WO2022235046A1 - Her2 백신 조성물 - Google Patents
Her2 백신 조성물 Download PDFInfo
- Publication number
- WO2022235046A1 WO2022235046A1 PCT/KR2022/006321 KR2022006321W WO2022235046A1 WO 2022235046 A1 WO2022235046 A1 WO 2022235046A1 KR 2022006321 W KR2022006321 W KR 2022006321W WO 2022235046 A1 WO2022235046 A1 WO 2022235046A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- vaccine
- dna
- cells
- her2
- vaccination
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims description 98
- 239000000203 mixture Substances 0.000 title abstract description 59
- 101150029707 ERBB2 gene Proteins 0.000 title description 2
- 108010041986 DNA Vaccines Proteins 0.000 claims abstract description 44
- 229940021995 DNA vaccine Drugs 0.000 claims abstract description 44
- 238000000034 method Methods 0.000 claims abstract description 44
- 230000005847 immunogenicity Effects 0.000 claims abstract description 42
- 230000007774 longterm Effects 0.000 claims abstract description 33
- 238000012544 monitoring process Methods 0.000 claims abstract description 14
- 238000002255 vaccination Methods 0.000 claims description 63
- 210000004027 cell Anatomy 0.000 claims description 34
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 claims description 33
- 239000000427 antigen Substances 0.000 claims description 31
- 102000036639 antigens Human genes 0.000 claims description 31
- 108091007433 antigens Proteins 0.000 claims description 31
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 15
- 210000003071 memory t lymphocyte Anatomy 0.000 claims description 12
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 claims description 10
- 101001018097 Homo sapiens L-selectin Proteins 0.000 claims description 10
- 102100033467 L-selectin Human genes 0.000 claims description 10
- 238000007390 skin biopsy Methods 0.000 claims description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical group C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 4
- 230000003834 intracellular effect Effects 0.000 claims description 4
- 239000013600 plasmid vector Substances 0.000 claims description 3
- 238000012408 PCR amplification Methods 0.000 claims description 2
- 239000002773 nucleotide Chemical group 0.000 claims 2
- 125000003729 nucleotide group Chemical group 0.000 claims 2
- 238000010998 test method Methods 0.000 claims 1
- 108020004414 DNA Proteins 0.000 description 46
- 206010006187 Breast cancer Diseases 0.000 description 33
- 208000026310 Breast neoplasm Diseases 0.000 description 32
- 230000028993 immune response Effects 0.000 description 26
- 238000011282 treatment Methods 0.000 description 22
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 21
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 21
- 206010028980 Neoplasm Diseases 0.000 description 20
- 239000013612 plasmid Substances 0.000 description 18
- 239000002246 antineoplastic agent Substances 0.000 description 17
- 230000001965 increasing effect Effects 0.000 description 17
- 201000011510 cancer Diseases 0.000 description 16
- 230000000694 effects Effects 0.000 description 15
- 238000011238 DNA vaccination Methods 0.000 description 13
- 201000010099 disease Diseases 0.000 description 13
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 13
- 238000011081 inoculation Methods 0.000 description 12
- 230000036039 immunity Effects 0.000 description 11
- 239000000126 substance Substances 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 239000002671 adjuvant Substances 0.000 description 9
- 230000002411 adverse Effects 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 102000015694 estrogen receptors Human genes 0.000 description 9
- 108010038795 estrogen receptors Proteins 0.000 description 9
- 230000001681 protective effect Effects 0.000 description 8
- 238000002347 injection Methods 0.000 description 7
- 239000007924 injection Substances 0.000 description 7
- 230000002688 persistence Effects 0.000 description 7
- 229960000575 trastuzumab Drugs 0.000 description 7
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 6
- 150000001413 amino acids Chemical group 0.000 description 6
- 239000003814 drug Substances 0.000 description 6
- 230000007246 mechanism Effects 0.000 description 6
- 108090000765 processed proteins & peptides Proteins 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 102000004457 Granulocyte-Macrophage Colony-Stimulating Factor Human genes 0.000 description 5
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 5
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 5
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 5
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 5
- 102100037850 Interferon gamma Human genes 0.000 description 5
- 108010074328 Interferon-gamma Proteins 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 230000005867 T cell response Effects 0.000 description 5
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 5
- 238000004519 manufacturing process Methods 0.000 description 5
- 239000003550 marker Substances 0.000 description 5
- 150000007523 nucleic acids Chemical group 0.000 description 5
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 4
- 206010027476 Metastases Diseases 0.000 description 4
- 229930012538 Paclitaxel Natural products 0.000 description 4
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 239000003795 chemical substances by application Substances 0.000 description 4
- 229960002949 fluorouracil Drugs 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 238000009169 immunotherapy Methods 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000009401 metastasis Effects 0.000 description 4
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 4
- 229960001592 paclitaxel Drugs 0.000 description 4
- 108090000623 proteins and genes Proteins 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- 230000009257 reactivity Effects 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 229960000814 tetanus toxoid Drugs 0.000 description 4
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 230000001363 autoimmune Effects 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000014509 gene expression Effects 0.000 description 3
- 230000002519 immonomodulatory effect Effects 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 238000007918 intramuscular administration Methods 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 210000004698 lymphocyte Anatomy 0.000 description 3
- 229940023041 peptide vaccine Drugs 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 102000004196 processed proteins & peptides Human genes 0.000 description 3
- 210000003289 regulatory T cell Anatomy 0.000 description 3
- -1 small molecule compound Chemical class 0.000 description 3
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- AHOKKYCUWBLDST-QYULHYBRSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s,3s)-2-[[(2s)-2,6-diaminohexanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=CC=C1 AHOKKYCUWBLDST-QYULHYBRSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 229940122361 Bisphosphonate Drugs 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000001301 EGF receptor Human genes 0.000 description 2
- 108060006698 EGF receptor Proteins 0.000 description 2
- XXPXYPLPSDPERN-UHFFFAOYSA-N Ecteinascidin 743 Natural products COc1cc2C(NCCc2cc1O)C(=O)OCC3N4C(O)C5Cc6cc(C)c(OC)c(O)c6C(C4C(S)c7c(OC(=O)C)c(C)c8OCOc8c37)N5C XXPXYPLPSDPERN-UHFFFAOYSA-N 0.000 description 2
- 101150054472 HER2 gene Proteins 0.000 description 2
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000831007 Homo sapiens T-cell immunoreceptor with Ig and ITIM domains Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 2
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 2
- 206010062016 Immunosuppression Diseases 0.000 description 2
- 206010022095 Injection Site reaction Diseases 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical class [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 2
- 239000002146 L01XE16 - Crizotinib Substances 0.000 description 2
- 102100020862 Lymphocyte activation gene 3 protein Human genes 0.000 description 2
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 2
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- 102100024834 T-cell immunoreceptor with Ig and ITIM domains Human genes 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 229960000548 alemtuzumab Drugs 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 150000004663 bisphosphonates Chemical class 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 229960005061 crizotinib Drugs 0.000 description 2
- KTEIFNKAUNYNJU-GFCCVEGCSA-N crizotinib Chemical compound O([C@H](C)C=1C(=C(F)C=CC=1Cl)Cl)C(C(=NC=1)N)=CC=1C(=C1)C=NN1C1CCNCC1 KTEIFNKAUNYNJU-GFCCVEGCSA-N 0.000 description 2
- 231100000433 cytotoxic Toxicity 0.000 description 2
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 2
- 230000001472 cytotoxic effect Effects 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 108700020302 erbB-2 Genes Proteins 0.000 description 2
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 238000003364 immunohistochemistry Methods 0.000 description 2
- 230000001506 immunosuppresive effect Effects 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- 238000007912 intraperitoneal administration Methods 0.000 description 2
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 2
- 229960004891 lapatinib Drugs 0.000 description 2
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 238000012417 linear regression Methods 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 206010061289 metastatic neoplasm Diseases 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- 238000000053 physical method Methods 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 230000002335 preservative effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 238000007920 subcutaneous administration Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- 238000002626 targeted therapy Methods 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- PKVRCIRHQMSYJX-AIFWHQITSA-N trabectedin Chemical compound C([C@@]1(C(OC2)=O)NCCC3=C1C=C(C(=C3)O)OC)S[C@@H]1C3=C(OC(C)=O)C(C)=C4OCOC4=C3[C@H]2N2[C@@H](O)[C@H](CC=3C4=C(O)C(OC)=C(C)C=3)N(C)[C@H]4[C@@H]21 PKVRCIRHQMSYJX-AIFWHQITSA-N 0.000 description 2
- 229960000281 trometamol Drugs 0.000 description 2
- 102000003390 tumor necrosis factor Human genes 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- STUWGJZDJHPWGZ-LBPRGKRZSA-N (2S)-N1-[4-methyl-5-[2-(1,1,1-trifluoro-2-methylpropan-2-yl)-4-pyridinyl]-2-thiazolyl]pyrrolidine-1,2-dicarboxamide Chemical compound S1C(C=2C=C(N=CC=2)C(C)(C)C(F)(F)F)=C(C)N=C1NC(=O)N1CCC[C@H]1C(N)=O STUWGJZDJHPWGZ-LBPRGKRZSA-N 0.000 description 1
- MWWSFMDVAYGXBV-MYPASOLCSA-N (7r,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.O([C@@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-MYPASOLCSA-N 0.000 description 1
- NWUYHJFMYQTDRP-UHFFFAOYSA-N 1,2-bis(ethenyl)benzene;1-ethenyl-2-ethylbenzene;styrene Chemical compound C=CC1=CC=CC=C1.CCC1=CC=CC=C1C=C.C=CC1=CC=CC=C1C=C NWUYHJFMYQTDRP-UHFFFAOYSA-N 0.000 description 1
- QCDWFXQBSFUVSP-UHFFFAOYSA-N 2-phenoxyethanol Chemical compound OCCOC1=CC=CC=C1 QCDWFXQBSFUVSP-UHFFFAOYSA-N 0.000 description 1
- YUDPTGPSBJVHCN-DZQJYWQESA-N 4-methylumbelliferyl beta-D-galactoside Chemical compound C1=CC=2C(C)=CC(=O)OC=2C=C1O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O YUDPTGPSBJVHCN-DZQJYWQESA-N 0.000 description 1
- TVEXGJYMHHTVKP-UHFFFAOYSA-N 6-oxabicyclo[3.2.1]oct-3-en-7-one Chemical compound C1C2C(=O)OC1C=CC2 TVEXGJYMHHTVKP-UHFFFAOYSA-N 0.000 description 1
- 108010012934 Albumin-Bound Paclitaxel Proteins 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 239000012275 CTLA-4 inhibitor Substances 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical class [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 102000016918 Complement C3 Human genes 0.000 description 1
- 108010028780 Complement C3 Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 238000007399 DNA isolation Methods 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010024405 HER2 peptide (369-377) Proteins 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- 101150030213 Lag3 gene Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000000112 Myalgia Diseases 0.000 description 1
- 239000012270 PD-1 inhibitor Substances 0.000 description 1
- 239000012668 PD-1-inhibitor Substances 0.000 description 1
- 102100035593 POU domain, class 2, transcription factor 1 Human genes 0.000 description 1
- 101710084414 POU domain, class 2, transcription factor 1 Proteins 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 102100025803 Progesterone receptor Human genes 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 239000004012 Tofacitinib Substances 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical class [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 229940028652 abraxane Drugs 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 229950010482 alpelisib Drugs 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 125000000129 anionic group Chemical group 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000003460 anti-nuclear Effects 0.000 description 1
- 239000004599 antimicrobial Substances 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 239000007900 aqueous suspension Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 230000006472 autoimmune response Effects 0.000 description 1
- 230000005784 autoimmunity Effects 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229940088954 camptosar Drugs 0.000 description 1
- 239000012830 cancer therapeutic Substances 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 238000003759 clinical diagnosis Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 229960002465 dabrafenib Drugs 0.000 description 1
- BFSMGDJOXZAERB-UHFFFAOYSA-N dabrafenib Chemical compound S1C(C(C)(C)C)=NC(C=2C(=C(NS(=O)(=O)C=3C(=CC=CC=3F)F)C=CC=2)F)=C1C1=CC=NC(N)=N1 BFSMGDJOXZAERB-UHFFFAOYSA-N 0.000 description 1
- 229950006418 dactolisib Drugs 0.000 description 1
- JOGKUKXHTYWRGZ-UHFFFAOYSA-N dactolisib Chemical compound O=C1N(C)C2=CN=C3C=CC(C=4C=C5C=CC=CC5=NC=4)=CC3=C2N1C1=CC=C(C(C)(C)C#N)C=C1 JOGKUKXHTYWRGZ-UHFFFAOYSA-N 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 229940000406 drug candidate Drugs 0.000 description 1
- 230000002500 effect on skin Effects 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 238000005534 hematocrit Methods 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 229940088013 hycamtin Drugs 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229940045207 immuno-oncology agent Drugs 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 239000002584 immunological anticancer agent Substances 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940124589 immunosuppressive drug Drugs 0.000 description 1
- 230000001024 immunotherapeutic effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 230000003907 kidney function Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 230000003908 liver function Effects 0.000 description 1
- 231100001252 long-term toxicity Toxicity 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000000691 measurement method Methods 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 238000001565 modulated differential scanning calorimetry Methods 0.000 description 1
- ZDZOTLJHXYCWBA-BSEPLHNVSA-N molport-006-823-826 Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-BSEPLHNVSA-N 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 239000002547 new drug Substances 0.000 description 1
- 229960002450 ofatumumab Drugs 0.000 description 1
- 239000006174 pH buffer Substances 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 229940121655 pd-1 inhibitor Drugs 0.000 description 1
- 229960002087 pertuzumab Drugs 0.000 description 1
- 239000008024 pharmaceutical diluent Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229960005323 phenoxyethanol Drugs 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 229940063179 platinol Drugs 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 238000009021 pre-vaccination Methods 0.000 description 1
- 229940071643 prefilled syringe Drugs 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 108090000468 progesterone receptors Proteins 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 229940030749 prostate cancer vaccine Drugs 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 239000002510 pyrogen Substances 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000000405 serological effect Effects 0.000 description 1
- 229960000714 sipuleucel-t Drugs 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 230000007480 spreading Effects 0.000 description 1
- 238000003892 spreading Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 229960001350 tofacitinib Drugs 0.000 description 1
- UJLAWZDWDVHWOW-YPMHNXCESA-N tofacitinib Chemical compound C[C@@H]1CCN(C(=O)CC#N)C[C@@H]1N(C)C1=NC=NC2=C1C=CN2 UJLAWZDWDVHWOW-YPMHNXCESA-N 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 229960000977 trabectedin Drugs 0.000 description 1
- 229960004066 trametinib Drugs 0.000 description 1
- LIRYPHYGHXZJBZ-UHFFFAOYSA-N trametinib Chemical group CC(=O)NC1=CC=CC(N2C(N(C3CC3)C(=O)C3=C(NC=4C(=CC(I)=CC=4)F)N(C)C(=O)C(C)=C32)=O)=C1 LIRYPHYGHXZJBZ-UHFFFAOYSA-N 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 150000003668 tyrosines Chemical class 0.000 description 1
- 229960003862 vemurafenib Drugs 0.000 description 1
- GPXBXXGIAQBQNI-UHFFFAOYSA-N vemurafenib Chemical compound CCCS(=O)(=O)NC1=CC=C(F)C(C(=O)C=2C3=CC(=CN=C3NC=2)C=2C=CC(Cl)=CC=2)=C1F GPXBXXGIAQBQNI-UHFFFAOYSA-N 0.000 description 1
- 230000002861 ventricular Effects 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- AQTQHPDCURKLKT-PNYVAJAMSA-N vincristine sulfate Chemical compound OS(O)(=O)=O.C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C=O)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 AQTQHPDCURKLKT-PNYVAJAMSA-N 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940004212 yondelis Drugs 0.000 description 1
- 229910052725 zinc Chemical class 0.000 description 1
- 239000011701 zinc Chemical class 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6844—Nucleic acid amplification reactions
- C12Q1/686—Polymerase chain reaction [PCR]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
Definitions
- the present invention relates to a HER2 vaccine composition.
