WO2022221920A1 - Novel compositions and methods for treating coronavirus infections - Google Patents
Novel compositions and methods for treating coronavirus infections Download PDFInfo
- Publication number
- WO2022221920A1 WO2022221920A1 PCT/AU2022/050363 AU2022050363W WO2022221920A1 WO 2022221920 A1 WO2022221920 A1 WO 2022221920A1 AU 2022050363 W AU2022050363 W AU 2022050363W WO 2022221920 A1 WO2022221920 A1 WO 2022221920A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ace2
- amino acid
- sars
- cov
- proteinaceous molecule
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/15—Oximes (>C=N—O—); Hydrazines (>N—N<); Hydrazones (>N—N=) ; Imines (C—N=C)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/485—Exopeptidases (3.4.11-3.4.19)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/17—Metallocarboxypeptidases (3.4.17)
- C12Y304/17023—Angiotensin-converting enzyme 2 (3.4.17.23)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/48—Hydrolases (3) acting on peptide bonds (3.4)
- C12N9/50—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
- C12N9/64—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
- C12N9/6421—Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
Definitions
- This invention relates generally to methods and compositions for treating coronavirus infections. More particularly, the present invention relates to proteinaceous agents that prevent or inhibit the replication of a SARS-CoV virus, including a SARS-CoV-2 virus. The present invention further relates to the use of these agents and molecules for treating or preventing a coronavirus infection in a subject.
- Coronaviruses are enveloped RNA viruses that infect mammals and birds.
- the severe acute respiratory syndrome (SARS) and the Middle East respiratory syndrome (MERS) are both members of the genus Betacoronavirus, and responsible for hundreds of deaths in Asia and the Middle East, respectively.
- SARS-CoV-2 SARS-coronavirus 2
- the coronaviruses are a virus family grouped into four genera, being the alphacoronavirus, betacoronavirus (b-CoVs), gammacoronavirus, and deltacoronavirus.
- the alphacoronaviruses and betacoronaviruses infect a wide range of species, including humans.
- the b-CoVs that are of particular clinical importance in humans include OC43 and HKU1 of the A lineage, Severe Acute Respiratory Syndrome coronavirus (SARS-CoV) and SARS-CoV-2 (which causes the disease COVID-19) of the B lineage, and Middle Eastern Respiratory Syndrome-related coronavirus (MERS-CoV) of the C lineage.
- SARS-CoV Severe Acute Respiratory Syndrome coronavirus
- SARS-CoV-2 which causes the disease COVID-19
- MERS-CoV Middle Eastern Respiratory Syndrome-related coronavirus
- the present invention arises at least in part from the unexpected realisation by the present inventors that host ACE2 protein nuclear localisation is an important function in the SARS-CoV virus infection of a host cell. Furthermore, the nuclear localisation of host ACE2 protein provides a molecular mechanism that can be disrupted in order to prevent SARS-CoV virus replication in the host cell. These realisations have been reduced to practice in novel compositions and methods for treating or preventing coronavirus infections (particularly, SARS-CoV infections).
- the present invention provides isolated or purified proteinaceous molecules reducing or inhibiting nuclear localisation of the ACE2 protein.
- These molecules generally comprise, consist, or consist essentially of an amino acid sequence represented by Formula I:
- Xi, X 2 , and X3 are independently selected from K and Q amino acids, or modified forms thereof.
- each of Xi, X2, and X3 are K amino acid residues.
- the proteinaceous molecule comprises, consists or consists essentially of the amino acid sequence TGIRDRKKKNKARS [SEQ ID NO: 3]
- the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRQQQNKARS [SEQ ID NO: 4] In some alternative embodiments, the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRKKQNKARS [SEQ ID NO: 5]. In some alternative embodiments, the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRQKKNKARS [SEQ ID NO: 6].
