독성 T 세포를 활성화하여, 활성화된 T 세포가 특정 유형의 암 세포를 인지하여 이에 맞서 작용하게 하거나, 암 세포 표면에 존재하는 항원과 결합하는 항체의 생산을 유도하도록 디자인된다.
지난 수년간 암 치료 또는 재발을 막기 위해 백신 연구가 광범위하게 이루어졌지만, 전립선암 백신인 시플루셀-T(sipuleucel-T, Provenge®)를 제외하고는 성공적인 사례가 아직 존재하지 않는다. 이러한 낮은 성공률에 대해서는 특정 유형의 종양 세포에 항원이 특이적으로 발현되더라도, 각 개인에 따라서는 낮은 수준으로 항원을 발현하거나, 전이성 종양의 경우 최초 발생 종양과 전이성 종양 간에 항원 프로파일이 변화될 수 있고, 종양세포의 면역회피 기전도 일부 낮은 성공률의 원인으로 설명하고 있다.
바람직한 백신 항원은 종양세포에서 배타적으로 또는 적어도 증가된 수준으로 발현되어야 한다. HER2/neu(이하 ‘HER2’라 함)는 EGFR(epidermal growth factor receptor)의 패밀리(EGFR2)로 많은 암종에서 EGFR의 과발현이 관찰된다. 특히 전체 유방암 환자의 15~30%에서 HER2 과발현이 관찰되고, HER2 발현은 유방암 환자에서 재발 및 나쁜 예후와 관련되어 있다고 알려져 있다.
HER2는 서열번호 1의 아미노산 서열을 가지는 세포막 관통 단백질로 protein tyrosine kinase 활성을 지니는 세포 내 도메인(intracellular domain: ICD, HER2 aa 676-1255), 막 횡단 도메인(transmembrane domain: TM, HER2 aa 653-675) 및 세포 밖 도메인(extracellular domain: ECM, HER2 aa 22-652)으로 구성되어 있다.
유방암에서의 HER2는 상당히 광범위하게 연구되어 왔으며, 수 개의 면역원성 펩타이드가 발굴되어 있다. 예를 들자면, HER2 단백질의 아미노산 369-377의 펩타이드(nelipepimut-S [NeuVax; HER2 aa369-377; E75 (NP-S)])의 경우 수지상 세포에 로딩 후 재주입되거나 하는 등의 면역 치료를 시도하였으나, 진행된 상태의 유방암을 가지는 여성에서 임상적으로 유의한 치료 또는 보호 효과가 보고되지는 않았다. 게다가 최근 대규모 임상 3상에서 무질병생존률(Disease Free Survival:DFS)에 있어서 위약군과 차이가 없어 임상실험이 중단된 바 있다.
또다른 HER2 펩타이드 백신의 예로서 HER2-ICD 펩타이드 백신인 AE37(LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790)), HER2-TM 펩타이드 백신인 GP2(HER2 aa 654-662) 등이 존재하고, 이들 백신으로 인해 생존률이 증가한다는 효과가 일부 보고된 바 있다. 또한 HER2-ICD 단편(이하 ‘HER2-ICD’라 함)에 대한 백신이 HER2-ECD 단편(이하 ‘HER2-ECD’라 함)에 대한 백신에 비해 종양의 크기가 줄어든다는 것을 동물실험에서 보고된 바 있으나, HER2-ICD DNA 백신을 직접적으로 유방암 환자에 적용한 결과는 보고된 바 없다.
따라서, 유방암 환자에 있어서, 유방암 치료 또는 재발에 대해 신뢰할 수 있는 보호효과를 제공할 백신을 생성하기 위해 HER2-ICD DNA 백신의 면역 효과 및 치료 가능성을 개발할 필요성이 있다.
[선행기술문헌]
[특허문헌]
대한민국 등록특허 10-1572474호(공고일: 2015. 11. 30.)
미국 공개특허 US 2002/0193329(공개일: 2002. 12. 19.)
[비특허문헌]
Breast Care 2016; 11:116-121
Clin Cancer Res; 25(14) July 15, 2019
이에 본 발명자들은 상기 문제를 해결하고자 연구를 수행한 결과, HER2-ICD를 암호화하는 핵산 서열을 포함하는 플라스미드를 포함하는 DNA 백신 조성물이 유방암 환자군에서 부작용 없이 안정적으로 HER2-ICD에 대한 면역원성을 높일 수 있음을 확인하여 본 발명을 완성하였다.
본 발명은 HER2-ICD를 암호화하는 핵산서열을 포함하는 플라스미드를 포함하는 백신 조성물(이하 “HER2-ICD DNA 백신 조성물”이라 함)을 제공하는 것을 목적으로 한다.
본 발명은 1회 투여 용량이 10㎍ 내지 1,0000㎍인 HER2-ICD DNA 백신 조성물을 제공하는 것을 목적으로 한다.
본 발명은 상기 백신 조성물을 대상체에 투여하여 유방암 재발 및/또는 진행을 억제하는 방법을 제공하는 것을 목적으로 한다.
상기 목적을 달성하기 위해, 본 발명은 HER2-ICD를 암호화하는 핵산 서열을 포함하는 플라스미드를 포함하는 DNA 백신 조성물을 제공한다.
본 발명의 일 구현예에 따라, 상기 백신 조성물의 1회 투여량은 10㎍ 내지 1,0000㎍일 수 있다.
본 발명의 일 구현예에 따라, 상기 백신 조성물은 HER2 단백질을 발현하는 환자군에 사용할 수 있다.
본 발명의 일 구현예에 따라, 상기 백신 조성물은 추가적으로 애주번트를 포함할 수 있다.
본 발명의 일 구현예에 따라, 상기 애주번트는 GM-CSF일 수 있다.
본 발명에 따른 백신 조성물은 HER2-ICD를 암호화하는 핵산서열을 포함하는 플라스미드를 포함하는 백신 조성물로서, 유방암 환자에서 특별한 부작용 없이 안정적으로 HER2-ICD 및 HER2-ECD에 대한 면역원성을 증대시킴으로써 유방암 재발을 억제에 유용하게 사용될 수 있다.
도 1은 HER2-ICD DNA 백신 및 HER2-ICD 펩타이드 백신의 면역원성 분석 결과를 나타낸 것이다.
도 2는 HER2-ICD DNA 백신의 투여 용량별 환자군(Arm 1~3)에서의 HER2-ICD에 대한 면역원성 분석 결과를 나타낸 것이다.
이하, 본 발명을 더욱 상세히 설명한다.
본 명세서에서 사용된 바와 같은 단수 형태(“a”, “an” 및 “the”)는 문맥에서 달리 명확하게 지시되지 않는 한 복수의 대상을 포함한다.
본 개시내용의 특정의 특성을 기술하고 청구함에 있어서, 다음의 용어는 달리 지정되지 않는 한 이하에 기술된 정의에 따라 사용될 것이다.
본원에서 어떤 양태들이 “~를 포함하는”이란 용어와 함께 기술되더라도, “~로 구성된” 및/또는 “본질적으로 ~로 구성된”의 관점에서 기술된 다른 유사 양태들도 또한 제공된다는 것이 이해되어야 한다.
용어 “예방하다”는, 임상적 완화 상태의 환자를 방사선 또는 물리적 방법 등으로 검사했을 때, 유방암 재발(recurrence/relapse)을 막은 성공 또는 성공의 징후를 언급한다.
용어 “재발이 없는”은 임상적 완화 상태의 환자를 방사선 또는 물리적 방법 등으로 검사했을 때, 유방암 또는 다른 부위에 암 재발이 없는 상태를 의미한다.
따라서 용어 “재발(recurrence, relapse)”또는 “재출현(resurgence)”은 본 명세서에서 상호교환적으로 사용되며, 유방암 치료에 의한 개선, 완화 또는 관해(remission) 기간 후 유방암 또는 다른 부위로의 암 발생에 대한 징후 또는 증상을 의미한다.
용어 “유방암이 없는(free of breast cancer)”, “질환이 없는 (disease free)”, “완전관해(complete remission)” 또는 “질환의 증거가 없음(No Evidence of Disease; NED)”는 환자가 현재 표준 의료 요법에 의한 임상적 완화 상태에 있는 것을 의미한다. 이 경우 비록 암세포가 신체에 여전히 존재할 수 있지만, 유방암의 임상적 징후, 방사선학적 징후 및 증상이 임상 진단에 기초할 때 상당히 감소되거나 완전히 사라진 것을 의미한다. 따라서, 완화는 부분적 및 완전한 완화를 포함하는 것으로 의미한다.