- DFC Disease Free Survival
- ER-targeted therapeutics such as tamoxifen, which inhibit the activation of estrogen receptors
- HER2-positive patients various targeted therapies such as using a HER2-targeting antibody such as Trastuzumab are used to treat breast cancer or to slow the progression of breast cancer.
- Cancer vaccines are designed to activate cytotoxic T cells, causing the activated T cells to recognize and act against certain types of cancer cells, or to induce the production of antibodies that bind antigens present on the surface of cancer cells.
- prostate cancer vaccine sipuleucel-T Provenge®
- antigens are specifically expressed in certain types of tumor cells, each individual expresses antigens at a low level, or in the case of metastatic tumors, the antigen profile may change between the initially occurring tumor and metastatic tumor.
- the immune evasion mechanism of tumor cells is also explained as the cause of some low success rates.
- HER2/neu (hereinafter referred to as 'HER2') is a family of epidermal growth factor receptor (EGFR2), and overexpression of EGFR is observed in many carcinomas. In particular, HER2 overexpression is observed in 15-30% of all breast cancer patients, and HER2 expression is known to be associated with recurrence and poor prognosis in breast cancer patients.
- HER2 is a transmembrane protein having the amino acid sequence of SEQ ID NO: 1, an intracellular domain (ICD, HER2 aa 676-1255) having protein tyrosine kinase activity, a transmembrane domain: TM, HER2 aa 653-675 ) and an extracellular domain (ECM, HER2 aa 22-652).
- HER2 in breast cancer has been studied quite extensively, and several immunogenic peptides have been discovered.
- immunotherapy is attempted, such as re-injection after loading into dendritic cells.
- no clinically significant therapeutic or protective effects were reported in women with advanced breast cancer.
- the recent large-scale Phase 3 clinical trial was discontinued because there was no difference in disease-free survival (DFS) compared to the placebo group.
- DFS disease-free survival
- Examples of another HER2 peptide vaccine include HER2-ICD peptide vaccine AE37 (LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790)), HER2-TM peptide vaccine GP2 (HER2 aa 654-662), and the like.
- HER2-ICD peptide vaccine AE37 LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790
- HER2-TM peptide vaccine GP2 HER2 aa 654-662
- a DNA vaccine composition comprising a plasmid comprising a nucleic acid sequence encoding HER2-ICD can stably increase immunogenicity against HER2-ICD in breast cancer patients without side effects. As well as possible, it was confirmed that the long-term immunogenicity of the vaccine composition can be monitored, thereby completing the present invention.
- the present invention provides a method for monitoring the long-term immunogenicity of a DNA vaccine composition by monitoring the extent of a specific immune response to a vaccine antigen in peripheral blood mononuclear cells (PBMC) at least 1 month after completion of vaccination in a DNA vaccinated patient. .
- PBMC peripheral blood mononuclear cells
- the present invention provides a method for monitoring the long-term immunogenicity of a DNA vaccine by determining the ratio of central memory T cells in peripheral blood mononuclear cells (PBMC) before and after vaccination of a DNA vaccination patient.
- PBMC peripheral blood mononuclear cells
- an object of the present invention is to provide a method for monitoring the long-term immunogenicity of a DNA vaccine by confirming the presence or absence of vaccine DNA at the inoculation site of a patient vaccinated with a DNA vaccine after completion of vaccination.
- the present invention provides a method for monitoring the long-term immunogenicity of a DNA vaccine after completion of vaccination at an inoculation site of a patient vaccinated with a DNA vaccine.
- the DNA vaccine can monitor the long-term immunogenicity of the DNA vaccine composition by monitoring the degree of specific immune response to the vaccine antigen in peripheral blood mononuclear cells (PBMC) at least one month after completion of inoculation. have.
- PBMC peripheral blood mononuclear cells
- PBMC peripheral blood mononuclear cells
- the DNA vaccine is inoculated intradermally, and the presence of vaccine DNA can be confirmed in the skin biopsy tissue at the inoculation site.
- the time for confirming the presence of the vaccine DNA may be arbitrarily selected from 1 month to 3 months after vaccination is completed.
- the monitoring method according to the present invention can continuously monitor the long-term immunogenicity of the DNA vaccine without a large burden on the patient, it facilitates the prediction of the acquisition of immunogenicity by the DNA vaccine in the vaccinated patient and provides additional vaccination ( It has the advantage of finding the timing of boosting immunization, boosting shot).
- Figure 2 shows the results of analysis of immunogenicity against HER2-ICD in central memory T cells in the Arm 2 patient group (Figure 2A: CD4+ T cells, Figure 2B: CD8+ T cells).
- prevent refers to the success or signs of success in preventing breast cancer recurrence/relapse when a patient in clinical remission is examined by radiation or physical methods.
- no recurrence refers to a state in which there is no recurrence of cancer in breast cancer or other sites when a patient in clinical remission is examined by radiation or physical methods.
- cancer to breast cancer or other sites after a period of improvement, remission, or remission by breast cancer treatment. means a sign or symptom of an outbreak.
- protective immunity means that a subject initiates an immune response against a HER2-ICD antigen so that the subject's immune system can target and destroy cells expressing the same antigen, thereby causing cancer recurrence or It is meant to reduce cancer progression.
- protective immunity is conferred by, but not limited to, T lymphocytes.
- the amount of IFN- ⁇ produced by peripheral blood mononuclear cells (PBMC) of a subject stimulated by HER2-ICD is measured by the Elispot method (Enzyme- When measured by linked immuno-spot assay: ELISpot), it was considered that the HER2-ICD-specific T cell response was increased when the HER2-ICD-specific IFN- ⁇ production was more than doubled compared to the baseline.
- booster refers to a dose of an immunogen administered to a patient to enhance, prolong or maintain protective immunity and to overcome down-regulation of T-cell responses mediated by regulatory T-cells.
- pharmaceutically acceptable refers to a substance that is acceptable to a patient from a pharmacological/toxicological point of view with respect to composition, formulation, safety, etc.
- pharmaceutically acceptable carrier refers to the biological activity of the active ingredient(s). It refers to a medium that does not interfere with the effect and is nontoxic to the subject upon administration.
- patient refers to a living organism suffering from, treated, or susceptible to a condition for which the disease can be prevented or treated by administration of a vaccine composition of the present invention, such as breast cancer, includes both humans and animals.
- Subjects include, but are not limited to, mammals (eg, mice, monkeys, horses, cattle, pigs, dogs, cats, etc.), preferably humans.
- patient or “subject” in the present invention includes, without distinction, a breast cancer patient or a breast cancer patient expressing HER2.
- administering refers to introducing a vaccine composition to a subject using any of a variety of methods and delivery systems known in the art.
- routes of administration include intravenous, intramuscular, subcutaneous, intraperitoneal, spinal, or other parenteral routes of administration, such as by injection or infusion.
- administration refers to an intradermal mode of administration generally by injection, including intravenous, intramuscular, intraarterial, intrathecal, or intralymphatic injection and infusion, but It is not limited.
- Other parenteral routes include topical, epithelial, or mucosal routes of administration, such as intranasal, vaginal, rectal, or sublingual routes.
- “vaccine injection”, “treatment” and “vaccination” are used without distinction to a subject.
- the term “immune anticancer agent” refers to a therapeutic agent that induces immune cells to selectively attack only cancer cells by stimulating the immune system by injecting artificial immune proteins into the body, unlike conventional anticancer agents that attack cancer itself. It is an anticancer drug with a mechanism to restore or strengthen the tumor recognition or destruction ability of the immune system in order to overcome the immunosuppression or immune evasion mechanism acquired by spores.
- the immuno-oncology agent includes, but is not limited to, an immune checkpoint inhibitor, an immune cell therapeutic agent, and an immunoviral therapeutic agent.
- the term “immune checkpoint inhibitor” refers to an immune checkpoint protein involved in T cell suppression when some cancer cells avoid immunity while utilizing the immune checkpoint of T cells, which are immune cells in the body. It is a type of immunotherapy that blocks activation and activates T cells to attack cancer cells, including CTLA-4 inhibitors, PD-1 inhibitors, LAG-3 inhibitors, TIM-3 inhibitors, TIGIT inhibitors, and VISTA inhibitors. It is not limited thereto.
- the immune checkpoint inhibitor is an antagonist, and may be an antagonist antibody or a small molecule compound.
- compositions disclosed herein are prepared as DNA vaccines.
- a DNA vaccine comprises a plasmid having a promoter, appropriate transcriptional and translational control elements and a nucleic acid sequence encoding one or more polypeptides of the present invention.
- the plasmid may additionally contain enhancement sequences, eg, sequences that enhance expression levels, intracellular targeting, and the like.
- the antigen of the vaccine composition of the present invention is an intracellular domain (ICD) of aa 676-1255 of the HER2 gene (HER2-ICD).
- the polypeptide sequence of HER2-ICD has 100% homology to the amino acid sequence of SEQ ID NO: 2, or, otherwise, 99% or more, 95% or more, 90% or more, 85% or more, or 80% or more homology can have However, in the case of homology limited to the above specific value, immunogenicity against HER2-ICD due to vaccination has the same or equivalent effect as a sequence having 100% homology.
- the DNA vaccine comprises a plasmid vector comprising a nucleic acid sequence encoding the HER2-ICD of the present invention.
- the plasmid is a pUMVC3 (conventional name is 'pNGVL3', so the two names may be used interchangeably) plasmid.
- the nucleic acid sequence encoding the HER2-ICD has 100% homology to the nucleic acid sequence of SEQ ID NO: 3 or, otherwise, 99% or more, 95% or more, 90% or more, 85% or more, 80% or more homology can have However, in the case of homology limited to the above specific value, immunogenicity against HER2-ICD due to vaccination has the same or equivalent effect as a sequence having 100% homology.
- the DNA vaccine may additionally encode immunomodulatory molecules that modulate the resulting immune response, such as enhancing the efficacy of the vaccine, stimulating the immune system or reducing immunosuppression. have.
- the patient group to which the HER2-ICD DNA vaccine composition is administered is a group of patients with stage 3 or 4 breast cancer, and is a group of patients expressing HER2.
- Each patient was in complete remission after completing standard breast cancer treatment, or only stable bone only diseas (SBO) was allowed in the stage 4 breast cancer patient group.
- the present invention can be administered on any schedule suitable for inducing and/or maintaining a cytotoxic T cell response to HER2-ICD.
- the vaccine composition of the invention may be administered to a patient.
- a vaccine composition as described and exemplified herein as a primary vaccination may be administered to a patient on a schedule, followed by administration of a booster to induce and/or maintain protective immunity.
- the vaccine composition may be administered to the patient once, twice or more times per month.
- the booster may be administered singly or multiple times at regular intervals, for example, at intervals of 1 month, and may be administered singly or multiple times with a period of 6 months or more.
- the HER2-ICD vaccine was administered three times once a month as the primary inoculation, but an additional booster may be administered after 6 months or 1 year.
- the booster may have the same dose and composition as the vaccine composition used for the primary inoculation, or the dose and/or composition may be changed.
- dose refers to the total amount of the active ingredient (HER2-ICD plasmid DNA) of the vaccine composition administered once to a subject.
- the dose of the HER2-ICD DNA vaccine composition was selected and administered to three arms of 10 ⁇ g, 100 ⁇ g, and 500 ⁇ g per arm (22 patients group). In each arm, immunogenicity against HER2-ICD was observed to increase with vaccine administration, and all vaccine-related adverse events occurring in each arm were Grade 1 and 2 (extremely low grade), and Grade 3-5 serious adverse events. was not found There was no statistically significant difference between each arm regarding side effects.
- the DNA vaccine composition of the present invention is a vaccine using HER2-ICD as an antigen, and is different from the sequence of HER2-ECD or peptide, but it is not effective against HER2-ECD in the patient group administered with the vaccine composition of the present invention, especially in the Arm 2 and Arm 3 patient groups. Immune reactivity was also increased.
- the immunoreactivity to HER2-ICD persists for a long time even after vaccine administration is finished, and the vaccine composition of the present invention has an excellent effect in preventing recurrence or metastasis of breast cancer in the patient group in remission with breast cancer treatment.
- the total amount of HER2-ICD plasmid DNA contained in the vaccine administered once is 10 ⁇ g to 1000 ⁇ g, 20 ⁇ g to 1000 ⁇ g, 30 ⁇ g to 1000 ⁇ g, 40 ⁇ g to 1000 ⁇ g, 50 ⁇ g to 1000 ⁇ g, 60 ⁇ g to 1000 ⁇ g, 70 ⁇ g to 1000 ⁇ g, 10 ⁇ g to 900 ⁇ g, 20 ⁇ g to 900 ⁇ g, 30 ⁇ g to 900 ⁇ g, 40 ⁇ g to 900 ⁇ g, 50 ⁇ g to 900 ⁇ g, 60 ⁇ g to 900 ⁇ g, 70 ⁇ g to 900 ⁇ g, 10 ⁇ g to 800 ⁇ g, 20 ⁇ g to 800 ⁇ g, 30 ⁇ g to 800 ⁇ g, 40 ⁇ g to 800 ⁇ g, 50 ⁇ g to 800 ⁇ g, 60 ⁇ g to 800 ⁇ g , 70 ⁇ g to 800 ⁇ g, 10 ⁇ g to 700 ⁇ g, 20 ⁇ g to
- the desired immune response may not occur. This could rather be reduced.
- long-term immunogenicity is the most important factor. If long-term immunogenicity is obtained after completion of DNA vaccination, treatment or prevention effects may occur by continuous immune response. In some cases, it is necessary to receive additional vaccines for acquisition or to finally change the treatment method.