- the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRKQKNKARS [SEQ ID NO: 7] In some alternative embodiments, the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRKQQNKARS [SEQ ID NO: 8]. In some other embodiments, the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRQKQNKARS [SEQ ID NO: 9]. In some alternative embodiments, the proteinaceous molecule comprises, consists, or consists essentially of the amino acid sequence TGIRDRQQKNKARS [SEQ ID NO: 10].
- the proteinaceous molecules comprise, consist, or consist essentially the amino acid sequence TGIRDRKKKNKARS.
- one, two, or each of Xi, X2, and X3 are methylated K (lysine) residues.
- the proteinaceous molecule comprises, consists, or consists essentially of an amino acid sequence selected from the group comprising: TGIRDRK(Me2)KKNKARS; TGIRDRKK(Me2)KNKARS; and TGIRDRKKK(Me2)NKARS.
- one, two, or each of Xi, X2, and X3 are acetylated K residues.
- the proteinaceous molecule comprises, consists essentially, or consists of an amino acid sequence which is represented by Formula II:
- Zi is absent or is selected from at least one of a proteinaceous moiety comprising from about 1 to about 50 amino acid residues, and a protecting moiety; and Z 2 is absent or is selected from at least one of a proteinaceous moiety comprising from about 1 to about 50 amino acid residues.
- the proteinaceous molecule comprises a ubiquitination site.
- the ubiquitination site is located in the C-terminal tail region (i.e., amino acid residues 763-805 of the full-length human ACE2 sequence as set forth in SEQ ID NO: 1 ).
- the ubiquitination site comprises the amino acid residue K788.
- the proteinaceous molecule may comprise, consist, or consist essentially of the amino acid sequence DISKGENNPGFQNTDDVQTS [SEQ ID NO: 11].
- the proteinaceous molecules may comprise an amino acid sequence that corresponds to both a methylation site and a ubiquitin site.
- the proteinaceous molecule may comprise, consists, or consists essentially of the amino acid sequence TGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF [SEQ ID NO: 12].
- the proteinaceous molecules comprise, consist, or consist essentially of, an amino acid sequence corresponding to the C-terminal tail region sequence of the ACE2 polypeptide that intervenes the methylation sites and the ubiquitination site.
- the ACE2 peptide may comprise, consist or consist essentially of an amino acid sequence that corresponds to residues 774-787 of the full-length human ACE2 protein (i.e., ARSGENPYASIDIS).
- the present invention provides a composition for treating or preventing a coronavirus infection, comprising an agent selected from a proteinaceous molecule and a pharmaceutically acceptable carrier or diluent, wherein the proteinaceous molecule as described above and/or elsewhere herein.
- the composition comprises a proteinaceous molecule comprising, consisting, or consisting essentially of a first amino acid sequence which is represented by Formula I or Formula II, and second amino acid sequence which identified by SEQ ID NO: 11 .
- the first amino acid sequence and the second amino acid sequence are located in the same polypeptide. Alternatively, in some embodiments the first amino acid sequence and the second amino acid sequence are present on different polypeptides. [0022] In some of the same embodiments and some other embodiments, the composition comprises at least one anti-viral agent.
- the present invention provides methods for preventing or reducing coronavirus replication in a host cell, the method comprising contacting the cell with a proteinaceous molecule as described above and/or elsewhere herein for a time and under conditions sufficient to prevent or reduce coronavirus entry in the cell.
- the present invention provides a method for treating or preventing a coronavirus infection (e.g., COVID-19) in a subject, the method comprising administering to the subject an effective amount of a proteinaceous molecule described above and/or elsewhere herein.
- a coronavirus infection e.g., COVID-19
- the proteinaceous molecule has an amino acid sequence as set forth in Formula I and/or Formula II.
- the coronavirus is a betacoronavirus.
- the coronavirus is selected from the group comprising SARS-CoV and SARS- CoV-2.
- the coronavirus is SARS-CoV-2.
- the subject is a human.
- the present invention provides the use of a proteinaceous molecule as described above and/or elsewhere herein, for therapy.