본 명세서에서 상기 “보호 면역” 또는 “보호 면역반응”은 대상체가 HER2-ICD 항원에 대해 면역반응을 개시하여 대상체의 면역계가 동일 항원을 발현하는 세포를 표적화하고 파괴할 수 있어 대상체에서 암 재발 또는 암 진행을 감소시키는 것을 의미한다. 본 발명에서 보호 면역은 T 림프구에 의해 부여되지만, 이에 제한되지 않는다.
본 명세서에서는 백신 투여 전(베이스라인: baseline), 후, 대상체의 말초혈액단핵구(Perpheral Blood Mononuclear Cell: PBMC)가 HER2-ICD에 의해 자극받아 생산하는 IFN-γ의 양을 엘리스팟법(Enzyme-linked immuno-spot assay: ELISpot)에 의해 측정하였을 때, 베이스라인에 비해 HER2-ICD 특이적인 IFN-γ 생산이 2배 이상인 경우 HER2-ICD 특이적인 T 세포 반응이 증가한 것으로 간주하였다.
용어 “부스터”는 보호 면역을 증진, 연장 또는 유지하고 조절 T-세포에 의해 매개되는 T-세포 반응의 하향-조절을 극복하기 위해 환자에게 투여되는 일정 용량의 면역원을 언급한다.
용어 “약제학적으로 허용되는”은 조성, 제형, 안전성 등에 대해 약리학적/독성학적 관점으로부터 환자에게 허용되는 물질을 의미하고, “약제학적으로 허용되는 담체”는 활성 성분(들)의 생물학적 활성의 효과를 방해하지 않는 매질을 언급하며, 투여 시 대상체에 무독성이다.
용어 “약”은, 측정가능한 값, 예를 들어 중량, 지속 기간 등을 언급하는 경우, 구체화된 값으로부터 ±20%, ±10%, ±5%, ±1%, 또는 ±0.1%의 변화를 의미할 수 있지만, 이에 제한되지 않고 기술된 방법을 수행하기에 적합한 변화를 포함하는 것으로, 반응성에 영향을 주지 않는 범위를 의미한다.
용어 “환자” 또는 “대상체”란, 본 발명의 백신 조성물의 투여에 의해 질환이 예방 또는 치료될 수 있는 병태, 예컨대 유방암을 앓고 있거나, 치료되었거나, 그러한 병태에 걸리기 쉬운, 살아있는 유기체를 지칭하며, 인간과 동물을 둘 다 포함한다. 대상체로서는 포유동물(예컨대, 마우스, 원숭이, 말, 소, 돼지, 개, 고양이 등)을 포함하나, 이에 한정되는 것은 아니며, 바람직하게는 인간이다. 또한, 본 발명에서의 “환자” 또는 “대상체”는 구분하지 않고 유방암 환자, 또는 HER2를 발현하는 유방암 환자를 포함한다.
용어 “투여하는 것”이란, 이 발명이 속하는 기술분야에서 공지된 다양한 방법과 전달 시스템 중 임의의 것을 사용하여 백신 조성물을 대상체에 도입하는 것을 지칭한다. 예시적 투여 경로는 정맥내, 근육내, 피하, 복강내, 척수 또는 기타 다른 비경구 투여 경로, 예컨대 주사 또는 주입에 의한 투여 경로를 포함한다. 본 발명의 명세서에 사용된 “투여”란, 일반적으로 주사에 의한 피내(intradermal) 투여 방식을 의미하고, 정맥내, 근육내, 동맥내, 척수강내, 또는 림프내 주사 및 주입을 포함하나, 이에 한정되는 것은 아니다. 기타 다른 비경구 경로로서는 국소, 상피 또는 점막 투여 경로, 예컨대 비내, 질, 직장, 또는 설하 경로를 포함한다. 본 명세서에서는 대상체에 “백신 투여(vaccine injection)”, “처치(treatment)”와 “접종(vaccination)”은 구분되지 않고 사용된다.
본 발명에서, 용어 “면역 항암제”는 암 자체를 공격하는 기존 항암제와는 달리 인공면역 단백질을 체내에 주입하여 면역체계를 자극함으로써 면역세포가 선택적으로 암 세포만을 공격하도록 유도하는 치료약제로서, 암세 포가 획득한 면역억제 또는 면역회피 기전을 극복하기 위하여 면역체계의 종양 인지능력 또는 파괴능력을 회복 또는 강화시키는 기전의 항암제이다. 상기 면역 항암제는 면역관문 억제제, 면역세포 치료제 및 면역바이러스 치료제를 포함하지만 이에 제한되지는 않는다.
본 발명에서, 용어 “면역관문 억제제”는 일부 암세포가 체내 면역세포인 T 세포의 면역체크포인트를 활용하면서 면역을 회피하는 경우에, T 세포 억제에 관여하는 면역체크포인트 단백질(Immune Checkpoint Protein)의 활성화를 차단하여 T 세포를 활성화시켜 암세포를 공격하는 작용을 하는 면역 항암제의 일종으로서, CTLA-4 억제제, PD-1 억제제, LAG-3 억제제, TIM-3 억제제, TIGIT 억제제 및 VISTA 억제제를 포함하지만 이에 제한되지는 않는다. 또한, 상기 면역관문 억제제 는 길항제로서, 길항제 항체 또는 소분자 화합물일 수 있다.
본 명세서에 개시된 조성물은 DNA 백신으로 제조된다. 본 발명의 일부 실시예에서, DNA 백신은 프로모터(promoter), 적절한 전사 및 번역 제어 요소 및 본 발명의 하나 또는 그 이상의 폴리펩타이드를 암호화하는 핵산 서열을 갖는 플라스미드를 포함한다. 일부 실시예에서, 상기 플라스미드는 추가적으로 증강(enhance) 서열, 예를 들어, 발현 수준, 세포 내 표적화 등을 증강하는 서열을 포함할 수 있다.
본 발명의 백신 조성물의 항원은 HER2 유전자의 aa 676-1255의 세포 내 도메인(intracellular domain: ICD) (HER2-ICD)이다. 상기 HER2-ICD의 폴리펩타이드 서열은 서열번호 2의 아미노산 서열과 100% 상동성을 가지거나, 그렇지 않은 경우, 99% 이상, 95% 이상, 90% 이상, 85% 이상, 또는 80% 이상의 상동성을 가질 수 있다. 단 상기 특정 수치로 한정된 상동성을 가지는 경우 백신 접종으로 인한 HER2-ICD에 대한 면역원성은 100% 상동성을 지니는 서열과 동일 또는 균등한 효과를 갖는다.
본 발명의 일부 실시예에서는, DNA 백신은 본 발명의 HER2-ICD를 암호화하는 핵산 서열을 포함하는 플라스미드 벡터를 포함한다. 일부 실시예에서 상기 플라스미드는 pUMVC3(종래 명칭은 ‘pNGVL3’이므로, 두 명칭은 혼용될 수 있음) 플라스미드이다. 상기 HER2-ICD를 암호화하는 핵산 서열은 서열번호 3의 핵산 서열과 100% 상동성을 가지거나, 그렇지 않은 경우, 99% 이상, 95% 이상, 90% 이상, 85% 이상, 80% 이상의 상동성을 가질 수 있다. 단 상기 특정 수치로 한정된 상동성을 가지는 경우 백신 접종으로 인한 HER2-ICD에 대한 면역원성은 100% 상동성을 지니는 서열과 동일 또는 균등한 효과를 갖는다.
본 발명의 일부 실시예에서, DNA 백신은 백신의 효력을 강화하거나, 면역시스템을 자극하거나 또는 면역억제를 감소시키는 것과 같은 생성된 면역반응을 조절하는 면역조절분자(immunomodulatory molecules)를 추가적으로 암호화할 수 있다.
본 발명의 일부 실시예에서 HER2-ICD DNA 백신 조성물이 투여되는 환자군은 3기 또는 4기 유방암 환자군으로서, HER2를 발현하는 환자군이다. 환자 각각은 유방암 표준치료를 마친 후 완전 관해(complete remission) 상태이거나, 4기 유방암 환자군에서는 안정적인 골 전이(stable bone only diseas: SBO)만 허용되었다.