- PBMC peripheral blood mononuclear cells
- PBMCs of subjects were isolated and the immune response to HER2-ICD was measured by Elispot method.
- the immunogenicity to HER2-ICD was high in the long term (long term follow-up: LTFU, 12 months after completion of vaccination). It was confirmed that the level of immunogenicity of the vaccine antigen measured at least one month after completion of vaccination is an important factor in predicting long-term immunogenicity.
- the time point for measuring immunogenicity in PBMCs after completion of vaccination may be 1 month, 2 months or 3 months after completion of vaccination, or any time point selected from 1 month to 3 months.
- DNA acts as a continuous source to transfect cells at the site of vaccine administration to produce the desired antigen. Therefore, when DNA is continuously present at the site of vaccine administration for a long period of time, antigen can be continuously produced, which is thought to be helpful in maintaining antigen-specific immunity. If it persists for a long time, the subject may elicit an immune response against the plasmid DNA vector itself.
- the vector DNA was detected in 31 patients, It was not detected in 21 patients.
- the 21 patient group in which vector DNA was not detected had higher immunoreactivity to HER2-ICD compared to patients in which vector DNA was detected. It showed a tendency to increase, and in particular, it was confirmed that there was a significant difference in immunoreactivity at LTFU (12 months after completion of vaccination).
- the time point of examining the presence of vector DNA in order to detect the persistence of the vaccine composition of the present invention in the inoculation site may be any time selected from 1 month, 2 months, 3 months, or 1 month to 3 months after the final vaccination. have.
- the long-term immunogenicity of DNA vaccines can also be monitored by a method to determine the proportion of central memory T cells (CMT cells) in PBMCs before and after vaccination.
- CMT cells central memory T cells
- clonal expansion of T cells activated by the vaccine antigen and differentiation into effector cells are induced, thereby showing a protective effect by the vaccine.
- the activated T cells are removed and, at the same time, differentiate into memory T cells including central memory T cells (CMT cells).
- CMT cells central memory T cells
- the ratio of CMT cells in PBMCs was analyzed before and 60 weeks after inoculation. Surprisingly, the proportion of CMT cells (CD4+, CD8+ cells) increased even after 60 weeks of vaccination, and it was confirmed that, in particular, both CD4+ CMT cells and CD8+ CMT cells had a significant correlation with the increased immune response to HER2-ICD.
- the vaccine composition described in the specification of the present invention is a pharmaceutically acceptable excipient, carrier, diluent, buffer, stabilizer, preservative, adjuvant ( adjuvant) or other substances well known in the art. These substances are non-toxic and do not interfere with the pharmaceutical activity of the active ingredient(s).
- the pharmaceutical carrier or diluent may be, for example, an aqueous solution.
- the carrier or other material that may be included in the vaccine composition of the present invention may be selected differently depending on the route of administration (eg, oral, intravenous, dermal or subcutaneous, nasal, intramuscular, intradermal and intraperitoneal administration).
- the vaccine composition of the present invention may include one or more “pharmaceutically acceptable carriers”. These typically include proteins, saccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose, and trehalose. Such carriers are well known in the art.
- the vaccine composition may also contain a diluent such as water, saline, glycerol, and the like.
- auxiliary substances such as wetting or emulsifying agents, pH buffer substances and the like may be present.
- Phosphate-buffered saline without sterile pyrogens and tromethamine (Tris) are typical carriers.
- One aspect of the present invention relates to a vaccine composition or kit as described above comprising one or more plasmid DNAs as an active ingredient. They may be for use in a method of inducing an immune response in a subject, or providing treatment, vaccination or immunotherapy, and the vaccine composition may be a vaccine or immunotherapeutic composition. Such treatment or vaccination comprises administering to the subject a vaccine composition of the present invention.
- the vaccine composition may be administered to a subject on a fixed schedule.
- the vaccine composition of the present invention may be lyophilized or may be in aqueous form, for example an aqueous solution or suspension. Liquid formulations of this type are ideal for injection as they can be administered directly in packaged form without the need for the composition to be reconstituted in an aqueous medium.
- the vaccine composition may be provided in vials or may be provided in a prefilled syringe. The syringe may be supplied with or without a needle. A syringe contains a single dose, whereas a vial may contain a single dose or multiple doses.
- the vaccine composition of the present invention may be administered using a microneedle.
- the vaccine composition of the present invention may be formulated as a delayed release vehicle or depot preparation.
- Such long acting formulations may be administered by inoculation or implantation (eg subcutaneously or intramuscularly) or by injection.
- a vaccine composition may be formulated with a suitable polymeric or hydrophobic material (e.g., an emulsion in an acceptable oil) or ion exchange resin, or as a sparingly soluble derivative (e.g., a sparingly soluble salt).
- a suitable polymeric or hydrophobic material e.g., an emulsion in an acceptable oil
- ion exchange resin e.g., a sparingly soluble derivative
- Liposomes and emulsions are well-known examples of delivery vehicles suitable for use as carriers.
- the vaccine composition of the present invention may contain an antimicrobial agent when packaged in a multiple dose format.
- the antibacterial agent may be selected from 2-phenoxyethanol or parabens (methyl, ethyl, propyl paraben).
- Optional preservatives are preferably present at low levels.
- a preservative may be added exogenously and/or may be a component of the bulk antigen that is mixed to form the composition.
- the vaccine composition of the present invention may be provided in the form of a kit including instructions and the like.
- the vaccine composition of the present invention may contain one or more adjuvants to increase the immunogenicity of the composition.
- Such suitable adjuvants include aluminum salts such as aluminum hydroxide or aluminum phosphate, but may be salts of calcium, iron or zinc or may be insoluble suspensions of acylated tyrosine or acylated sugars, or may be cationic or anionic It may be selected from derivatized saccharides and the like, but is not limited thereto.
- the adjuvant may contain cytokines used as immunomodulatory agents.
- Cytokines suitable for use as the immunomodulatory agent include interleukins (eg, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.); Although it can be selected from macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF), granulocyte macrophage colony stimulating factor (GM-CSF), etc. , but not limited thereto.
- interleukins eg, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, etc.
- M-CSF macrophage colony stimulating factor
- TNF tumor necrosis factor
- GM-CSF granulocyte macrophage colony stimulating factor
- GM-CSF may be included as an adjuvant.
- the adjuvant may be added in an amount of 0.075 mg to 0.2 mg, or 0.08 mg to 0.12 mg per dose.
- the vaccine composition of the present invention may be administered in combination with one or more anticancer agents selected from chemical anticancer agents, targeted anticancer agents, and immune anticancer agents.
- One or more anticancer agents selected from chemical anticancer agents, targeted anticancer agents, and immune anticancer agents that can be administered in combination with the vaccine composition of the present invention may be administered simultaneously or sequentially with a time difference, and may be selected according to an appropriate time and cycle. .
- the chemical anticancer agent is also called a cytotoxic anticancer agent or a chemical drug anticancer agent.
- the chemical anticancer agent is, for example, Gemcitabine (Gemcitabine), Cytarabine, Carboplatin (Paraplatin), Cisplatin (Platinol, Platinol-AQ) ), Crizotinib (Zalkori), Cyclophosphamide (Cytoxane, Neosar), Docetaxel (Taxotere), Doxorubicin (Adriamycin), Etoposide ) (bepeside), fluorouracil (5-fluorouracil, 5-FU), irinotecan (camptosar), liposome-encapsulated doxorubicin (doxyl), methotrexate (polex, mexate, ametope) Terine), Paclitaxel (Taxol, Abraxane), Topotecan (Hycamtin), Trabectedin
- the target anticancer agent is trametinib, vemurafenib, alpelisib, dactolisib, gefitinib, erlotinib, lapatinib ( Lapatinib), Sunitinib, Sorafenib, Crizotinib, Dabrafenib, Trastuzumab, Cetuximab, Bevacizumab , Panitumumab, Ipilimumab, Pertuzumab, Tofacitinib, Imatinib, Bortezomib, Ofatumumab and Alemtuzumab ( Alemtuzumab) may be one or more targeted therapeutic agents selected from the group consisting of, but is not limited thereto.
- the immunocancer agent is CTLA-4 (cytotoxic Tlymphocyte-associated protein 4), PD-1 (Programmed cell death protein 1), LAG3 (Lymphocyte Activation Gene-3), TIM-3 (T-cell Immunoglobulin and Mucin-domain containing-3), TIGIT (T-cell Immunoreptor with IG and ITIM domain), and VISTA (Vdomain Ig Suppressor of T cell Activation) to any one selected from the group consisting of an immune checkpoint inhibitor (immune checkpoint inhibitor)
- an immune checkpoint inhibitor immunoreconstituted thereto.
- the composition may further include an anticancer adjuvant, and more preferably, the anticancer adjuvant may be a STimulator of InterferoN Gene (STING) agonist, but is not limited thereto.
- STING STimulator of InterferoN Gene
- administration of the HER2-ICD DNA vaccine composition may be performed simultaneously with treatment with other cancer therapeutic agents.
- the cancer treatment agents include anticancer agents such as fluorouracil, doxorubicin, and paclitaxel that are standardly used for breast cancer treatment, Trastuzumab, Herceptin®, an antibody treatment for HER2, and tamoxifen, an Estrogen receptor (ER) targeted treatment ) or bisphosphonates may be used, but are not limited thereto.
- stage 3 or 4 breast cancer patients who met the following criteria.
- stage IV patients (2) Cases that are found to overexpress HER2 gene or protein in the primary tumor or metastasis stage through immunohistochemistry (IHC) or fluorescence in situ hybridization (FISH).
- ECOG performance score is 0 (SCOG Performance Score O).
- WBC White Blood Cell
- WBC Do not receive chemotherapy or other immunosuppressive drugs such as steroids for 30 days prior to clinical trial enrollment.
- LVEF Left Ventricular Ejection Fraction
- Standard of care including bisphosphonates, anti-estrogens and Trastuzumab therapy, was permitted during the vaccination period. All patients provided written informed consent in accordance with institutional and federal regulations. 66 patients were enrolled from May 2004 to August 2007 and 64 patients completed all three vaccinations. Two patients enrolled in Arm 1 discontinued the study due to disease progression after one dose of vaccine. Long-term toxicity of patients was followed for 10 years in accordance with federal regulations.
- Toxicity was graded according to CTCAE v 3.0 and vaccine-related toxicity was defined as an Adverse Effect, regardless of severity, definitely, probably or possibly. Long-term adverse events were assessed through an annual medical record review of surviving patients.
- PBMCs were evaluated at baseline and after the third vaccine administration (12 weeks) and 1, 3, 6 and 12 months after the last vaccination (after clinical enrollment, respectively) to evaluate the induced immune responses to HER2-ICD and HER2-ECD. 16, 24, 36, and 60 weeks).
- PBMCs were assessed for the presence of plasmid DNA at baseline and 1 month after the last vaccine.
- the HER2 ICD sequence (SEQ ID NO: 2) was inserted into pNGVL3 and confirmed by DNA sequencing.
- the plasmid DNA vaccine, pNGVL3-HER2-ICD was amplified, quantified and prepared in vials under GMP conditions. Single dose vials contained 10 ⁇ g, 100 ⁇ g or 500 ⁇ g plasmid DNA (pNGVL3-HER2-ICD) suspended in Tromethamine/EDTA as stabilization buffer (1.2 ml) and commonly 100 ⁇ g GM-CSF. Vials were tested for microbial, sterility, and stability and stored between -25 o C and -10 o C at the University of Washington Investigational Drug Services Pharmacy according to US Pharmacopoeia standards.
- PBMC samples from all patients were processed and cryopreserved using standardized methods that have been demonstrated to preserve lymphocyte function. All samples for each patient were thawed and analyzed simultaneously to reduce experimental variability. Specificity for HER2 through the IFN- ⁇ Elispot method stimulated by an antigen (stimulator) to be described later according to the previously known method of Disis et al. (J Clin Oncol. 2009 Oct 1; 27(28): 4685-92) negative response was measured. For the HER2-ICD or HER2-ECD antigen (stimulator), an overlapping 15 amino acid peptide pool (1 mg/mL) in which 11 amino acids overlap was used as an antigen.
- a patient was considered to have an increased HER2-ICD-specific T cell response if the HER2-ICD-specific IFN- ⁇ production in PBMCs measured by the Elispot method after vaccination was increased by 2 times from baseline.
- the vaccination was administered between the two tattoo marks.
- a biopsy was performed at the designated inoculation site (skin) at the designated period.
- the isolated skin tissue was stored at 70 ° C.
- DNA of tissue and PBMC was isolated using a DNA isolation kit, and vector DNA was amplified using a primer pair of PRDM36 primer [GACTAACAGACTGTTCCTTTCCATGG: coding primer] and PRDM52 primer [GCCAGAAGTCAGATGCTCAA: complementary primer].
- PBMCs were fluorochrome-bound single containing CD3 FITC, CD4 PE-Cy7, CD45RO APC, CD62L PE, CD279(PD-1) APC, CD278(ICOS) PE, and CD28 PerCP Cy5.5 for T-cell phenotyping analysis. It was stained with clonal antibody. Data are expressed as % of CD45RO+ CD62L+ cells in CD3+ CD4+ or CD3+ CD8+ cells, CD28+ CD4+ or CD8+ in CD3+ cells, PD1+ CD4+ or CD8+ cells and fluorescence of ICOS in CD4+ and CD8+ populations.
- HLA-DR PE-Cy7, CD11b PE and CD33 PerCP Cy5.5, CD3 PE-Cy 5, CD4 PE-Cy7 and Foxp3 Alex488 were stained.
- regulatory T cells Treg cells
- MDSCs were defined as HLA-DR-CD11b+ CD33+ cells
- Treg cells were defined as CD4+ Foxp3+ cells among CD3+ cells.
- Arm 1 and Arm 3 each consisted of 22 patients, each containing 10 ⁇ g, 100 ⁇ g, and 500 ⁇ g of HER2-ICD plasmid DNA, and a vaccine composition containing 100 ⁇ g of GM-CSF in common. It was administered intradermally. The patient characteristics for each arm are listed in Table 1.
- Estrogen Receptor PR Progesterone Receptor
- the side effects caused by the administration of the vaccine composition of the present invention cannot be said to be of concern when administered to a subject at an extremely low grade, and no signs of autoimmune disease or the occurrence of disease were observed.
- the vaccine composition of the present invention was not observed to be inserted into the genome of the subject, it is judged that there is no problem in safety in clinical application.
- Anti-ds DNA anti-double strand DNA antibody
- the HER2-ICD antigen was detected from isolated peripheral blood mononuclear cells (PBMC) at 1 month after vaccination and 12 months after completion of vaccination (LTFU) to analyze the immunoreactivity. Immunoreactivity was analyzed by Elispot method.