- the methods comprise concurrently, sequentially, or subsequently administering to the subject an antiviral agent.
- the antiviral agent is selected from the group comprising hydroxychloroquine, chloroquine, lopinavir, ritonavir, favipiravir, and remdesivir. In some of the same embodiments and some other embodiments, the antiviral agent comprises an IFN-y polypeptide.
- the present invention provides a pharmaceutical composition that comprises, consists, or consists essentially of an ACE2 peptide as described above and/or elsewhere herein and a pharmaceutically acceptable excipient, carrier and/or diluent.
- the pharmaceutical composition also comprises an antiviral agent.
- the present invention provides a method for reducing ACE2 nuclear localisation in a cell, the method comprising contacting the cell with an agent selected from a proteinaceous molecule or composition as described above or elsewhere herein for a time and under conditions sufficient to reduce nuclear localisation in the cell.
- the present invention provides a method for reducing or preventing the binding of an ACE2 polypeptide to an IMPa polypeptide, the method comprising contacting the cell with an agent selected from a proteinaceous molecule or composition as described above or elsewhere herein for a time and under conditions sufficient to reduce, prevent inhibit the binding of an ACE2 polypeptide to an IMPa polypeptide.
- inflammation e.g., lung inflammation
- the level of cells expressing CD3+ is increased in the lung of the subject.
- the level of cells expressing perforin is increased in the lung of the subject.
- Figure 1 shows that LSD1 and ACE2 associate as a complex on cell surface in SARS-CoV-2 susceptible cells.
- A Representative images of CaCo2 cells imaged with the ASI digital pathology system. Cells are either permeabilized (intracellular) or not permeabilized (surface) and stained for expression of ACE2, LSD1 and TRMPSS2.
- +1 perfect colocalization.
- C Representative FACS plot showing the cell surface and intracellular expression of ACE2 and LSD1 in Caco-2 cells. The numbers in each quadrant indicate the percentage of the total cell population, which also shown in dot plot (D). Data in dot plot represent two independent biological replicates.
- E Representative image of MRC5 cells imaged with the ASI digital pathology system, that are either permeabilized (intracellular) or not permeabilized (surface) and stained for expression of ACE2, LSD1 and TRMPSS2. Scale bar represents 10 mm.
- F Dot graphs displays the nuclear fluorescence intensity in MRC5 cells for ACE2, LSD1 and TRMPSS2 from (E). > 50 cells counted per group. Data represent mean ⁇ SE. Mann-Whitney-test. **p ⁇ 0.01 , ***p ⁇ 0.001 , ****p ⁇ 0.0001 denote significant differences n.s. denotes non-significant.
- Figure 2 provides graphical representation showing LSD1 and ACE2 have increased association on the cell surface in SARS-CoV-2 infected cells.
- C Representative image of Caco-2 or Caco-2-SARS-CoV-2 infected cells imaged with the ASI digital pathology system are shown, cells were either permeabilized (intracellular) with 0.5% Triton X-100 for 15 minutes or not permeabilized (surface) and stained for with primary antibodies against ACE2, LSD1 and SARS-CoV-2 SPIKE protein.
- -1 inverse of colocalization
- 0 no colocalization
- +1 perfect colocalization.
- (E) FACS analysis of the expression of SARS-CoV-2 nucleocapsid protein, cell surface ACE2 and intracellular LSD1 in Caco-2 cells after 48 hours post-infection. The unit of y axis indicates the percentage of the total cell population. Data represent mean ⁇ SD, n 2.
- FIG. 1 Representative image of CaCo2 or CaCo2- SARS-CoV-2 infected cells imaged with ASI digital pathology system are shown, cells were either (FI) not permeabilized (surface) or (I) permeabilized (intracellular) with 0.5% Triton X- 100 for 15 minutes or and stained for with primary antibodies against SETDB1 , G9A and ACE2.