본 발명에서 백신 조성물은 유방암 재발에 대해 보호 면역을 유도 및/또는 유지하는 것이 목적이므로, 본 발명에서는 HER2-ICD에 대한 세포독성 T 세포 반응을 유도 및/또는 유지하기에 적합한 임의의 스케줄로 본 발명의 백신 조성물을 환자에게 투여할 수 있다. 예를 들어, 일차 예방접종으로서 본 명세서에서 기술되고 예시되는 바와 같은 백신 조성물을 일정 스케줄로 환자에게 투여한 후, 보호 면역을 유도 및/또는 유지하기 위해 부스터를 투여할 수 있다.
본 발명의 일부 실시예에서, 백신 조성물은 1개월 당 1회, 2회 또는 그 이상의 횟수로 환자에게 투여될 수 있다. 부스터는 접종 스케줄을 마친 후 일정 간격으로, 예를 들어 1개월의 간격으로 단수 또는 복수 회 투여될 수 있고, 6개월 이상의 기간을 가지고 단수 또는 복수 회 투여될 수 있다. 본 발명의 일부 실시예에서 일차 접종으로 매달 1회씩 3회 HER2-ICD 백신을 투여하였으나, 6개월 또는 1년 후에 추가적인 부스터를 접종할 수 있다.
이때 부스터는 일차 접종 시 사용한 백신 조성물과 동일한 용량 및 구성일 수도 있고, 용량 및/또는 구성이 변경될 수도 있다.
용어 “용량”은 대상체에 일회 투여하는 백신 조성물의 유효성분(HER2-ICD 플라스미드 DNA)의 총량을 의미한다. 본 발명의 일부 실시예에서는 HER2-ICD DNA 백신 조성물의 투여 용량을 각 Arm(22명 환자군)당 10㎍, 100㎍ 및 500㎍의 세가지 Arm으로 선정하여 투여하였다. 각 Arm에서는 모두 백신 투여에 의해 HER2-ICD에 대한 면역원성이 증가하는 것을 관찰했으며, 각 Arm에서 발생한 백신과 관련된 부작용들은 모두 Grade 1, 2이고(극히 낮은 등급), Grade 3-5의 심각한 부작용은 발견되지 않았다. 부작용과 관련하여 각 Arm들 간에 통계적으로 유의적인 차이는 없었다.
놀랍게도 본 발명의 백신 조성물을 투여한 환자군에서는 HER2-ECD에 대한 면역원성을 증가시킬 수 있었다. 본 발명의 DNA 백신 조성물은 HER2-ICD를 항원으로 하는 백신으로 HER2-ECD 또는 펩타이드의 서열과는 상이하나, 본 발명의 백신 조성물을 투여한 환자군 특히 Arm 2, Arm 3 환자군에서 HER2-ECD에 대한 면역반응성도 증가되어 있었다.
이러한 효과들을 미루어 볼 때 본 발명의 백신 조성물은 HER2-ICD에 대한 면역반응성이 백신 투여가 끝나도 장기적으로 지속된다는 것을 확인하였고, 유방암 치료로 관해 상태인 환자군에서 유방암 재발 또는 전이를 예방하는데 있어 우수한 효과를 가질 것이다.
본 발명의 백신 조성물에 있어서, 1회 투여되는 백신에 포함된 HER2-ICD의 플라스미드 DNA의 총량은 10㎍ 내지 1000㎍, 20㎍ 내지 1000㎍, 30㎍ 내지 1000㎍, 40㎍ 내지 1000㎍, 50㎍ 내지 1000㎍, 60㎍ 내지 1000㎍, 70㎍ 내지 1000㎍일 수 있고, 10㎍ 내지 900㎍, 20㎍ 내지 900㎍, 30㎍ 내지 900㎍, 40㎍ 내지 900㎍, 50㎍ 내지 900㎍, 60㎍ 내지 900㎍, 70㎍ 내지 900㎍일 수 있고, 10㎍ 내지 800㎍, 20㎍ 내지 800㎍, 30㎍ 내지 800㎍, 40㎍ 내지 800㎍, 50㎍ 내지 800㎍, 60㎍ 내지 800㎍, 70㎍ 내지 800㎍일 수 있고, 10㎍ 내지 700㎍, 20㎍ 내지 700㎍, 30㎍ 내지 700㎍, 40㎍ 내지 700㎍, 50㎍ 내지 700㎍, 60㎍ 내지 700㎍, 70㎍ 내지 700㎍일 수 있고, 10㎍ 내지 600㎍, 20㎍ 내지 600㎍, 30㎍ 내지 600㎍, 40㎍ 내지 600㎍, 50㎍ 내지 600㎍, 60㎍ 내지 600㎍, 70㎍ 내지 600㎍일 수 있고, 10㎍ 내지 500㎍, 20㎍ 내지 500㎍, 30㎍ 내지 500㎍, 40㎍ 내지 500㎍, 50㎍ 내지 500㎍, 60㎍ 내지 500㎍, 70㎍ 내지 500㎍일 수 있고; 10㎍ 내지 900㎍, 10㎍ 내지 800㎍, 10㎍ 내지 700㎍, 10㎍ 내지 600㎍, 10㎍ 내지 500㎍, 10㎍ 내지 400㎍, 10㎍ 내지 300㎍일 수 있고, 20㎍ 내지 900㎍, 20㎍ 내지 800㎍, 20㎍ 내지 700㎍, 20㎍ 내지 600㎍, 20㎍ 내지 500㎍, 20㎍ 내지 400㎍, 20㎍ 내지 300㎍일 수 있고, 30㎍ 내지 900㎍, 30㎍ 내지 800㎍, 30㎍ 내지 700㎍, 30㎍ 내지 600㎍, 30㎍ 내지 500㎍, 30㎍ 내지 400㎍, 30㎍ 내지 300㎍일 수 있고, 40㎍ 내지 900㎍, 40㎍ 내지 800㎍, 40㎍ 내지 700㎍, 40㎍ 내지 600㎍, 40㎍ 내지 500㎍, 40㎍ 내지 400㎍, 40㎍ 내지 300㎍일 수 있고, 50㎍ 내지 900㎍, 50㎍ 내지 800㎍, 50㎍ 내지 700㎍, 50㎍ 내지 600㎍, 50㎍ 내지 500㎍, 50㎍ 내지 400㎍, 50㎍ 내지 300㎍일 수 있다.
1회 투여되는 백신에 포함된 HER2-ICD의 플라스미드 DNA의 총량이 1㎍ 이면 목적하는 면역반응이 일어나지 않을 수 있고, 1000㎍ 초과인 경우 주사 부위 과민반응이나 면역 관용(immune tolerance)이 일어나서 면역력이 오히려 감소할 수 있다.
본 발명의 명세서에 기재된 백신 조성물은 HER2-ICD를 암호화하는 DNA를 포함하는 플라스미드 외에 약학적으로 허용되는 부형제(excipient), 담체, 희석제, 버퍼(buffer), 안정제(stabilizer), 보존제, 애주번트(adjuvant) 또는 이 발명이 속하는 기술분야에 잘 알려진 기타 물질을 포함할 수 있다. 이러한 물질은 비독성이고 유효 성분(들)의 약학적 활성을 방해하지 않는다. 약제학적 담체 또는 희석제는 예를 들어 수용액일 수 있다. 본 발명의 백신 조성물에 포함될 수 있는 담체 또는 다른 물질은 투여 경로(예를 들어 경구, 정맥, 피부 또는 피하, 코, 근육, 피내 및 복강 투여)에 따라 다르게 선택될 수 있다.
본 발명의 백신 조성물은 하나 또는 그 이상의 “약제학적으로 허용되는 담체”를 포함할 수 있다. 이들은 전형적으로 단백질, 당류(saccharides), 폴리락트산(polylactic acids), 폴리글리콜산(polyglycolic acids), 폴 리머릭(polymeric) 아미노산, 아미노산 공중합체, 수크로오스(sucrose), 트레할로스(trehalose) 등이 속한다. 이러한 담체는 이 발명이 속하는 기술분야에 잘 알려져 있다. 백신 조성물은 또한 물, 식염수, 글리세롤 등과 같은 희석제를 함유할 수 있다. 또한, 습윤제 또는 유화제, pH 버퍼 물질 등과 같은 보조 물질이 존재할 수 있다. 무균 발열원이 없는 인산염 버퍼 생리식염수, 트로메타민(트리스)이 대표적인 담체이다.
본 발명의 일 양태는 유효 성분으로서 하나 또는 그 이상의 플라스미드 DNA를 포함하는 상기 기재된 바와 같은 백신 조성물, 또는 키트에 관한 것이다. 이들은 대상에 면역반응을 유도하거나, 치료, 백신접종(vaccinating) 또는 면역요법을 제공하는 방법에 사용하기 위한 것일 수 있으며, 백신 조성물은 백신 또는 면역치료 조성물일 수 있다. 이러한 치료 또는 백신 접종은 대상체에 본 발명의 백신 조성물을 투여하는 것을 포함한다. 상기 백신 조성물은 정해진 스케줄로 대상체에 투여될 수 있다.