- the immune response to the HER2-ICD antigen before vaccination was used as the “baseline” to analyze the level of the immune response to the baseline.
- the degree of specific immune response to the vaccine antigen in PBMCs at least 1 month after completion of vaccination (a level that has been increased more than twofold) can be used as a marker to predict long-term immunogenicity during DNA vaccination.
- vaccine DNA persists for only a certain period and when lost, a higher immune response occurs, and such a mechanism can be used as a marker for predicting long-term immunogenicity during DNA vaccination. .
- CMT cells central memory T cells
- the arm 2 and arm 3 patient groups showed a higher immune response to HER2-ICD by vaccination than the arm 1 patient group, and there was no difference between Arm 2 and Arm 3, but the arm 2 patient group showed a higher level of immunity even after completion of vaccination.
- the level of immunogenicity against HER2-ICD was maintained.
- CMT cells central memory T cells
- CD4+ cells CD45RO+ CD62L+ CD4+
- CD8+ CD62L+ CD8+ CD45RO+ CD62L+ CD8+
- both CD45RO+ CD62L+ CD4+ T cells and CD45RO+ CD62L+ CD8+ T cells which are CMT cells, significantly increased in LTFU after inoculation compared to before vaccination (see FIG. 1 ).
- SEQ ID NO: 1 (HER2 full length sequence)
- SEQ ID NO: 2 (HER2-ICD amino acid sequence)
- SEQ ID NO: 3 (HER2-ICD nucleotide sequence)
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Urology & Nephrology (AREA)
- Microbiology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
본 발명은 DNA 백신 조성물의 장기 면역원성을 모니터링하는 방법에 관한 것으로, 본 발명의 모니터링 방법은 장기 면역원성을 조기부터 지속적으로 모니터링할 수 방법이다. 본 발명의 장기 면역원성 모니터링 방법은 환자에 부담을 주지 않는 방법으로 HER2-ICD DNA 백신 조성물에 적용될 수 있다.
Description
본 출원은 2021년 05월 04일자 미국 특허 출원 제63/183,874호에 기초한 우선권의 이익을 주장하며, 해당 미국 특허 출원의 문헌에 개시된 모든 내용은 본 명세서의 일부로서 포함한다.
본 발명은 HER2 백신 조성물에 관한 것이다.
유방암은 여성에게서 가장 빈번하게 진단되는 암이며, 가장 흔한 암 사망의 원인일 뿐만 아니라, 발생률은 높아지고, 발병 연령대는 점차 낮아지는 경향을 보인다.
지난 20년 동안 유방암 치료에 있어서, 다양한 표적 치료 및 진단법 등으로 Disease Free Survival(DFC)를 다른 암종에 비해 상당히 개선하였다. 예를 들어, 외과적인 수술 및 파클리탁셀과 같은 화학요법 또는 방사선요법 등의 전통적인 암 치료법에 더해, 에스트로겐 수용체(Estrogen Receptor; ER) 양성 유방암 환자에는 에스트로겐 수용체의 활성화를 억제하는 타목시펜 등의 ER 표적 치료제를 사용하고, HER2 양성 환자에게는 트라스투주맙과 같은 HER2 표적 항체를 사용하는 등의 다양한 표적치료제를 이용하여 유방암을 치료하거나, 유방암 진행을 느리게 하고 있다.
하지만, 유방암 치료에 있어 치료방법의 진전에도 불구하고, 상당수의 환자는 전이 또는 재발에 의해 사망하는 경우가 많기 때문에, 유방암 재발을 낮추고 생존률(Overall Survival:OS) 또는 무질병생존률(Disease Free Survival:DFS)을 높이려는 시도가 있어왔다.
유방암 전이 또는 재발을 막기 위한 시도로서 유방암 줄기세포(breast cancer stem cell)에 대한 바이오마커를 발굴하여 이에 대한 표적치료를 하는 방법에 대한 연구와 동시에 유방암 특이 항원에 대한 백신을 이용하는 면역요법에 대해 연구되고 있다. 암 백신은 세포독성 T 세포를 활성화하여, 활성화된 T 세포가 특정 유형의 암 세포를 인지하여 이에 맞서 작용하게 하거나, 암 세포 표면에 존재하는 항원과 결합하는 항체의 생산을 유도하도록 디자인된다.
지난 수년간 암 치료 또는 재발을 막기 위해 백신 연구가 광범위하게 이루어졌지만, 전립선암 백신인 시플루셀-T(sipuleucel-T, Provenge®)를 제외하고는 성공적인 사례가 아직 존재하지 않는다. 이러한 낮은 성공률에 대해서는 특정 유형의 종양 세포에 항원이 특이적으로 발현되더라도, 각 개인에 따라서는 낮은 수준으로 항원을 발현하거나, 전이성 종양의 경우 최초 발생 종양과 전이성 종양 간에 항원 프로파일이 변화될 수 있고, 종양세포의 면역회피 기전도 일부 낮은 성공률의 원인으로 설명하고 있다.
바람직한 백신 항원은 종양세포에서 배타적으로 또는 적어도 증가된 수준으로 발현되어야 한다. HER2/neu(이하 ‘HER2’라 함)는 EGFR(epidermal growth factor receptor)의 패밀리(EGFR2)로 많은 암종에서 EGFR의 과발현이 관찰된다. 특히 전체 유방암 환자의 15~30%에서 HER2 과발현이 관찰되고, HER2 발현은 유방암 환자에서 재발 및 나쁜 예후와 관련되어 있다고 알려져 있다.
HER2는 서열번호 1의 아미노산 서열을 가지는 세포막 관통 단백질로 protein tyrosine kinase 활성을 지니는 세포 내 도메인(intracellular domain: ICD, HER2 aa 676-1255), 막 횡단 도메인(transmembrane domain: TM, HER2 aa 653-675) 및 세포 밖 도메인(extracellular domain: ECM, HER2 aa 22-652)으로 구성되어 있다.
유방암에서의 HER2는 상당히 광범위하게 연구되어 왔으며, 수 개의 면역원성 펩타이드가 발굴되어 있다. 예를 들자면, HER2 단백질의 아미노산 369-377의 펩타이드(nelipepimut-S [NeuVax; HER2 aa369-377; E75 (NP-S)])의 경우 수지상 세포에 로딩 후 재주입되거나 하는 등의 면역 치료를 시도하였으나, 진행된 상태의 유방암을 가지는 여성에서 임상적으로 유의한 치료 또는 보호 효과가 보고되지는 않았다. 게다가 최근 대규모 임상 3상에서 무질병생존률(Disease Free Survival:DFS)에 있어서 위약군과 차이가 없어 임상실험이 중단된 바 있다.
또다른 HER2 펩타이드 백신의 예로서 HER2-ICD 펩타이드 백신인 AE37(LRMK-GVGSPYVSRLLGICL: LRMK-HER2 aa 776-790)), HER2-TM 펩타이드 백신인 GP2(HER2 aa 654-662) 등이 존재하고, 이들 백신으로 인해 생존률이 증가한다는 효과가 일부 보고된 바 있다. 또한 HER2-ICD 단편(이하 ‘HER2-ICD’라 함)에 대한 백신이 HER2-ECD 단편(이하 ‘HER2-ECD’라 함)에 대한 백신에 비해 종양의 크기가 줄어든다는 것을 동물실험에서 보고된 바 있으나, HER2-ICD DNA 백신을 직접적으로 유방암 환자에 적용한 결과는 보고된 바 없다.
질병 치료 목적의 DNA 백신은 장기 면역원성을 유도할 수 있는 기능을 가져야 할 뿐만 아니라, 대상체에 부담을 주지 않는 방법으로 장기 면역원성 생성을 모니터링하는 것이 중요하다. 장기면역성과 관련하여 플라스미드 벡터를 전달체로 사용하는 DNA 백신의 경우 체내 지속 기간이 길수록 항원 생산이 지속되므로, 장기 면역원성 생성에 이점이 있을수 있으나, 대상체에서 불필요하게 DNA 플라스미드 벡터에 대한 면역반응이 일어날 수 있다는 단점이 있다. 하지만, 아직까지는 DNA 백신의 장기 면역원성과 관련하여 실제 대상체에서 모니터링을 하면서 관찰하고 확인한 바 없다.
[선행기술문헌]
[특허문헌]
대한민국 등록특허 10-1572474호(공고일: 2015. 11. 30.)
미국 공개특허 US 2002/0193329(공개일: 2002. 12. 19.)
[비특허문헌]
Breast Care 2016; 11:116-121
Clin Cancer Res; 25(14) July 15, 2019
이에 본 발명자들은 상기 문제를 해결하고자 연구를 수행한 결과, HER2-ICD를 암호화하는 핵산 서열을 포함하는 플라스미드를 포함하는 DNA 백신 조성물이 유방암 환자에서 부작용 없이 안정적으로 HER2-ICD에 대한 면역원성을 높일 수 있을 뿐 아니라, 상기 백신 조성물의 장기 면역원성을 모니터링할 수 있음을 확인하여 본 발명을 완성하였다.
본 발명은 DNA 백신 접종 환자에서 접종 완료 후 적어도 1달 이후에 말초혈액단핵구(PBMC)에서 백신 항원에 대한 특이 면역반응의 정도를 모니터링함으로써, DNA 백신 조성물의 장기 면역원성을 모니터링하는 방법을 제공한다.
추가적으로, 본 발명은 DNA 백신 접종 환자의 백신 접종 전후 말초혈액단핵구(PBMC)에서 중심 기억 T 세포(central memory T 세포)의 비율을 확인하여, DNA 백신의 장기 면역원성을 모니터링하는 방법을 제공하는 것을 목적으로 한다.
추가적으로, 본 발명은 DNA 백신을 접종받은 환자의 접종 부위에서 백신 접종 완료 후 백신 DNA 존재 여부를 확인함으로써, DNA 백신의 장기 면역원성을 모니터링하는 방법을 제공하는 것을 목적으로 한다.
상기 목적을 달성하기 위해, 본 발명은 DNA 백신을 접종받은 환자의 접종 부위에서 백신 접종 완료 후 DNA 백신의 장기 면역원성을 모니터링하는 방법을 제공한다.
본 발명의 일 구현예에 따라, 상기 DNA 백신은 접종 완료 후 적어도 한달 이후에 말초혈액단핵구(PBMC)에서 백신 항원에 대한 특이 면역반응의 정도를 모니터링함으로써 DNA 백신 조성물의 장기 면역원성을 모니터링 할 수 있다.
본 발명의 일 구현예에 따라, 추가적으로 DNA 백신 접종 환자의 백신 접종 전후 말초혈액단핵구(PBMC)에서 중심기억세포(central memory T 세포)의 비율을 확인하여 DNA 백신의 장기 면역원성을 모니터링 할 수 있다.
또한, 본 발명의 일 구현예에 따라, 상기 DNA 백신은 피내(intradermal)에 접종하고, 접종 부위의 피부생검 조직에서 백신 DNA의 존재 여부를 확인할 수 있다.
또한, 본 발명의 일 구현예에 따라, 상기 백신 DNA의 존재 여부를 확인하는 시기는 백신 접종이 완료된 후 1달 내지 3달 중 임의로 선택될 수 있다.
본 발명에 따른 모니터링 방법은 환자에게 큰 부담 없이 DNA 백신의 장기면역원성을 지속적으로 모니터링 할 수 있으므로, 백신을 접종한 환자에 있어, DNA 백신에 의한 면역원성 획득의 예측을 용이하게 하고 추가 접종 (boosting immunization, Boosting shot)의 시기를 찾을 수 있다는 장점이 있다.
도 1은 Arm 2 환자군에서의 백신 접종 전후의 PBMC에서 중심 기억 T 세포의 비율을 분석한 결과이다.
도 2는 Arm 2 환자 군에서 중심 기억 T 세포에서의 HER2-ICD에 대한 면역원성을 분석한 결과이다(도 2A: CD4+ T 세포, 도 2B: CD8+ T 세포)
이하, 본 발명을 더욱 상세히 설명한다.
본 명세서에서 사용된 바와 같은 단수 형태(“a”, “an” 및 “the”)는 문맥에서 달리 명확하게 지시되지 않는 한 복수의 대상을 포함한다.
본 개시내용의 특정의 특성을 기술하고 청구함에 있어서, 다음의 용어는 달리 지정되지 않는 한 이하에 기술된 정의에 따라 사용될 것이다.
본원에서 어떤 양태들이 “~를 포함하는”이란 용어와 함께 기술되더라도, “~로 구성된” 및/또는 “본질적으로 ~로 구성된”의 관점에서 기술된 다른 유사 양태들도 또한 제공된다는 것이 이해되어야 한다.
용어 “예방하다”는, 임상적 완화 상태의 환자를 방사선 또는 물리적 방법 등으로 검사했을 때, 유방암 재발(recurrence/relapse)을 막은 성공 또는 성공의 징후를 언급한다.
용어 “재발이 없는”은 임상적 완화 상태의 환자를 방사선 또는 물리적 방법 등으로 검사했을 때, 유방암 또는 다른 부위에 암 재발이 없는 상태를 의미한다.
따라서 용어 “재발(recurrence, relapse)”또는 “재출현(resurgence)”은 본 명세서에서 상호교환적으로 사용되며, 유방암 치료에 의한 개선, 완화 또는 관해(remission) 기간 후 유방암 또는 다른 부위로의 암 발생에 대한 징후 또는 증상을 의미한다.
용어 “유방암이 없는(free of breast cancer)”, “질환이 없는 (disease free)”, “완전관해(complete remission)” 또는 “질환의 증거가 없음(No Evidence of Disease; NED)”는 환자가 현재 표준 의료 요법에 의한 임상적 완화 상태에 있는 것을 의미한다. 이 경우 비록 암세포가 신체에 여전히 존재할 수 있지만, 유방암의 임상적 징후, 방사선학적 징후 및 증상이 임상 진단에 기초할 때 상당히 감소되거나 완전히 사라진 것을 의미한다. 따라서, 완화는 부분적 및 완전한 완화를 포함하는 것으로 의미한다.
본 명세서에서 상기 “보호 면역” 또는 “보호 면역반응”은 대상체가 HER2-ICD 항원에 대해 면역반응을 개시하여 대상체의 면역계가 동일 항원을 발현하는 세포를 표적화하고 파괴할 수 있어 대상체에서 암 재발 또는 암 진행을 감소시키는 것을 의미한다. 본 발명에서 보호 면역은 T 림프구에 의해 부여되지만, 이에 제한되지 않는다.
본 명세서에서는 백신 투여 전(베이스라인: baseline), 후, 대상체의 말초혈액단핵구(Perpheral Blood Mononuclear Cell: PBMC)가 HER2-ICD에 의해 자극받아 생산하는 IFN-γ의 양을 엘리스팟법(Enzyme-linked immuno-spot assay: ELISpot)에 의해 측정하였을 때, 베이스라인에 비해 HER2-ICD 특이적인 IFN-γ 생산이 2배 이상인 경우 HER2-ICD 특이적인 T 세포 반응이 증가한 것으로 간주하였다.
용어 “부스터”는 보호 면역을 증진, 연장 또는 유지하고 조절 T-세포에 의해 매개되는 T-세포 반응의 하향-조절을 극복하기 위해 환자에게 투여되는 일정 용량의 면역원을 언급한다.
용어 “약제학적으로 허용되는”은 조성, 제형, 안전성 등에 대해 약리학적/독성학적 관점으로부터 환자에게 허용되는 물질을 의미하고, “약제학적으로 허용되는 담체”는 활성 성분(들)의 생물학적 활성의 효과를 방해하지 않는 매질을 언급하며, 투여 시 대상체에 무독성이다.
용어 “약”은, 측정가능한 값, 예를 들어 중량, 지속 기간 등을 언급하는 경우, 구체화된 값으로부터 ±20%, ±10%, ±5%, ±1%, 또는 ±0.1%의 변화를 의미할 수 있지만, 이에 제한되지 않고 기술된 방법을 수행하기에 적합한 변화를 포함하는 것으로, 반응성에 영향을 주지 않는 범위를 의미한다.
용어 “환자” 또는 “대상체”란, 본 발명의 백신 조성물의 투여에 의해 질환이 예방 또는 치료될 수 있는 병태, 예컨대 유방암을 앓고 있거나, 치료되었거나, 그러한 병태에 걸리기 쉬운, 살아있는 유기체를 지칭하며, 인간과 동물을 둘 다 포함한다. 대상체로서는 포유동물(예컨대, 마우스, 원숭이, 말, 소, 돼지, 개, 고양이 등)을 포함하나, 이에 한정되는 것은 아니며, 바람직하게는 인간이다. 또한, 본 발명에서의 “환자” 또는 “대상체”는 구분하지 않고 유방암 환자, 또는 HER2를 발현하는 유방암 환자를 포함한다.
용어 “투여하는 것”이란, 이 발명이 속하는 기술분야에서 공지된 다양한 방법과 전달 시스템 중 임의의 것을 사용하여 백신 조성물을 대상체에 도입하는 것을 지칭한다. 예시적 투여 경로는 정맥내, 근육내, 피하, 복강내, 척수 또는 기타 다른 비경구 투여 경로, 예컨대 주사 또는 주입에 의한 투여 경로를 포함한다. 본 발명의 명세서에 사용된 “투여”란, 일반적으로 주사에 의한 피내(intradermal) 투여 방식을 의미하고, 정맥내, 근육내, 동맥내, 척수강내, 또는 림프내 주사 및 주입을 포함하나, 이에 한정되는 것은 아니다. 기타 다른 비경구 경로로서는 국소, 상피 또는 점막 투여 경로, 예컨대 비내, 질, 직장, 또는 설하 경로를 포함한다. 본 명세서에서는 대상체에 “백신 투여(vaccine injection)”, “처치(treatment)“와 “접종(vaccination)”은 구분되지 않고 사용된다.
본 발명에서, 용어 “면역 항암제”는 암 자체를 공격하는 기존 항암제와는 달리 인공면역 단백질을 체내에 주입하여 면역체계를 자극함으로써 면역세포가 선택적으로 암 세포만을 공격하도록 유도하는 치료약제로서, 암세 포가 획득한 면역억제 또는 면역회피 기전을 극복하기 위하여 면역체계의 종양 인지능력 또는 파괴능력을 회복 또는 강화시키는 기전의 항암제이다. 상기 면역항암제는 면역관문 억제제, 면역세포 치료제 및 면역바이러스 치료제를 포함하지만 이에 제한되지는 않는다.
본 발명에서, 용어 “면역관문 억제제”는 일부 암세포가 체내 면역세포인 T 세포의 면역체크포인트를 활용하면서 면역을 회피하는 경우에, T 세포 억제에 관여하는 면역체크포인트 단백질(Immune Checkpoint Protein)의 활성화를 차단하여 T 세포를 활성화시켜 암세포를 공격하는 작용을 하는 면역항암제의 일종으로서, CTLA-4 억제제, PD-1 억제제, LAG-3 억제제, TIM-3 억제제, TIGIT 억제제 및 VISTA 억제제를 포함하지만 이에 제한되지는 않는다. 또한, 상기 면역관문 억제제는 길항제로서, 길항제 항체 또는 소분자 화합물일 수 있다.
본 명세서에 개시된 조성물은 DNA 백신으로 제조된다. 본 발명의 일부 실시예에서, DNA 백신은 프로모터(promoter), 적절한 전사 및 번역 제어 요소 및 본 발명의 하나 또는 그 이상의 폴리펩타이드를 암호화하는 핵산 서열을 갖는 플라스미드를 포함한다. 일부 실시예에서, 상기 플라스미드는 추가적으로 증강(enhance) 서열, 예를 들어, 발현 수준, 세포 내 표적화 등을 증강하는 서열을 포함할 수 있다.
본 발명의 백신 조성물의 항원은 HER2 유전자의 aa 676-1255의 세포 내 도메인(intracellular domain: ICD) (HER2-ICD)이다. 상기 HER2-ICD의 폴리펩타이드 서열은 서열번호 2의 아미노산 서열과 100% 상동성을 가지거나, 그렇지 않은 경우, 99% 이상, 95% 이상, 90% 이상, 85% 이상, 또는 80% 이상의 상동성을 가질 수 있다. 단 상기 특정 수치로 한정된 상동성을 가지는 경우 백신 접종으로 인한 HER2-ICD에 대한 면역원성은 100% 상동성을 지니는 서열과 동일 또는 균등한 효과를 갖는다.
본 발명의 일부 실시예에서는, DNA 백신은 본 발명의 HER2-ICD를 암호화하는 핵산 서열을 포함하는 플라스미드 벡터를 포함한다. 일부 실시예에서 상기 플라스미드는 pUMVC3(종래 명칭은 ‘pNGVL3’이므로, 두 명칭은 혼용될 수 있음) 플라스미드이다. 상기 HER2-ICD를 암호화하는 핵산 서열은 서열번호 3의 핵산 서열과 100% 상동성을 가지거나, 그렇지 않은 경우, 99% 이상, 95% 이상, 90% 이상, 85% 이상, 80% 이상의 상동성을 가질 수 있다. 단 상기 특정 수치로 한정된 상동성을 가지는 경우 백신 접종으로 인한 HER2-ICD에 대한 면역원성은 100% 상동성을 지니는 서열과 동일 또는 균등한 효과를 갖는다.
본 발명의 일부 실시예에서, DNA 백신은 백신의 효력을 강화하거나, 면역시스템을 자극하거나 또는 면역억제를 감소시키는 것과 같은 생성된 면역반응을 조절하는 면역조절분자(immunomodulatory molecules)를 추가적으로 암호화할 수 있다.
본 발명의 일부 실시예에서 HER2-ICD DNA 백신 조성물이 투여되는 환자군은 3기 또는 4기 유방암 환자군으로서, HER2를 발현하는 환자군이다. 환자 각각은 유방암 표준치료를 마친 후 완전 관해(complete remission) 상태이거나, 4기 유방암 환자군에서는 안정적인 골 전이(stable bone only diseas: SBO)만 허용되었다.
본 발명에서 백신 조성물은 유방암 재발에 대해 보호 면역을 유도 및/또는 유지하는 것이 목적이므로, 본 발명에서는 HER2-ICD에 대한 세포독성 T 세포 반응을 유도 및/또는 유지하기에 적합한 임의의 스케줄로 본 발명의 백신 조성물을 환자에게 투여할 수 있다. 예를 들어, 일차 예방접종으로서 본 명세서에서 기술되고 예시되는 바와 같은 백신 조성물을 일정 스케줄로 환자에게 투여한 후, 보호 면역을 유도 및/또는 유지하기 위해 부스터를 투여할 수 있다.
본 발명의 일부 실시예에서, 백신 조성물은 1개월 당 1회, 2회 또는 그 이상의 횟수로 환자에게 투여될 수 있다. 부스터는 접종 스케줄을 마친 후 일정 간격으로, 예를 들어 1개월의 간격으로 단수 또는 복수 회 투여될 수 있고, 6개월 이상의 기간을 가지고 단수 또는 복수 회 투여될 수 있다. 본 발명의 일부 실시예에서 일차 접종으로 매달 1회씩 3회 HER2-ICD 백신을 투여하였으나, 6개월 또는 1년 후에 추가적인 부스터를 접종할 수 있다.
이때 부스터는 일차 접종 시 사용한 백신 조성물과 동일한 용량 및 구성일 수도 있고, 용량 및/또는 구성이 변경될 수도 있다.
용어 “용량”은 대상체에 일회 투여하는 백신 조성물의 유효성분(HER2-ICD 플라스미드 DNA)의 총량을 의미한다. 본 발명의 일부 실시예에서는 HER2-ICD DNA 백신 조성물의 투여 용량을 각 Arm(22명 환자군)당 10㎍, 100㎍ 및 500㎍의 세가지 Arm으로 선정하여 투여하였다. 각 Arm에서는 모두 백신 투여에 의해 HER2-ICD에 대한 면역원성이 증가하는 것을 관찰했으며, 각 Arm에서 발생한 백신과 관련된 부작용들은 모두 Grade 1, 2이고(극히 낮은 등급), Grade 3-5의 심각한 부작용은 발견되지 않았다. 부작용과 관련하여 각 Arm들 간에 통계적으로 유의적인 차이는 없었다.
놀랍게도 본 발명의 백신 조성물을 투여한 환자군에서는 HER2-ECD에 대한 면역원성을 증가시킬 수 있었다. 본 발명의 DNA 백신 조성물은 HER2-ICD를 항원으로 하는 백신으로 HER2-ECD 또는 펩타이드의 서열과는 상이하나, 본 발명의 백신 조성물을 투여한 환자군 특히 Arm 2, Arm 3 환자군에서 HER2-ECD에 대한 면역반응성도 증가되어 있었다.
이러한 효과들을 미루어 볼 때 본 발명의 백신 조성물은 HER2-ICD에 대한 면역반응성이 백신 투여가 끝나도 장기적으로 지속된다는 것을 확인하였고, 유방암 치료로 관해 상태인 환자군에서 유방암 재발 또는 전이를 예방하는데 있어 우수한 효과를 가질 것이다.
본 발명의 백신 조성물에 있어서, 1회 투여되는 백신에 포함된 HER2-ICD의 플라스미드 DNA의 총량은 10㎍ 내지 1000㎍, 20㎍ 내지 1000㎍, 30㎍ 내지 1000㎍, 40㎍ 내지 1000㎍, 50㎍ 내지 1000㎍, 60㎍ 내지 1000㎍, 70㎍ 내지 1000㎍일 수 있고, 10㎍ 내지 900㎍, 20㎍ 내지 900㎍, 30㎍ 내지 900㎍, 40㎍ 내지 900㎍, 50㎍ 내지 900㎍, 60㎍ 내지 900㎍, 70㎍ 내지 900㎍일 수 있고, 10㎍ 내지 800㎍, 20㎍ 내지 800㎍, 30㎍ 내지 800㎍, 40㎍ 내지 800㎍, 50㎍ 내지 800㎍, 60㎍ 내지 800㎍, 70㎍ 내지 800㎍일 수 있고, 10㎍ 내지 700㎍, 20㎍ 내지 700㎍, 30㎍ 내지 700㎍, 40㎍ 내지 700㎍, 50㎍ 내지 700㎍, 60㎍ 내지 700㎍, 70㎍ 내지 700㎍일 수 있고, 10㎍ 내지 600㎍, 20㎍ 내지 600㎍, 30㎍ 내지 600㎍, 40㎍ 내지 600㎍, 50㎍ 내지 600㎍, 60㎍ 내지 600㎍, 70㎍ 내지 600㎍일 수 있고, 10㎍ 내지 500㎍, 20㎍ 내지 500㎍, 30㎍ 내지 500㎍, 40㎍ 내지 500㎍, 50㎍ 내지 500㎍, 60㎍ 내지 500㎍, 70㎍ 내지 500㎍일 수 있고; 10㎍ 내지 900㎍, 10㎍ 내지 800㎍, 10㎍ 내지 700㎍, 10㎍ 내지 600㎍, 10㎍ 내지 500㎍, 10㎍ 내지 400㎍, 10㎍ 내지 300㎍일 수 있고, 20㎍ 내지 900㎍, 20㎍ 내지 800㎍, 20㎍ 내지 700㎍, 20㎍ 내지 600㎍, 20㎍ 내지 500㎍, 20㎍ 내지 400㎍, 20㎍ 내지 300㎍일 수 있고, 30㎍ 내지 900㎍, 30㎍ 내지 800㎍, 30㎍ 내지 700㎍, 30㎍ 내지 600㎍, 30㎍ 내지 500㎍, 30㎍ 내지 400㎍, 30㎍ 내지 300㎍일 수 있고, 40㎍ 내지 900㎍, 40㎍ 내지 800㎍, 40㎍ 내지 700㎍, 40㎍ 내지 600㎍, 40㎍ 내지 500㎍, 40㎍ 내지 400㎍, 40㎍ 내지 300㎍일 수 있고, 50㎍ 내지 900㎍, 50㎍ 내지 800㎍, 50㎍ 내지 700㎍, 50㎍ 내지 600㎍, 50㎍ 내지 500㎍, 50㎍ 내지 400㎍, 50㎍ 내지 300㎍일 수 있다.
1회 투여되는 백신에 포함된 HER2-ICD의 플라스미드 DNA의 총량이 1㎍ 이하면 목적하는 면역반응이 일어나지 않을 수 있고, 1000㎍ 초과인 경우 주사 부위 과민반응이나 면역 관용(immune tolerance)이 일어나서 면역력이 오히려 감소할 수 있다.
DNA 백신 접종에 있어서, 장기면역원성은 무엇보다 중요한 인자이다. DNA 백신 접종 완료 후에 장기면역원성을 가지는 경우 지속적인 면역반응에 의한 치료 또는 예방 효과가 일어날 수 있지만, 장기면역원성을 가지지 못하는 경우 면역반응이 제대로 일어나지 못하게 되고, 면역반응을 활성화하기 위해 부스팅 등 면역원성 획득을 위한 추가 백신을 접종하거나, 최종적으로 치료 방법을 바꿔야 하는 경우가 있다.
따라서, 환자에게 큰 부담 없이 지속적으로 DNA 백신의 장기면역원성을 모니터링하여는 것은 중요하다.
본 발명의 일실시예에서는 HER2-ICD DNA 백신 접종 전·후 백신 항원에 대한 면역반응성을 말초혈액단핵구(PBMC)에서 측정하여, HER2-ICD에 대한 면역반응성이 증가되고 유지하는 것을 확인함으로써 장기 면역원성을 모니터링하였다.