본 발명의 백신 조성물은 동결건조되거나 수성 형태(aqueous form)일 수 있다, 예를 들어 수용액 또는 현탁액 일 수 있다. 이러한 유형의 액체 제제(Liquid formulations)는 조성물이 수성 매질(aqueous medium)에서 재구성(reconstitution) 할 필요없이 포장된 형태로 직접 투여할 수 있으므로 주사에 이상적이다. 백신조성물은 바이알(vials)로 제공될 수 있거나 또는 미리 충전된 주사기로 제공될 수 있다. 주사기는 바늘과 함께 또는 바늘없이 공급될 수 있다. 주사기는 단일 용량을 포함하는 반면, 바이알은 단일 용량 또는 다수의(multiple) 용량을 포함할 수 있다. 또한, 본 발명의 백신 조성물은 마이크로니들을 이용하여 투여될 수 있다.
또한, 본 발명의 백신 조성물은 지연 방출 비히클 또는 데포(depot) 제제로 제형화될 수 있다. 이러한 장기간 작용 제형은 접종 또는 이식(예를 들어 피하 또는 근육내)에 의하거나 주사에 의해 투여될 수 있다. 따라서, 예를 들어, 백신 조성물은 적합한 중합체성 또는 소수성 물질(예를 들어, 허용되는 오일 중의 에멀젼) 또는 이온 교환 수지와 함께, 또는 난용성 유도체(예를 들어 난용성 염)으로서 제형화될 수 있다. 리포좀 및 에멀젼은 담체로서 사용하기에 적합한 전달 비히클로서 널리 알려진 예이다.
본 발명의 백신 조성물은 다수의(multiple) 투여 포맷(multiple dose format)으로 포장될 때 항균제(antimicrobial)를 포함할 수 있다. 항균제로는 2-페녹시에탄올(2-phenoxyethanol) 또는 파라벤(parabens)(메틸, 에틸, 프로필 파라벤) 등에서 선택될 수 있다. 임의의 보존제는 바람직하게는 낮은 수준으로 존재한다. 보존제는 외인성으로 첨가될 수 있고 및/또는 조성물을 형성하기 위해 혼합되는 벌크 항원의 성분일 수 있다.
본 발명의 백신 조성물은 설명서 등을 포함하는 키트 형태로 제공될 수 있다.
본 발명의 백신 조성물은 조성물의 면역원성을 증가시키기 위해, 하나 또는 그 이상의 애주번트(adjuvant)를 포함할 수 있다.
상기 적합한 애주번트(adjuvant)는 수산화알루미늄 또는 인산 알루미늄과 같은 알루미늄염을 포함하지만, 칼슘, 철 또는 아연의 염일 수 있거나 또는 아실화 티로신 또는 아실화 당의 불용성 현탁액일 수 있거나, 또는 양이온 또는 음이온적으로 유도된 당류 등에서 선택될 수 있으나, 이에 제한되지 않는다. 또한, 애주번트에는 면역조절제로 사용되는 사이토카인이 포함될 수 있다.
상기 면역조절제로 사용하기 적합한 사이토카인은 인터루킨(interleukin)(예를 들어, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, 등), 대식세포 콜로니 자극 인자(macrophage colony stimulating factor, M-CSF), 종양 괴사 인자(tumour necrosis factor, TNF), 과립구 대식세포 콜로니 자극 인자(granulocyte, macrophage colony stimulating factor, GM-CSF) 등에서 선택될 수 있지만, 이에 제한되지 않는다.
본 발명의 일실시예에서는 애주번트로 GM-CSF를 포함할 수 있다.
상기 애주번트는 1회 용량당 0.075mg 내지 0.2mg, 또는 0.08mg 내지 0.12mg의 양으로 첨가될 수 있다.
본 발명의 백신 조성물은 화학 항암제, 표적 항암제 및 면역 항암제 중 선택되는 하나 이상의 항암제와 병용투여할 수 있다. 본 발명의 백신 조성물과 병용투여될 수 있는 화학 항암제, 표적 항암제 및 면역 항암제 중 선택되는 하나 이상의 항암제는 상호 동시에 또는 시간 차를 두고 순차적으로 투여될 수 있으며, 적절한 시간 및 주기에 따라 선택될 수 있다.
본 발명에 있어서, 화학 항암제는 세포독성 항암제, 화학약물 항암제로도 불린다. 상기　화학 항암제는 예를 들면, 젬시타빈(Gemcitabine)(제시타빈주), 사이타라빈(Cytarabine), 카르보플라틴(Carboplatin)(파라플라틴), 시스플라틴 (Cisplatin)(플라티놀, 플라티놀-AQ), 크리조티닙(Crizotinib)(잘코리), 시클로포 스파미드(Cyclophosphamide)(시톡산, 네오사르), 도세탁셀(Docetaxel)(탁소티어), 독소루비신(Doxorubicin)(아드리아마이신), 에토포사이드(Etoposide)(베페시드), 플루오로우라실(5-fluorouracil, 5-FU), 이리노테칸(irinotecan)(캄토사르), 리포좀-캡슐화된 독소루비신(독실), 메토트렉세이트(Methotrexate)(폴렉스, 멕세이트, 아메토프테린), 파클리탁셀(Paclitaxel)(탁솔, 아브락산), 토포테칸(Topotecan)(하 이캄틴), 트라벡티딘(Trabectedin)(욘델리스), 빈크리스틴(Vincristine)(온코빈, 빈카사르 PFS) 또는 빈블라스틴(Vinbrastine)(벨반) 등이 있지만, 이에 제한되지 않는다.
본 발명에 있어서, 표적 항암제는 트라메티닙(Trametinib), 베무라페닙(vemurafenib), 알페리십(alpelisib), 닥톨리십(dactolisib), 게피티닙 (Gefitinib), 엘로티닙(Erlotinib), 라파티닙(Lapatinib), 수니티닙(Sunitinib), 소라페닙(Sorafenib), 크리조티닙(Crizotinib), 다브라페닙(Dabrafenib), 트라스투 주맙(Trastuzumab), 세툭시맙(Cetuximab), 베바시주맙(Bevacizumab), 파니투무맙 (Panitumumab), 이필리무맙(Ipilimumab), 퍼투주맙(Pertuzumab), 토파시티닙 (Tofacitinib), 이마티닙(Imatinib), 보르테조밉(Bortezomib), 오파투무맙 (Ofatumumab) 및 알렘투주맙(Alemtuzumab)으로 이루어진 군으로부터 선택되는 하나 이상의 표적 치료제일 수 있지만, 이에 제한되지 않는다.
본 발명에 있어서, 상기 면역 항암제는 CTLA-4(cytotoxic Tlymphocyte-associated protein 4), PD-1(Programmed cell death protein 1), LAG3(Lymphocyte Activation Gene-3), TIM-3(T-cell Immunoglobulin and Mucin-domain containing-3), TIGIT(T-cell Immunoreptor with IG and ITIM domain) 및 VISTA(Vdomain Ig Suppressor of T cell Activation)로 구성된 군으로부터 선택된 어느 하나에 대한 면역관문 억제제(immune checkpoint inhibitor)일 수 있으나, 이에 제한 되지 않는다.
본 발명에 있어서, 상기 조성물은 항암 보조제를 추가로 포함할 수 있고, 보다 바람직하게는 상기 항암 보조제는 STING(STimulator of InterferoN Gene) 아고니스트일 수 있으나 이에 제한되지는 않는다.
본 발명의 일부 실시예에서는 HER2-ICD DNA 백신 조성물의 투여는 다른 암 치료제에 의한 치료와 동시에 진행될 수 있다. 상기 암 치료제는 유방암 치료에 표준적으로 사용되는 플루오로우라실, 독소루비신, 파클리탁셀 등의 항암제, HER2에 대한 항체 치료제인 트라스투주맙(Trastuzumab, Herceptin®), ER(Estrogen receptor) 표적치료제인 타목시펜(tamoxifen) 또는 비스포스포네이트가 사용될 수 있지만, 이에 제한되지 않는다.