백신 접종 완료 후 적어도 한달 이후에 대상체의 PBMC를 분리하여 HER2-ICD에 대한 면역반응을 엘리스팟법에 의해 측정하였다. 그 결과 백신 접종 전(baseline)에 비해 HER2-ICD에 대한 면역반응성이 증가한 환자군에서 HER2-ICD에 대한 면역원성이 장기적으로(long term follow-up: LTFU, 백신 접종완료 12개월 시점) 높은 수준으로 유지되어 있는 것을 확인하여 백신 접종 완료 후 적어도 1달 이후에 측정된 백신 항원의 면역원성의 정도가 장기 면역원성을 예정하는데 중요한 인자임을 확인하였다.
상기 백신 접종 완료 후 PBMC에서의 면역원성을 측정하는 시점은 백신 접종 완료 후 1개월, 2개월 또는 3개월일 수 있고, 또는 1개월 내지 3개월 중 선택되는 임의의 시점일 수 있다.
DNA 백신에 있어서, DNA(플라스미드 DNA)는 백신 투여 부위에서 세포를 형질 감염시켜 목적하는 항원을 생산할 수 있도록 하는 지속적인 원천으로 작용한다. 따라서, 백신 투여 부위에 DNA가 장기간 지속적으로 존재하는 경우 항원을 지속적으로 생산할 수 있으므로, 항원 특이 면역력을 유지하는데 도움이 될 것이라 생각되지만, 이와는 반대로 환자의 체내에 이종 물질인 DNA 전달체인 플라스미드 DNA 벡터가 오랜 기간 지속된다면 대상체에서는 플라스미드 DNA 벡터 자체에 대한 면역반응을 야기할 수 있다.
이와 관련하여 백신 부위의 DNA 지속성이 지속적인 항원 특이 면역의 개발 및 유지에 도움이 되는지 여부는 알려져 있지 않다.
본 발명에서는 백신 투여 부위에서 DNA 지속성과 HER2-ICD 면역반응 사이의 연관성을 선형 회귀모델을 통해 분석하였다.
본 발명의 일 실시예에서는 백신 접종 완료 시점을 기준으로 1달 후 백신 투여 부위의 생검을 통해 피부 조직을 분리하여 PCR법을 통해 벡터 DNA를 증폭한 결과, 31명의 환자에서는 벡터 DNA가 검출되었고, 21명의 환자에서는 검출되지 않았다. 환자 각각의 PBMC에서 HER2-ICD에 의한 IFN-γ 생산량을 엘리스팟법에 의해 분석한 결과, 벡터 DNA가 검출되지 않은 21명의 환자군은 벡터 DNA가 검출된 환자에 비해 HER2-ICD에 대한 면역반응성이 증가하는 경향을 보였고, 특히 LTFU(백신 접종 완료 12개월 시점)에서의 면역반응성이 유의하게 차이를 보이는 것을 확인하였다.
놀랍게도, 이러한 면역반응원성의 차이는 HER2-ICD에 국한되었고, 파상풍 톡소이드(음성 대조군)에 대한 면역반응원성은 차이가 없는 것으로 보아, HER2-ICD DNA 백신 특이적인 것으로 보인다. 따라서, DNA 백신접종을 피내에 하는 경우 백신 DNA가 일정 기간 동안만 지속되는 경우 더 높은 면역반응을 일으키고, 이와 같은 기전은 DNA 면역 접종 시 장기 면역원성을 예측할 수 있는 마커로 사용될 수 있을 것이다.
본 발명의 백신 조성물의 접종 부위 내 지속성을 검출하기 위해 벡터 DNA 존재 여부를 검사하는 시점은 최종 백신 접종 후 1개월, 2개월, 3개월, 또는 1개월 내지 3개월 중 선택되는 임의의 시점일 수 있다.
DNA 백신의 장기 면역원성은 백신 접종 전후의 PBMC에서 중심 기억 T 세포(central memory T cell: CMT 세포)의 비율을 확인하는 방법에 의해서도 모니터링될 수 있다.
DNA 백신에 있어 백신 항원에 의해 활성화된 T 세포가 클론 확장(clonal expansion)과 효과기 세포(effector cells)로의 분화가 유도되어 백신에 의한 보호효과를 보이게 된다. 하지만, 더 이상 공격할 대상이 없어지면 활성화된 T 세포들은 제거됨과 동시에 중심 기억 T 세포(Central memory T cells: CMT 세포)를 포함하는 기억 T 세포(memory T cells)로 분화한다.
본 발명에서는 백신 접종 전과 접종 후 60주에서 PBMC에서 CMT 세포의 비율을 분석하였다. 놀랍게도 백신 접종 60주 후에도 CMT 세포(CD4+, CD8+ 세포)의 비율이 증가하였고, 특히 CD4+ CMT 세포, CD8+ CMT 세포 모두 증가된 HER2-ICD에 대한 면역반응과 유의한 상관관계가 있다는 것을 확인하였다.
따라서, DNA 백신 접종 전후 PBMC에서 CMT 세포(CD4+, CD8+ 세포)의 비율을 분석하여 CMT 세포의 비율이 증가하는 경우 DNA 백신의 장기 면역원성을 나타낸다고 예측할 수 있을 것이다.
본 발명의 명세서에 기재된 백신 조성물은 HER2-ICD를 암호화하는 DNA를 포함하는 플라스미드 외에 약학적으로 허용되는 부형제(excipient), 담체, 희석제, 버퍼(buffer), 안정제(stabilizer), 보존제, 애주번트(adjuvant) 또는 이 발명이 속하는 기술분야에 잘 알려진 기타 물질을 포함할 수 있다. 이러한 물질은 비독성이고 유효 성분(들)의 약학적 활성을 방해하지 않는다. 약제학적 담체 또는 희석제는 예를 들어 수용액일 수 있다. 본 발명의 백신 조성물에 포함될 수 있는 담체 또는 다른 물질은 투여 경로(예를 들어 경구, 정맥, 피부 또는 피하, 코, 근육, 피내 및 복강 투여)에 따라 다르게 선택될 수 있다.
본 발명의 백신 조성물은 하나 또는 그 이상의 “약제학적으로 허용되는 담체”를 포함할 수 있다. 이들은 전형적으로 단백질, 당류(saccharides), 폴리락트산(polylactic acids), 폴리글리콜산(polyglycolic acids), 폴 리머릭(polymeric) 아미노산, 아미노산 공중합체, 수크로오스(sucrose), 트레할로스(trehalose) 등이 속한다. 이러한 담체는 이 발명이 속하는 기술분야에 잘 알려져 있다. 백신 조성물은 또한 물, 식염수, 글리세롤 등과 같은 희석제를 함유할 수 있다. 또한, 습윤제 또는 유화제, pH 버퍼 물질 등과 같은 보조 물질이 존재할 수 있다. 무균 발열원이 없는 인산염 버퍼 생리식염수, 트로메타민(트리스)이 대표적인 담체이다.
본 발명의 일 양태는 유효 성분으로서 하나 또는 그 이상의 플라스미드 DNA를 포함하는 상기 기재된 바와 같은 백신 조성물, 또는 키트에 관한 것이다. 이들은 대상에 면역반응을 유도하거나, 치료, 백신접종(vaccinating) 또는 면역요법을 제공하는 방법에 사용하기 위한 것일 수 있으며, 백신 조성물은 백신 또는 면역치료 조성물일 수 있다. 이러한 치료 또는 백신 접종은 대상체에 본 발명의 백신 조성물을 투여하는 것을 포함한다. 상기 백신 조성물은 정해진 스케줄로 대상체에 투여될 수 있다.
본 발명의 백신 조성물은 동결건조되거나 수성 형태(aqueous form)일 수 있다, 예를 들어 수용액 또는 현탁액 일 수 있다. 이러한 유형의 액체 제제(Liquid formulations)는 조성물이 수성 매질(aqueous medium)에서 재구성(reconstitution) 할 필요없이 포장된 형태로 직접 투여할 수 있으므로 주사에 이상적이다. 백신조성물은 바이알(vials)로 제공될 수 있거나 또는 미리 충전된 주사기로 제공될 수 있다. 주사기는 바늘과 함께 또는 바늘없이 공급될 수 있다. 주사기는 단일 용량을 포함하는 반면, 바이알은 단일 용량 또는 다수의(multiple) 용량을 포함할 수 있다. 또한, 본 발명의 백신 조성물은 마이크로니들을 이용하여 투여될 수 있다.
또한, 본 발명의 백신 조성물은 지연 방출 비히클 또는 데포(depot) 제제로 제형화될 수 있다. 이러한 장기간 작용 제형은 접종 또는 이식(예를 들어 피하 또는 근육내)에 의하거나 주사에 의해 투여될 수 있다. 따라서, 예를 들어, 백신 조성물은 적합한 중합체성 또는 소수성 물질(예를 들어, 허용되는 오일 중의 에멀젼) 또는 이온 교환 수지와 함께, 또는 난용성 유도체(예를 들어 난용성 염)으로서 제형화될 수 있다. 리포좀 및 에멀젼은 담체로서 사용하기에 적합한 전달 비히클로서 널리 알려진 예이다.
본 발명의 백신 조성물은 다수의(multiple) 투여 포맷(multiple dose format)으로 포장될 때 항균제(antimicrobial)를 포함할 수 있다. 항균제로는 2-페녹시에탄올(2-phenoxyethanol) 또는 파라벤(parabens)(메틸, 에틸, 프로필 파라벤) 등에서 선택될 수 있다. 임의의 보존제는 바람직하게는 낮은 수준으로 존재한다. 보존제는 외인성으로 첨가될 수 있고 및/또는 조성물을 형성하기 위해 혼합되는 벌크 항원의 성분일 수 있다.
본 발명의 백신 조성물은 설명서 등을 포함하는 키트 형태로 제공될 수 있다.
본 발명의 백신 조성물은 조성물의 면역원성을 증가시키기 위해, 하나 또는 그 이상의 애주번트(adjuvant)를 포함할 수 있다.
상기 적합한 애주번트(adjuvant)는 수산화알루미늄 또는 인산 알루미늄과 같은 알루미늄염을 포함하지만, 칼슘, 철 또는 아연의 염일 수 있거나 또는 아실화 티로신 또는 아실화 당의 불용성 현탁액일 수 있거나, 또는 양이온 또는 음이온적으로 유도된 당류 등에서 선택될 수 있으나, 이에 제한되지 않는다. 또한, 애주번트에는 면역조절제로 사용되는 사이토카인이 포함될 수 있다.
상기 면역조절제로 사용하기 적합한 사이토카인은 인터루킨(interleukin)(예를 들어, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12, 등), 대식세포 콜로니 자극 인자(macrophage colony stimulating factor, M-CSF), 종양 괴사 인자(tumour necrosis factor, TNF), 과립구 대식세포 콜로니 자극 인자(granulocyte, macrophage colony stimulating factor, GM-CSF) 등에서 선택될 수 있지만, 이에 제한되지 않는다.
본 발명의 일실시예에서는 애주번트로 GM-CSF를 포함할 수 있다.
상기 애주번트는 1회 용량당 0.075mg 내지 0.2mg, 또는 0.08mg 내지 0.12mg의 양으로 첨가될 수 있다.
본 발명의 백신 조성물은 화학 항암제, 표적 항암제 및 면역 항암제 중 선택되는 하나 이상의 항암제와 병용투여할 수 있다. 본 발명의 백신 조성물과 병용투여될 수 있는 화학 항암제, 표적 항암제 및 면역 항암제 중 선택되는 하나 이상의 항암제는 상호 동시에 또는 시간 차를 두고 순차적으로 투여될 수 있으며, 적절한 시간 및 주기에 따라 선택될 수 있다.
본 발명에 있어서, 화학 항암제는 세포독성항암제, 화학약물항암제로도 불린다. 상기 화학항암제는 예를 들면, 젬시타빈(Gemcitabine)(제시타빈주), 사이타라빈(Cytarabine), 카르보플라틴(Carboplatin)(파라플라틴), 시스플라틴 (Cisplatin)(플라티놀, 플라티놀-AQ), 크리조티닙(Crizotinib)(잘코리), 시클로포 스파미드(Cyclophosphamide)(시톡산, 네오사르), 도세탁셀(Docetaxel)(탁소티어), 독소루비신(Doxorubicin)(아드리아마이신), 에토포사이드(Etoposide)(베페시드), 플루오로우라실(5-fluorouracil, 5-FU), 이리노테칸(irinotecan)(캄토사르), 리포좀-캡슐화된 독소루비신(독실), 메토트렉세이트(Methotrexate)(폴렉스, 멕세이트, 아메토프테린), 파클리탁셀(Paclitaxel)(탁솔, 아브락산), 토포테칸(Topotecan)(하 이캄틴), 트라벡티딘(Trabectedin)(욘델리스), 빈크리스틴(Vincristine)(온코빈, 빈카사르 PFS) 또는 빈블라스틴(Vinbrastine)(벨반) 등이 있지만, 이에 제한되지 않는다.
본 발명에 있어서, 표적 항암제는 트라메티닙(Trametinib), 베무라페닙(vemurafenib), 알페리십(alpelisib), 닥톨리십(dactolisib), 게피티닙 (Gefitinib), 엘로티닙(Erlotinib), 라파티닙(Lapatinib), 수니티닙(Sunitinib), 소라페닙(Sorafenib), 크리조티닙(Crizotinib), 다브라페닙(Dabrafenib), 트라스투 주맙(Trastuzumab), 세툭시맙(Cetuximab), 베바시주맙(Bevacizumab), 파니투무맙 (Panitumumab), 이필리무맙(Ipilimumab), 퍼투주맙(Pertuzumab), 토파시티닙 (Tofacitinib), 이마티닙(Imatinib), 보르테조밉(Bortezomib), 오파투무맙 (Ofatumumab) 및 알렘투주맙(Alemtuzumab)으로 이루어진 군으로부터 선택되는 하나 이상의 표적 치료제일 수 있지만, 이에 제한되지 않는다.
본 발명에 있어서, 상기 면역 항암제는 CTLA-4(cytotoxic Tlymphocyte-associated protein 4), PD-1(Programmed cell death protein 1), LAG3(Lymphocyte Activation Gene-3), TIM-3(T-cell Immunoglobulin and Mucin-domain containing-3), TIGIT(T-cell Immunoreptor with IG and ITIM domain) 및 VISTA(Vdomain Ig Suppressor of T cell Activation)로 구성된 군으로부터 선택된 어느 하나에 대한 면역관문 억제제(immune checkpoint inhibitor)일 수 있으나, 이에 제한 되지 않는다.
본 발명에 있어서, 상기 조성물은 항암 보조제를 추가로 포함할 수 있고, 보다 바람직하게는 상기 항암 보조제는 STING(STimulator of InterferoN Gene) 아고니스트일 수 있으나 이에 제한되지는 않는다.
본 발명의 일부 실시예에서는 HER2-ICD DNA 백신 조성물의 투여는 다른 암 치료제에 의한 치료와 동시에 진행될 수 있다. 상기 암 치료제는 유방암 치료에 표준적으로 사용되는 플루오로우라실, 독소루비신, 파클리탁셀 등의 항암제, HER2에 대한 항체 치료제인 트라스투주맙(Trastuzumab, Herceptin®), ER(Estrogen receptor) 표적치료제인 타목시펜(tamoxifen) 또는 비스포스포네이트가 사용될 수 있지만, 이에 제한되지 않는다.
달리 나타내지 않는 한, 본 명세서 및 청구범위에 사용된 모든 숫자는, 언급되었든지 아니든지, 모든 경우에 용어 “약”에 의해 수식될 수 있는 것으로 이해되어야 한다. 또한, 본 명세서 및 특허청구범위에 사용된 정밀한 수치는 본 개시내용의 추가적인 실시양태를 형성하는 것으로 이해되어야 한다. 실시예에 개시된 수치의 정확성을 보장하기 위해 노력을 기울였다. 그러나, 측정된 모든 수치는 내재적으로 이의 각각의 측정 기법에서 실측된 표준 편차로부터 생성된 특정 오차값을 함유할 수 있다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
임상시험(NCT00436254)의 설계 및 결과
환자군
실험에 참여한 환자들은 다음의 기준을 만족하는 3기 또는 4기 유방암 환자이다. (1) 표준 요법을 완료했고 완전히 관해 상태로서, 4기 환자에서는 안정적인 골 전이(stable bone only disease)만 있는 환자만 허용되었다. (2) 면역 조직 세포 화학(Immunohistochemistry; IHC) 또는 형광 혼성화(Fluoresence in situ hybridization; FISH)를 통한 원발성 종양 또는 전이 단계에서 HER2 유전자 또는 단백질을 과발현하는 것으로 판명된 경우이다. (3) ECOG 수행상태 점수는 0이다(SCOG Performance Score O). (4) 백혈구(White Blood Cell:WBC)≥3000/mL, 혈소판(platelet) 수≥100,000/mL, 헤마토크릿(hematocrit)≥30; 그리고 정상적인 신장 및 간 기능을 가져야 한다. (5) 임상시험 등록 전 30일 동안 화학 요법 또는 스테로이드와 같은 기타 면역 억제 약물치료를 받지 않아야 한다. (6) 정상 범위의 좌심실구혈율(Left Ventricular Ejection Fraction; LVEF)이어야 한다.
백신 접종 기간 중 비스포스포네이트, 항-에스트로겐 및 트라스투주맙(Trastuzumab) 요법 등의 표준 치료가 허용되었다. 모든 환자는 기관 및 연방 규정에 따라 서면 동의를 제공했다. 66명의 환자가 2004년 5월부터 2007년 8월까지 등록되었으며 64명의 환자가 3번의 백신 접종을 모두 완료했다. Arm 1에 등록한 2명의 환자는 백신을 1회 투여받은 후 질병이 진행되어 연구를 중단하였다. 연방 규정에 따라 10년 동안 환자들의 장기 독성 정도 추적하였다.
연구 설계 및 치료 일정
본 실험에 참여하는 환자는 백신 용량으로 정의된 3개의 pNGVL3-HER2-ICD군(Arm 1: 10㎍, Arm 2: 100㎍, Arm 3: 500㎍) 중 하나에 순차적으로 배정되었다. 모든 백신은 피내(intradermal; i.d.)로 투여되는데, 같은 배액 림프절 부위 내(draining lymph node site)에서 한 달에 한 번 총 세 번의 백신에 대해, 한 번 백신 투약 시 두 개의 주사부위에 나누어 접종하였다. 환자들은 첫 번째 접종 전에 양성 대조군으로 파상풍 톡소이드 백신을 투여받았다. 동시에 트라스투주맙을 투여받은 환자는 기준선과 마지막 백신 1개월 후 MUGA 스캔을 수행했다. 독성 평가는 매월 수행되었으며, 백신 시리즈 완료 후 3, 6 및 12 개월에 수행되었으며 신체 검사, 자가 면역 혈청검사, CBC 및 종합 대사 패널검사를 포함했다. 독성은 CTCAE v 3.0에 따라 등급이 매겨졌고 백신 관련 독성은 심각도에 관계없이 확실히(definitely), 아마도(probably) 또는 관련성 있는(possibly) 이상 반응(Adverse Effect)으로 정의되었다. 장기적인 부작용은 생존 환자에 대한 연간 의료 기록 검토를 통해 평가되었다. PBMC는 베이스라인과 HER2-ICD 및 HER2-ECD에 대한 유도 면역반응을 평가하기 위해 세번째 백신 투여 후(12주) 및 최종 백신 접종 후 1, 3, 6 및 12개월(각각 임상 참여(enrollment) 후 16, 24, 36, 60주에 해당됨)에 수집되었다.
플라스미드 DNA의 지속성을 평가하기 위해 마지막 백신 투여 1개월과 3개월 후 백신 주사 부위에서 피부 생검을 얻었다. PBMC는 기준선과 마지막 백신 1개월 후 플라스미드 DNA의 존재에 대해 평가되었다.
백신 제제
HER2 ICD 서열(서열번호: 2)을 pNGVL3에 삽입하고 DNA시퀀싱으로 확인하였다. 플라스미드 DNA 백신인 pNGVL3-HER2-ICD는 GMP 조건 하에서 증폭, 정량화 및 바이얼(vial)로 제조되었다. 단일 용량 바이알에는 안정화 완충액(1.2ml)으로 Tromethamine/EDTA에 현탁된 10㎍, 100㎍ 또는 500㎍ 플라스미드 DNA(pNGVL3-HER2-ICD) 및 공통으로 100㎍의 GM-CSF가 포함되어 있다. 바이알은 미생물, 무균 및 안정성 테스트를 거쳐 미국 약전 표준에 따라 University of Washington Investigational Drug Services Pharmacy에서 -25oC에서 -10oC 사이에 보관되었다.
항원 특이적 T 세포 반응의 평가
모든 환자의 PBMC 샘플은 림프구 기능을 보존하는 것으로 입증된 표준화된 방법을 사용하여 처리되고 냉동 보존되었다. 각 환자에 대한 모든 샘플을 동시에 해동하고 분석하여 실험적 변동성을 줄였다. 이전에 공지된 Disis등의 방법(J Clin Oncol. 2009 Oct 1; 27(28): 4685-92)에 따라 후술할 항원(자극제)에 의해 자극된 IFN-γ 엘리스팟법을 통해 HER2에 대한 특이적인 반응을 측정하였다. HER2-ICD 또는 HER2-ECD 항원(자극제)은 11개 아미노산이 중첩되는 15개 아미노산 펩타이드 풀(overlapping peptide pool; 1 mg/mL)을 항원으로 사용하였다.
백신 접종 후 엘리스팟법으로 측정된 PBMC에서HER2-ICD 특이적인IFN-γ 생산량이 베이스라인보다 2 배 증가한 경우 환자는 HER2-ICD 특이적 T 세포 반응을 증가시킨 것으로 간주하였다.
피부 및 림프구의 플라스미드 DNA 지속성 평가
백신 접종 후 피부 생검을 위한 일관된 마커 역할을 하기 위해 백신 접종은 두 개의 문신 마크 사이에 투여되었다. 지정된 기간에 지정된 접종 부위(피부)에서 생검 하였다. 분리된 피부 조직은 70oC에 보관하였다. 조직 및 PBMC의 DNA는 DNA 분리용 키트를 통해 분리하여 PRDM36 프라이머[GACTAACAGACTGTTCCTTTCCATGG : 코딩 프라이머] 및 PRDM52 프라이머[GCCAGAAGTCAGATGCTCAA : 상보적 프라이머]의 프라이머 쌍을 이용하여 벡터 DNA를 증폭하였다.
유세포 분석
PBMC는 T-세포 표현형 분석을 위해 CD3 FITC, CD4 PE-Cy7, CD45RO APC, CD62L PE, CD279(PD-1) APC, CD278(ICOS) PE, 및 CD28 PerCP Cy5.5를 포함하는 형광 색소 결합 단일 클론 항체로 염색되었다. 데이터는 CD3+ CD4+ 또는 CD3+ CD8+ 세포 중 CD45RO+ CD62L+ 세포의 %, CD3+ 세포 중 CD28+ CD4+ 또는 CD8+, PD1+ CD4+ 또는 CD8+ 세포 및 CD4+ 및 CD8+ 집단에서 ICOS의 형광으로 표현된다. 골수유래 면역억제 세포(Myeloid-derived suppressor cell: MDSC) 분석을 위해 HLA-DR PE-Cy7, CD11b PE 및 CD33 PerCP Cy5.5, CD3 PE-Cy 5, CD4 PE-Cy7 및 Foxp3 Alex488로 염색했다. 조절 T 세포(regulatory T cell: Treg) 세포 분석을 위해 Foxp3 염색 버퍼 키트(Biolegend)를 이용하여 염색하였다. MDSC는 HLA-DR-CD11b+ CD33+ 세포로 정의했고, Treg 세포는 CD3+ 세포 중 CD4+ Foxp3+ 세포로 정의한다.
환자군 분석 및 각 Arm 별 독성(Adverse Effect) 분석
Arm 1, Arm 2 및 Arm 3는 각각 22명의 환자로 구성되었으며, 각각 HER2-ICD 플라스미드 DNA를 10㎍, 100㎍ 및 500㎍을 포함하고, 공통으로 100㎍의 GM-CSF가 포함된 백신 조성물을 피내(intradermal)로 투여받았다. 각 Arm의 환자 특성은 표 1에 기재되어 있다.
DNA 백신 용량 | Arm 1 (10㎍) |
Arm 2 (100㎍) |
Arm 3 (500㎍) |
|||
No. | % | No. | % | No. | % | |
연령(~세): 중간값(범위) | 50(38-68) | 51(34-72) | 53(42-77) | |||
병기 | ||||||
III | 15 | 68 | 15 | 68 | 12 | 55 |
IV (NED) | 3 | 14 | 4 | 18 | 7 | 32 |
IV (SBO) | 4 | 18 | 3 | 14 | 3 | 14 |
ER/PR 상태 | ||||||
ER+ 및/또는 PR+ | 14 | 64 | 15 | 68 | 8 | 36 |
ER-/PR- | 8 | 36 | 7 | 32 | 14 | 64 |
이전 트라스투주맙 치료여부 | ||||||
No | 4 | 18 | 2 | 9 | 2 | 9 |
Yes | 18 | 32 | 20 | 91 | 20 | 91 |
동시 트라스투주맙 치료 | ||||||
No | 14 | 64 | 12 | 55 | 9 | 41 |
Yes | 8 | 36 | 10 | 45 | 13 | 59 |
ER: Estrogen Receptor(에스트로겐 수용체)PR: Progesterone Receptor(프로게스테론 수용체)
NED: No Evidence of Disease(질병의 징후가 없음)
SBO: Stable Bone-Only disease(안정적인 골 전이)
모든 부문에서 총 990개의 부작용(Adverse Effects)이 관찰되었으며 517개는 백신과 관련된 것으로 간주된다(표 2). 가장 일반적인 백신 관련 부작용은 주사 부위 반응(23%), 피로(7%) 및 근육통(7%)을 포함한다. 모든 백신 관련 독성은 대부분 1등급(89%) 또는 2등급(11%)이었으며, 각 Arm들 간에 유의한 차이가 없다.
DNA 백신의 안전성에 있어서, 외부 DNA가 대상체로 투여되기 때문에, 자가면역반응의 발생 및 /또는 대상체의 유전체 DNA(chromosomal DNA)로 외부 DNA가 삽입되는 위험성이 매우 낮지만 존재한다. 본 연구에서는 모든 Arm들에서 16회의 자가면역에 관련된 이상 혈청학적 반응이 발견되었다(표 2). 11명의 환자에서는 백신 접종 기간에 ANA 양성을 보였고, 5명의 환자에서는 C3의 일시적인 감소가 관찰되었다.
모든 자가면역 관련 독성은 1등급이었고, 항 ds-DNA 항체는 모든 환자에서 발견되지 않았을 뿐만 아니라, 자가면역질환의 징후 또는 발생은 발견되지 않았다. 백신을 접종한 모든 환자의 림프구(circulating lymphocyte)에서 DNA 백신은 검출되지 않았다.
따라서, 본 발명의 백신 조성물 투여에 의한 부작용은 극히 낮은 등급으로 대상체에 투여함에 있어 우려할 정도라 할 수 없고, 자가면역질환의 징후 또는 질환의 발생이 관찰되지 않았다. 또한, 본 발명의 백신 조성물은 대상체의 유전체로의 삽입이 관찰되지 않았으므로, 임상에 적용함에 있어 안전성에 문제가 없는 것으로 판단된다.
DNA 백신 용량 | total | Arm 1 (10㎍) |
Arm 2 (100㎍) |
Arm 3 (500㎍) |
|||||
No | % | No | % | No | % | No | % | ||
가장 빈번한 부작용(n=188) | |||||||||
주사부위 반응 | 117 | 23 | 38 | 7 | 48 | 9 | 31 | 6 | |
감기 유사 반응 | 35 | 7 | 19 | 4 | 9 | 2 | 7 | 1 | |
피로 | 36 | 7 | 14 | 3 | 17 | 3 | 5 | 1 | |
비정상적인 자가 면역반응(n=16) | |||||||||
ANA | 11 | 2 | 4 | 1 | 3 | 1 | 4 | 1 | |
C3 | 5 | 1 | 3 | 1 | 1 | <1 | 1 | <1 | |
Anti-ds DNA | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | |
모든 부작용의 등급(n=517) | |||||||||
1 | 459 | 89 | 180 | 35 | 130 | 25 | 149 | 29 | |
2 | 57 | 11 | 26 | 5 | 11 | 2 | 20 | 4 | |
3 | 1 | <1 | 0 | 0 | 0 | 0 | 1 | <1 | |
4 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | |
5 | 0 | 0 | 0 | 0 | 0 | 0 | 0 | 0 |
SBO: Stable Bone-Only disease(안정적인 골 전이)ANA: anti-nuclear antibody(항-핵 항체)
C3: Complement 3(컴플리먼트 3)
Anti-ds DNA: anti-double strand DNA antibody(항-이중가닥 DNA 항체)
백신 접종 전·후에 따른 HER2-ICD에 대한 면역원성 분석
HER2-ICD DNA 백신에 의한 면역반응성을 분석하기 위하여 백신 접종 전 및 백신 접종 완료 후 1달 및 백신 접종 완료 후 12개월(LTFU) 시점에 분리된 말초혈액단핵구(PBMC)에서 HER2-ICD 항원에 대한 면역반응성을 엘리스팟법으로 분석하였다.