달리 나타내지 않는 한, 본 명세서 및 청구범위에 사용된 모든 숫자는, 언급되었든지 아니든지, 모든 경우에 용어 “약”에 의해 수식될 수 있는 것으로 이해되어야 한다. 또한, 본 명세서 및 특허청구범위에 사용된 정밀한 수치는 본 개시내용의 추가적인 실시양태를 형성하는 것으로 이해되어야 한다. 실시예에 개시된 수치의 정확성을 보장하기 위해 노력을 기울였다. 그러나, 측정된 모든 수치는 내재적으로 이의 각각의 측정 기법에서 실측된 표준 편차로부터 생성된 특정 오차값을 함유할 수 있다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
임상시험(NCT00436254)의 설계 및 결과
환자군
실험에 참여한 환자들은 다음의 기준을 만족하는 3기 또는 4기 유방암 환자이다. (1) 표준 요법을 완료했고 완전히 관해 상태로서, 4기 환자에서는 안정적인 골 전이(stable bone only disease)만 있는 환자만 허용되었다. (2) 면역 조직 세포 화학(Immunohistochemistry; IHC) 또는 형광 혼성화(Fluoresence in situ hybridization; FISH)를 통한 원발성 종양 또는 전이 단계에서 HER2 유전자 또는 단백질을 과발현하는 것으로 판명된 경우이다. (3) ECOG 수행상태 점수는 0이다(ECOG Performance Score O). (4) 백혈구(White Blood Cell:WBC)≥3000/mL, 혈소판(platelet) 수≥100,000/mL, 헤마토크릿(hematocrit)≥30; 그리고 정상적인 신장 및 간 기능을 가져야 한다. (5) 임상시험 등록 전 30일 동안 화학 요법 또는 스테로이드와 같은 기타 면역 억제 약물치료를 받지 않아야 한다. (6) 정상 범위의 좌심실구혈율(Left Ventricular Ejection Fraction; LVEF)이어야 한다.
백신 투여 기간 중 비스포스포네이트, 항-에스트로겐 및 트라스투주맙(Trastuzumab) 요법 등의 표준 치료가 허용되었다. 모든 환자는 기관 및 미연방(USA) 규정에 따라 서면 동의를 제공했다. 66명의 환자가 2004년 5월부터 2007년 8월까지 등록되었으며 64명의 환자가 3번의 백신 접종을 모두 완료했다. Arm 1에 등록한 2명의 환자는 백신을 1회 투여받은 후 질병이 진행되어 연구를 중단하였다.
승인받은 프로토콜에 따라 10년 동안 환자들의 장기 독성 정도 추적하였다.
연구 설계 및 치료 일정
본 실험에 참여하는 환자는 백신 용량으로 정의된 3개의 pNGVL3-HER2-ICD군(Arm 1: 10㎍, Arm 2: 100㎍, Arm 3: 500㎍) 중 하나에 순차적으로 배정되었다. 모든 백신은 피내(intradermal; i.d.)로 투여되는데, 같은 배액 림프절 부위 내(draining lymph node site)에서 한 달에 한 번 총 세 번의 백신에 대해, 한 번 백신 투약 시 두 개의 주사부위에 나누어 접종하였다. 환자들은 첫 번째 접종 전에 양성 대조군으로 파상풍 톡소이드 백신을 투여받았다. 동시에 트라스투주맙을 투여받은 환자는 기준선과 마지막 백신 1개월 후 MUGA 스캔을 수행했다. 독성 평가는 매월 수행되었으며, 백신 시리즈 완료 후 3, 6 및 12 개월에 수행되었으며 신체 검사, 자가 면역 혈청검사, CBC 및 종합 대사 패널검사를 포함했다. 독성은 CTCAE v 3.0에 따라 등급이 매겨졌고 백신 관련 독성은 심각도에 관계없이 확실히(definitely), 아마도(probably) 또는 관련성 있는(possibly) 이상 반응(Adverse Effect)으로 정의되었다. 장기적인 부작용은 생존 환자에 대한 연간 의료 기록 검토를 통해 평가되었다. PBMC는 베이스라인과 HER2-ICD 및 HER2-ECD에 대한 유도 면역반응을 평가하기 위해 세번째 백신 투여 후(12주) 및 최종 백신 접종 후 1, 3, 6 및 12개월(각각 임상 참여(enrollment) 후 16, 24, 36, 60주에 해당됨)에 수집되었다.
플라스미드 DNA의 지속성을 평가하기 위해 마지막 백신 투여 1개월과 3개월 후 백신 주사 부위에서 피부 생검을 얻었다. PBMC는 기준선과 마지막 백신 1개월 후 플라스미드 DNA의 존재에 대해 평가되었다.
백신 제제
HER2-ICD 서열(서열번호: 2)을 pNGVL3에 삽입하고 DNA시퀀싱으로 확인하였다. 플라스미드 DNA 백신인 pNGVL3-HER2-ICD는 GMP 조건 하에서 증폭, 정량화 및 바이얼(vial)로 제조되었다. 단일 용량 바이알에는 안정화 완충액(1.2ml)으로 Tromethamine/EDTA에 현탁된 10㎍, 100㎍ 또는 500㎍ 플라스미드 DNA(pNGVL3-HER2-ICD) 및 공통으로 100㎍의 GM-CSF가 포함되어 있다. 바이알은 미생물, 무균 및 안정성 테스트를 거쳐 미국 약전 표준에 따라 University of Washington Investigational Drug Services Pharmacy에서 -25oC에서 -10oC 사이에 보관되었다.
항원 특이적 T 세포 반응의 평가
모든 환자의 PBMC 샘플은 림프구 기능을 보존하는 것으로 입증된 표준화된 방법을 사용하여 처리되고 냉동 보존되었다. 각 환자에 대한 모든 샘플을 동시에 해동하고 분석하여 실험적 변동성을 줄였다. 이전에 공지된 Disis등의 방법(J Clin Oncol. 2009 Oct 1; 27(28): 4685-92)에 따라 후술할 항원(자극제)에 의해 자극된 IFN-γ 엘리스팟법을 통해 HER2에 대한 특이적인 반응을 측정하였다. HER2-ICD 또는 HER2-ECD 항원(자극제)은 11개 아미노산이 중첩되는 15개 아미노산 펩타이드 풀(overlapping peptide pool; 1 mg/mL)을 항원으로 사용하였다.
백신 접종 후 엘리스팟법으로 측정된 PBMC에서HER2-ICD 특이적인IFN-γ 생산량이 베이스라인보다 2 배 증가한 경우 환자는 HER2-ICD 특이적 T 세포 반응을 증가시킨 것으로 간주하였다.
환자군 분석 및 각 Arm 별 독성(Adverse Effect) 분석
Arm 1, Arm 2 및 Arm 3는 각각 22명의 환자로 구성되었으며, 각각 HER2-ICD 플라스미드 DNA를 10㎍, 100㎍ 및 500㎍을 포함하고, 공통으로 100㎍의 GM-CSF가 포함된 백신 조성물을 피내(intradermal)로 투여받았다. 각 Arm의 환자 특성은 표 1에 기재되어 있다.
DNA 백신 용량 Arm 1
(10㎍)		 Arm 2
(100㎍)		 Arm 3
(500㎍)
No % No % No %
연령(~세): 중간값(범위) 50(38-68) 51(34-72) 53(42-77)
병기
III 15 68 15 68 12 55
IV (NED) 3 14 4 18 7 32
IV (SBO) 4 18 3 14 3 14
ER/PR 상태
ER+ 및/또는 PR+ 14 64 15 68 8 36
ER-/PR- 8 36 7 32 14 64
이전 트라스투주맙 치료여부
No 4 18 2 9 2 9
Yes 18 32 20 91 20 91
동시 트라스투주맙 치료
No 14 64 12 55 9 41
Yes 8 36 10 45 13 59
ER: Estrogen Receptor(에스트로겐 수용체)PR: Progesterone Receptor(프로게스테론 수용체)
NED: No Evidence of Disease(질병의 징후가 없음)
SBO: Stable Bone-Only disease(안정적인 골 전이)