백신 접종 전의 HER2-ICD 항원에 대한 면역반응을 “베이스라인”으로 하여 베이스라인에 대한 면역반응의 정도를 분석하였다.
그 결과 백신 접종 완료 후 1달 후에 베이스라인에 비해 2배 이상으로 면역반응이 증가한 환자의 경우 LTFU까지 면역반응성이 높은 수준으로 유지되는 것을 알 수 있었다. 하지만, 베이스라인에 비해 면역반응이 증가하지 않은 환자들의 경우 LTFU에서의 면역반응성이 감소하는 경향을 알 수 있다.
따라서, DNA 백신 접종에 있어 백신 접종 완료 후 적어도 1달 이후에 PBMC에서의 백신 항원에 대한 특이 면역반응 정도(2배 이상 증가된 수준)는 DNA 백신 접종 시 장기 면역원성을 예측할 수 있는 마커로 사용될 수 있을 것이다.
백신 접종 부위에서 플라스미드 DNA의 지속성 분석
백신 접종 시작 후16주차(마지막 백신 투여 후 1개월)에 피부 생검 조직에서 DNA 백신의 존재 여부를 HER2-ICD가 클로닝되어 있는 벡터 DNA의 PCR 증폭으로 분석하였다.
전체 52명 환자의 피부 생검 조직을 얻었고, 이중 31명(60%)의 환자에서 벡터 DNA가 검출되었다. Arm 1에서는 61%, Arm 2 에서는 50%, Arm 3에서는 73%의 환자에서 벡터 DNA가 검출되었다. 상기 DNA가 검출된 환자와 검출되지 않은 환자 간의 백신 접종 전 HER2-ICD에 대한 면역반응은 유의한 차이가 없었다(p = 0.65). 따라서, 각 환자들간의 백신 접종 전 HER2-ICD에 대한 면역원성은 백신 접종 부위의 DNA 지속기간과는 관계가 없는 것으로 보인다.
놀랍게도, 상기 DNA가 검출된 환자와 검출되지 않은 환자를 각각 추적 관찰한 결과(표 3) DNA가 검출된 환자는 시간이 지남에 따라 HER2-ICD에 대한 면역원성이 평균적으로 낮았을 뿐 아니라, 백신 접종 후 60주(백신접종 후 12개월) 시점에서의 HER2-ICD에 대한 면역반응원성이 유의하게 낮다는 것을 확인할 수 있었다(p=0.02).
Time point | DNA negative | DNA positive | p-value | ||
N | Median(IQR) | N | Median(IQR) | ||
Baseline | 21 | 70 (7, 555) | 31 | 81 (4, 243) | 0.65a |
Week 12-baseline | 19 | 4 (-99, 292) | 30 | -1 (-61, 44) | |
Week 16-baseline | 20 | 16 (-25, 228) | 29 | 0 (-99, 17) | |
Week 24-baseline | 19 | 0 (-390, 215) | 28 | -1 (-187, 87) | |
Week 36-baseline | 18 | 25 (3, 301) | 28 | 14 (-86, 240) | |
Week 60-baseline | 17 | 36 (-122, 417) | 27 | 0 (-31, 249) | 0.02b |
IQR: interquartile range(사분범위)
a: Baseline 비교를 위한 Wilcoxon rank test
b: DNA 지속성, 치료군, 주, Baseline HER2-ICD 면역반응, 및 등록 연령의 함수로서 기준선과 ICD 반응의 차이에 대한 선형 회귀 모델
이러한 결과와는 대조적으로 백신 접종 후 추적 관찰 시 파상풍 톡소이드에 특이적인 IFN- 분비 T 세포의 반응성은 DNA가 검출된 환자와 검출되지 않은 환자 간에 차이가 없었다(p = 0.51).
따라서, DNA 백신접종을 피내에 하는 경우 백신 DNA가 일정 기간 동안만 지속되고 소실되는 경우 더 높은 면역반응을 일으키고, 이와 같은 기전은 DNA 백신 접종시 장기 면역원성을 예측할 수 있는 마커로 사용될 수 있을 것이다.
백신 접종 후 중심 기억 T세포(Central memory T cells: CMT 세포) 분석
Arm 2 및 Arm 3의 환자군은 Arm 1의 환자군보다 백신 접종에 의해 더 증가된 HER2-ICD에 대한 면역반응을 보였고, Arm 2와 Arm 3 간에는 차이가 없었지만, Arm 2의 환자군은 백신 접종 완료 후에도 높은 수준의 HER2-ICD에 대한 면역원성을 유지하였다.
이에 관하여 백신 접종 전후 PBMC의 유세포 분석을 통해 백신 접종 전후 Arm 2 및 Arm 3 두 그룹간에 CD4+ 또는 CD8+ T 세포에서 Treg, MDSC 또는 PD-1의 발현 수준에는 통계적으로 유의한 차이가 없음을 확인하였다.
추가적으로 Arm 2의 환자군들을 대상으로 백신 접종 전과 마지막 접종 후 60주(long-term follow-up: LTFU)에서의 중심기억 T세포(Central memory T cell: CMT 세포)의 분포를 분석하였다.
CMT 세포는 CD4+ 세포에서의 CMT 세포(CD45RO+ CD62L+ CD4+) 및 CD8+ 세포에서의 CMT 세포(CD45RO+ CD62L+ CD8+)가 존재한다.
Arm 2 환자군에서는 모두 백신 접종 전에 비해 접종 후 LTFU에 CMT 세포인 CD45RO+ CD62L+ CD4+ T 세포 및 CD45RO+ CD62L+ CD8+ T 세포 모두 유의하게 증가한 것을 보인다(도 1 참조).
Arm 2의 환자군에서 LTFU에서 증가된 CD4+ CMT 세포 및 CD8+ CMT 세포는 모두 증가된 HER2-ICD에 대한 면역반응과 유의한 상관관계(p=0.06, p=0.04)가 있었지만(도 2 참조), HER2-ECD(에피토프 확장, Epitope spreading) 및 파상풍 톡소이드(음성 대조군)에 대한 면역반응과는 관련이 없었다.
따라서, DNA 백신접종에 있어서 백신 접종 전 대비 접종 후 일정 기간 후의 CMT 세포가 증가한 경우, 항원에 대한 장기적인 면역반응성을 예측할 수 있고, 이와 같은 기전은 DNA 백신 접종 시 장기 면역원성 반응을 예측할 수 있는 마커로 사용될 수 있을 것이다.
서열정보
서열번호 1(HER2 전장서열)
YLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
서열번호 2(HER2-ICD 아미노산 서열)
MKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQSLPTHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERAKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
서열번호 3(HER2-ICD 뉴클레오타이드 서열)
GGGACCTGGTGGATGCTGAGGAGTATCTGGTACCCCAGCAGGGCTTCTTCTGTCCAGACCCTGCCCCGGGCGCTGGGGGCATGGTCCACCACAGGCACCGCAGCTCATCTACCAGGAGTGGCGGTGGGGACCTGACACTAGGGCTGGAGCCCTCTGAAGAGGAGGCCCCCAGGTCTCCACTGGCACCCTCCGAAGGGGCTGGCTCCGATGTATTTGATGGTGACCTGGGAATGGGGGCAGCCAAGGGGCTGCAAAGCCTCCCCACACATGACCCCAGCCCTCTACAGCGGTACAGTGAGGACCCCACAGTACCCCTGCCCTCTGAGACTGATGGCTACGTTGCCCCCCTGACCTGCAGCCCCCAGCCTGAATATGTGAACCAGCCAGATGTTCGGCCCCAGCCCCCTTCGCCCCGAGAGGGCCCTCTGCCTGCTGCCCGACCTGCTGGTGCCACTCTGGAAAGGGCCAAGACTCTCTCCCCAGGGAAGAATGGGGTCGTCAAAGACGTTTTTGCCTTTGGGGGTGCCGTGGAGAACCCCGAGTACTTGACACCCCAGGGAGGAGCTGCCCCTCAGCCCCACCCTCCTCCTGCCTTCAGCCCAGCCTTCGACAACCTCTATTACTGGGACCAGGACCCACCAGAGCGGGGGGCTCCACCCAGCACCTTCAAAGGGACACCTACGGCAGAGAACCCAGAGTACCTGGGTCTGGACGTGCCAGTGTAA
Claims (13)
- DNA 백신을 접종 받은 환자의 말초혈액단핵구(PBMC)에서 백신 접종 전·후의 백신 항원에 대한 면역원성을 검사하는 방법을 포함하는, DNA 백신의 장기 면역원성을 모니터링하는 방법.
- 제1항에 있어서,상기 백신 접종 후 백신 항원에 대한 면역원성을 모니터링 하는 시점은 백신 접종 완료 후 1개월 내지 3개월 중 임의로 선택되는, 방법.
- 제2항에 있어서,상기 방법은 말초혈액단핵구(PBMC)에서 백신 접종 전·후 중심 기억 T 세포(central memory T cell: CMT 세포)의 비율을 확인하는 방법을 추가로 포함하는, 방법.
- 제3항에 있어서,상기 중심 기억 T 세포는 CD45RO+ CD62L+ CD4+ T 세포, 또는 CD45RO+ CD62L+ CD8+ T 세포인, 방법.
- 제4항에 있어서,상기 중심 기억 T 세포는 CD45RO+ CD62L+ CD4+ T 세포, 및 CD45RO+ CD62L+ CD8+ T 세포인, 방법.
- 제3항에 있어서,상기 방법은 DNA 백신을 접종받은 환자의 접종 부위에서 백신 접종 완료 후 백신 DNA의 존재 여부를 확인하는 방법을 추가로 포함하는, 방법.
- 제6항에 있어서,상기 DNA 백신은 피내(intradermal)로 투여되는, 방법.
- 제6항에 있어서,상기 백신 DNA를 존재 여부의 확인 시점은 백신 접종 완료 후 1달 내지 3달 중 임의로 선택되는, 방법.
- 제8항에 있어서,상기 백신 DNA의 존재 여부는 DNA 백신이 투여된 부분의 피부 생검을 통해 확인하는 것인, 방법.
- 제9항에 있어서,상기 백신 DNA의 존재 여부는 PCR 증폭방법에 의한 것인, 방법.
- 제1항 내지 제10항 중 어느 한 항에 있어서,상기 DNA 백신은 HER2-ICD(세포내 영역: intracellular domain) 백신인, 방법.
- 제11항에 있어서,상기 HER2-ICD 백신은 서열번호 2 또는 이와 80% 이상의 서열상동성을 지니는 HER2-ICD 영역을 암호화하는 뉴클레오티드 서열을 포함하는 플라스미드 벡터를 포함하는, 방법.
- 제12항에 있어서,상기 뉴클레오티드 서열은 서열번호 3 또는 이와 80% 이상의 서열상동성을 지니는, 방법.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202163183874P | 2021-05-04 | 2021-05-04 | |
US63/183,874 | 2021-05-04 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022235046A1 true WO2022235046A1 (ko) | 2022-11-10 |
Family
ID=83932840
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/006321 WO2022235046A1 (ko) | 2021-05-04 | 2022-05-03 | Her2 백신 조성물 |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2022235046A1 (ko) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100332417A1 (en) * | 2009-06-02 | 2010-12-30 | Targeted Molecular Diagnostics, Llc | Methods for the detection and quantitation of the p95 component of her2/neu (erbb2) |
-
2022
- 2022-05-03 WO PCT/KR2022/006321 patent/WO2022235046A1/ko active Application Filing
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100332417A1 (en) * | 2009-06-02 | 2010-12-30 | Targeted Molecular Diagnostics, Llc | Methods for the detection and quantitation of the p95 component of her2/neu (erbb2) |
Non-Patent Citations (4)
Title |
---|
ANONYMOUS: "Vaccine Therapy in Treating Patients With Stage IV Hormone Receptor Positive Breast Cancer", -CLINICALTRIALS.GOV, 11 April 2017 (2017-04-11), XP093001305, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/show/NCT01729884> [retrieved on 20221123] * |
ARAB ATEFEH; YAZDIAN-ROBATI REZVAN; BEHRAVAN JAVAD: "HER2-Positive Breast Cancer Immunotherapy: A Focus on Vaccine Development", ARCHIVUM IMMUNOLOGIAE ET THERAPIAE EXPERIMENTALIS, BIRKHAEUSER VERLAG AG, CH, vol. 68, no. 1, 9 January 2020 (2020-01-09), CH , XP037118528, ISSN: 0004-069X, DOI: 10.1007/s00005-019-00566-1 * |
DISIS MARY L., COVELER ANDREW L., HIGGINS DOREEN, FINTAK PATRICIA, WAISMAN JAMES ROSS, REICHOW JESSICA, SLOTA MEREDITH, CHILDS JEN: "A phase I trial of the safety and immunogenicity of a DNA-based vaccine encoding the HER2/neu (HER2) intracellular domain in subjects with HER2+ breast cancer.", JOURNAL OF CLINICAL ONCOLOGY, AMERICAN SOCIETY OF CLINICAL ONCOLOGY, US, vol. 32, no. 15_suppl, 20 May 2014 (2014-05-20), US , pages 616 - 616, XP009540881, ISSN: 0732-183X, DOI: 10.1200/jco.2014.32.15_suppl.616 * |
OMABE MAXWELL, AHMED SHAHID, SAMI AMER, XIE YUFENG, TAO MIN, XIANG JIM: "HER2-Specific Vaccines for HER2-Positive Breast Cancer Immunotherapy", WORLD JOURNAL OF VACCINES, SCIENTIFIC RESEARCH PUBLISHING, INC., US, vol. 05, no. 02, 1 January 2015 (2015-01-01), US , pages 106 - 128, XP093001309, ISSN: 2160-5815, DOI: 10.4236/wjv.2015.52013 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10450380B2 (en) | Polypeptide immunogen for generating an antibody to non-functional P2X7 receptor | |
CA2687368C (en) | Vaccine for the prevention of breast cancer relapse | |
US9737596B2 (en) | Vaccine for the prevention of breast cancer recurrence | |
EP2613808B1 (en) | Companion animal cancer treatments with an anti p2x7 antibody | |
CA2459348C (en) | Antibodies to non-functional p2x7receptor, diagnosis and treatment of cancers and other conditions | |
JP7301408B2 (ja) | 乳がんおよび卵巣がんワクチン | |
RU2559782C2 (ru) | Набор для детекции спор, происходящих из микобактерий | |
US20220202901A1 (en) | Peptides in combination with immune checkpoint inhibitors for use in treatment of cancer | |
WO2022235046A1 (ko) | Her2 백신 조성물 | |
EP4378473A1 (en) | Her2 vaccine composition | |
WO2022235045A1 (ko) | Her2 백신 조성물 | |
WO2022235044A1 (ko) | Her2 백신 조성물 | |
EP3552620A1 (en) | Methods of treatment for candida auris infections |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22799089 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 22799089 Country of ref document: EP Kind code of ref document: A1 |