모든 부문에서 총 990개의 부작용(Adverse Effects)이 관찰되었으며 517개는 백신과 관련된 것으로 간주된다(표 2). 가장 일반적인 백신 관련 부작용은 주사 부위 반응(23%), 피로(7%) 및 근육통(7%)을 포함한다. 모든 백신 관련 독성은 대부분 1등급(89%) 또는 2등급(11%)이었으며, 각 Arm들 간에 유의한 차이가 없다.
DNA 백신의 안전성에 있어서, 외부 DNA가 대상체로 투여되기 때문에, 자가면역반응의 발생 및 /또는 대상체의 유전체 DNA(chromosomal DNA)로 외부 DNA가 삽입되는 위험성이 매우 낮지만 존재한다. 본 연구에서는 모든 Arm들에서 16회의 자가면역에 관련된 이상 혈청학적 반응이 발견되었다(표 2). 11명의 환자에서는 백신 접종 기간에 ANA 양성을 보였고, 5명의 환자에서는 C3의 일시적인 감소가 관찰되었다.
모든 자가면역 관련 독성은 1등급이었고, 항 ds-DNA 항체는 모든 환자에서 발견되지 않았을 뿐만 아니라, 자가면역질환의 징후 또는 발생은 발견되지 않았다. 백신을 접종한 모든 환자의 림프구(circulating lymphocyte)에서 DNA 백신은 검출되지 않았다.
따라서, 본 발명의 백신 조성물 투여에 의한 부작용은 극히 낮은 등급으로 대상체에 투여함에 있어 우려할 정도라 할 수 없고, 자가면역질환의 징후 또는 질환의 발생이 관찰되지 않았다. 또한, 본 발명의 백신 조성물은 대상체의 유전체로의 삽입이 관찰되지 않았으므로, 임상에 적용함에 있어 안전성에 문제가 없는 것으로 판단된다.
DNA 백신 용량 total Arm 1
(10㎍)		 Arm 2
(100㎍)		 Arm 3
(500㎍)
No % No % No % No %
가장 빈번한 부작용(n=188)
주사부위 반응 117 23 38 7 48 9 31 6
감기 유사 반응 35 7 19 4 9 2 7 1
피로 36 7 14 3 17 3 5 1
비정상적인 자가 면역반응(n=16)
ANA 11 2 4 1 3 1 4 1
C3 5 1 3 1 1 <1 1 <1
Anti-ds DNA 0 0 0 0 0 0 0 0
모든 부작용의 등급(n=517)
1 459 89 180 35 130 25 149 29
2 57 11 26 5 11 2 20 4
3 1 <1 0 0 0 0 1 <1
4 0 0 0 0 0 0 0 0
5 0 0 0 0 0 0 0 0
SBO: Stable Bone-Only disease(안정적인 골 전이)ANA: anti-nuclear antibody(항-핵 항체)
C3: Complement 3(컴플리먼트 3)
Anti-ds DNA: anti-double strand DNA antibody(항-이중가닥 DNA 항체)
HER2-ICD DNA 백신 및 HER2-ICD 펩타이드 백신의 항원에 대한 면역원성 분석
본 과제 이전에 연구가 완료된(NCT00343109) 유방암 3기 또는 4기 환자 38명을 대상으로 한HER2-ICD 펩타이드 백신(aa 971-984: ELVSEFSRMARDP)에서의 항원에 대한 면역반응 증강효과와 본 과제에서의 HER2-ICD DNA 백신에서의 항원에 대한 면역반응 증강효과를 비교하였다.
각 항원에 대한 면역반응은 마지막 백신 투여 1달 후(1 month post final vaccine), 마지막 백신 투여 40주 이후(Long-term follow up; LTFU)에 채취된 PBMC에 각 백신에 맞는 항원 즉 HER2-ICD DNA 백신 투여군의 경우 HER2-ICD를 항원으로 사용하였고, HER2-ICD 펩타이드 백신 투여군의 경우 ELVSEFSRMARDP의 폴리펩타이드를 항원으로 사용하여 IFN-γ의 양을 엘리스팟법에 의해 측정하였다.
그 결과 HER2-ICD DNA 백신의 경우 마지막 백신 투여 1달 후 및 40주 후의 면역반응은 여전히 증가되어 있었지만, HER2-ICD 펩타이드 백신은 마지막 백신 투여 후 40주 후부터 감소된 면역반응을 보이는 것으로 보아 HER2-ICD 펩타이드 백신은 장기 면역 지속력이 HER2-ICD DNA 백신에 비해 떨어지는 것으로 보인다(도 1).
각 Arm 별 면역반응성 분석
HER2-ICD DNA 백신에 의해 면역반응이 증강된 환자의 비율(베이스라인에 비해 2배 이상 증가)은 Arm 1(47 %) 및 Arm 3(45 %)에 비해 Arm 2(73 %)에서 가장 높았다. 백신접종 후 모든 환자군에서 HER2-ICD에 대한 면역반응이 증가하였다. 연구 기간 동안의 최대치로 관찰된 면역반응(연구 과정 동안 개인의 최대 면역반응으로 정의되었지만 마지막 면역학적 시점 이전의 측정값임)은 각 Arm에서 백신 접종 전 반응과 비교할 때 상당히 높았다(p <0.05, p <0.005 및 p <0.01). 하지만, 백신 접종 완료 후 면역반응(Long-term follow up: LTFU; 마지막 접종 후 60주 경과)은 Arm 1 및 Arm 3에서는 유의미하게 감소하였다. 하지만, Arm 2에서의 백신 접종 후 면역반응은 최대치를 유지하였다(도 2 참조).
각 용량군에 따른 HER2-ICD에 대한 면역반응을 분석한 결과, Arm 2 및 Arm 3는 Arm 1에 비해 증가된 HER2-ICD 면역반응성을 보였다. 하지만, Arm 2 및 Arm 3간의 HER2-ICD에 대한 면역반응에는 통계적으로 유의한 차이가 없었다. 도 2에 나타난 바와 같이 백신 접종 1년 후에도 Arm 2 및 Arm 3는 증강된 HER2-ICD에 대한 면역반응성이 유지되었지만, Arm 1의 경우 백신 접종 후 24주가 지난 후부터 HER2-ICD에 대한 평균 면역반응성은 감소하는 경향을 보였다.
Arm 1 내지 Arm 3의 모든 환자군에서는 HER2-ICD 백신 투여 후 HER2-ECD에 대해서도 증가된 면역반응성을 보였다. 하지만, Arm 1의 경우는 백신 전·후에 있어 HER2-ECD에 대한 면역반응성의 차이는 통계적으로 유의하지 않았고, Arm 2 및 Arm 3는 백신 전·후에 있어 통계적으로 유의한 HER2-ECD에 대한 면역반응성의 차이를 보였다. 하지만, Arm 2 및 Arm 3간에는 통계적으로 유의한 차이를 보이지 않았다. Arm 2의 경우 백신 접종 완료후에도 HER2-ECD에 대한 면역반응성은 감소되지 않고 유지되는 경향을 보였다.
종합하면, 본 발명의 HER2-ICD DNA 백신은 접종 용량 10㎍(Arm 1), 100㎍(Arm 2), 500㎍(Arm 3)에서 유의미한 부작용은 발생하지 않았고, 모두 증강된 HER2-ICD에 대한 면역반응을 보였으나, 백신 조성물의 용량이 10㎍(Arm 1)의 경우 100㎍(Arm 2), 500㎍(Arm 3)에 비해 HER2-ICD에 대한 면역반응 증가율이 낮을 뿐만 아니라, LTFU(1년)에서 최대치의 면역반응에 있어서도 100㎍(Arm 2), 500㎍(Arm 3)에 비해 감소된 면역반응률을 보였다.
서열정보
서열번호 1(HER2 전장서열)
YLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
서열번호 2(HER2-ICD aa 서열)
MKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERAKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
서열번호 3(HER2-ICD NT 서열)
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGGCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTAA

Claims (13)

  1. 약제학적으로 허용 가능한 담체, 및 서열번호 2 또는 이와 80% 이상의 서열상동성을 지니는 HER2-ICD 영역을 암호화하는 뉴클레오티드 서열을 포함하는 플라스미드 벡터를 1회 용량당 10㎍ 내지 1000㎍의 함량으로 포함하는 대상체에서 유방암 재발에 대해 보호 또는 치료 면역을 유도하는 백신 조성물.
  2. 제1항에 있어서,
    상기 뉴클레오티드 서열은 서열번호 3 또는 이와 80% 이상의 서열상동성을 지니는, 백신 조성물.
  3. 제1항 또는 제2항에 있어서,
    상기 백신 조성물에 포함되는 플라스미드 벡터의 1회 용량당 함량은 50㎍ 내지 500㎍인, 백신 조성물.
  4. 제1항 또는 제2항에 있어서,
    상기 대상체는 HER2를 발현하는 유방암 환자인, 백신 조성물.
  5. 제4항에 있어서,
    상기 대상체는 유방암 진단 후 완전한 임상적 완화(remission) 상태인, 백신 조성물.
  6. 제4항에 있어서,
    상기 대상체는 유방암 진단 후 부분적인 임상적 완화 상태인, 백신 조성물.
  7. 제4항에 있어서,
    상기 대상체는 사람인, 백신 조성물
  8. 제1항 또는 제2항에 있어서,
    상기 백신 조성물은 추가적으로 애주번트를 포함하는, 백신 조성물.
  9. 제8항에 있어서,
    상기 애주번트은 GM-CSF인, 백신 조성물.
  10. 제1항 또는 제2항에 있어서,
    상기 백신 조성물은 주사 또는 접종에 의해 투여되는, 백신 조성물.
  11. 제10항에 있어서,
    상기 조성물은 피내(intradermal)주사에 의해 투여되는, 백신 조성물.
  12. 제11항에 있어서,
    상기 백신 조성물이 보호 면역을 확립할 때까지 3개월에 거쳐 3회 투여되는, 백신 조성물.
  13. 제12항에 있어서,
    추가적으로 부스팅 접종을 포함하는, 백신 조성물.
PCT/KR2022/006314 2021-05-04 2022-05-03 Her2 백신 조성물 WO2022235044A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163183865P 2021-05-04 2021-05-04
US63/183,865 2021-05-04

Publications (1)

Publication Number Publication Date
WO2022235044A1 true WO2022235044A1 (ko) 2022-11-10

Family

ID=83932831

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/006314 WO2022235044A1 (ko) 2021-05-04 2022-05-03 Her2 백신 조성물

Country Status (1)

Country Link
WO (1) WO2022235044A1 (ko)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100332417A1 (en) * 2009-06-02 2010-12-30 Targeted Molecular Diagnostics, Llc Methods for the detection and quantitation of the p95 component of her2/neu (erbb2)

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20100332417A1 (en) * 2009-06-02 2010-12-30 Targeted Molecular Diagnostics, Llc Methods for the detection and quantitation of the p95 component of her2/neu (erbb2)

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
ARAB ATEFEH; YAZDIAN-ROBATI REZVAN; BEHRAVAN JAVAD: "HER2-Positive Breast Cancer Immunotherapy: A Focus on Vaccine Development", ARCHIVUM IMMUNOLOGIAE ET THERAPIAE EXPERIMENTALIS, BIRKHAEUSER VERLAG AG, CH, vol. 68, no. 1, 9 January 2020 (2020-01-09), CH , XP037118528, ISSN: 0004-069X, DOI: 10.1007/s00005-019-00566-1 *
AYDAH AL‐AWADHI; JAMES LEE MURRAY; NUHAD K. IBRAHIM: "Developing anti‐HER2 vaccines: Breast cancer experience", INTERNATIONAL JOURNAL OF CANCER, JOHN WILEY & SONS, INC., US, vol. 143, no. 9, 10 May 2018 (2018-05-10), US , pages 2126 - 2132, XP071290425, ISSN: 0020-7136, DOI: 10.1002/ijc.31551 *
DISIS MARY L., COVELER ANDREW L., HIGGINS DOREEN, FINTAK PATRICIA, WAISMAN JAMES ROSS, REICHOW JESSICA, SLOTA MEREDITH, CHILDS JEN: "A phase I trial of the safety and immunogenicity of a DNA-based vaccine encoding the HER2/neu (HER2) intracellular domain in subjects with HER2+ breast cancer.", JOURNAL OF CLINICAL ONCOLOGY, AMERICAN SOCIETY OF CLINICAL ONCOLOGY, US, vol. 32, no. 15_suppl, 20 May 2014 (2014-05-20), US , pages 616 - 616, XP009540881, ISSN: 0732-183X, DOI: 10.1200/jco.2014.32.15_suppl.616 *
OMABE MAXWELL, AHMED SHAHID, SAMI AMER, XIE YUFENG, TAO MIN, XIANG JIM: "HER2-Specific Vaccines for HER2-Positive Breast Cancer Immunotherapy", WORLD JOURNAL OF VACCINES, SCIENTIFIC RESEARCH PUBLISHING, INC., US, vol. 05, no. 02, 1 January 2015 (2015-01-01), US , pages 106 - 128, XP093001309, ISSN: 2160-5815, DOI: 10.4236/wjv.2015.52013 *

Similar Documents

Publication Publication Date Title
US20220241389A1 (en) Vaccine for the prevention of breast cancer relapse
JP5059271B2 (ja) リガンド免疫原複合体を用いる処置方法
JP6387156B2 (ja) 乳癌再発の予防用ワクチン
EP2613808B1 (en) Companion animal cancer treatments with an anti p2x7 antibody
JP2003528924A5 (ko)
KR20140053906A (ko) 헨드라 및 니파 바이러스 ｇ 당단백질 면역원성 조성물
CA2459348C (en) Antibodies to non-functional p2x7receptor, diagnosis and treatment of cancers and other conditions
US20100330093A1 (en) Treatment of melanoma with alpha thymosin peptides in combination with antibodies against cytotoxic t lymphocyte-associated antigen 4 (ctla4)
WO2023008815A1 (ko) Her2 백신 조성물
WO2022235044A1 (ko) Her2 백신 조성물
US20220202901A1 (en) Peptides in combination with immune checkpoint inhibitors for use in treatment of cancer
WO2023055078A1 (ko) Hsp90 항원성 펩타이드를 포함하는 항암용 백신 조성물 및 이의 용도
WO2022235045A1 (ko) Her2 백신 조성물
WO2022235046A1 (ko) Her2 백신 조성물
EA012072B1 (ru) Иммунотерапевтические композиции для получения аутоантител, способных предотвращать связывание интерлейкина-2 со своим рецептором, и их использование в лечении рака
WO2011146559A1 (en) Combination therapy with ae37 peptide and an antibody that binds to her2/neu protein
US20200038440A1 (en) Short-term activated dc1s and methods for their production and use
US20150031617A1 (en) Use of thymosin alpha for treatment of purulent rhinosinusitis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22799087

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 22799087

Country of ref document: EP

Kind code of ref document: A1