- J Dot graphs displaying the nuclear fluorescence intensity in Caco-2 cells for ACE2, LSD1 and SARS-CoV-2 from (FI, I). >50 cells counted per group. Data represent mean ⁇ SE. Mann-Whitney-test. **p ⁇ 0.01 , ***p ⁇ 0.001 , ****p ⁇ 0.0001 denote significant differences n.s. denotes non-significant. Scale bars represents 12 mm.
- FIG. 3 provides graphical representations showing LSD1 directly interacting with the ACE2 cytoplasmic tail that harbours high affinity LSD1 demethylation domain.
- A The dimer structure of ACE2 is depicted as a schematic. We have identified using high resolution bioinformatic tools in the C-terminal flexible domain sequence which is predicted to be an NLS that binds IMPa. This motif also contains 3 lysine residues (in red) that are high probability de-methylation targets for LSD1 catalytic activity, with an SVM probability of 0.72 or higher.
- B Microscale thermophoresis was carried out to determine the binding between LSD1 and ACE2 via the C-terminal tail region.
- C, D Representative image of Caco-2 cells imaged with the ASI digital pathology system are shown. Caco-2 cells were treated with vehicle control or 200 mM of phenelzine and imaged with the ASI digital pathology system are shown, cells were either (C) permeabilized (intracellular) with 0.5% Triton X-100 for 15 minutes or (D) non-permeabilized (surface) and stained for with primary antibodies against ACE2, LSD1 and SARS-CoV-2 nucleocapsid protein. Scale bar represents 12 mm.
- FIG. 4 provides a graphical representation of a global transcript analysis. Caco-2 cells were treated with Phenelzine, GSK or L1 and global RNA transcriptome analysis shows that key anti-viral and transcription processes are impacted.
- the heat map above focuses on a DEGs list related to ISG, IFN-I, cytokine/chemokine activity, and viral entry, nuclear import/RNA synthesis, translation and replication.
- the heatmap graph depicts the log2 (fold change) of DEGs of inhibition treated compared with control cells. Those selected DEGs have a log2 (fold change) of more than 1 and FDR value of less than 0.01 .
- Figure 5 shows a graphical representation of the interplay of intracellular ACE2 in infected cells.
- A Representative image of Caco-2 or MRC5 SARS- CoV-2 infected cells are depicted. Scale bar represents 15 mm.
- B Cells were permeabilized and imaged with the ASI digital pathology system are shown, cells were stained for with primary antibodies against SARS-CoV-2 (nucleocapsid), ACE2 and LSD1 . Dot graphs display the nuclear fluorescence intensity in Caco-2 cells for ACE2, LSD1. 20 or more cells counted per group.
- C Cells were not permeabilized to track surface expression and stained for with primary antibodies against ACE2 and LSD1 .
- Dot graphs display the nuclear fluorescence intensity in Caco-2 cells for ACE2, LSD1. 20 or more cells counted per group. Data represent mean ⁇ SEM. Mann-Whitney-test. * p ⁇ 0.0181 , **p ⁇ 0.01 , ***p ⁇ 0.001 , ****p ⁇ 0.0001 denote significant differences, n.s. denotes non-significant.
- the nuclear/cytoplasmic fluorescence ratio (Fn/c) using the equation: Fn/c (Fn- Fb)/(Fc - Fb), where Fn is nuclear fluorescence, Fc is cytoplasmic fluorescence, and the dotted line indicates background fluorescence.
- FIG. 1 Representative image of Caco-2 cells imaged with the ASI digital pathology system are shown, that are not permeabilized (surface stain), treated with vehicle control or 25 mM/50 mM of ACE2 novel peptide inhibitor (tagged with FAM5) and stained for cell surface expression of ACE2, LSD1 .
- B Dot graphs displays the nuclear fluorescence intensity in Caco-2 cells for ACE2 and LSD1 from (A).
- FIG. 1 Representative image of Caco-2 cells imaged with the ASI digital pathology system are shown, permeabilized with 0.5% Triton X-100, treated with vehicle control or 25 mM/50 mM of ACE2 novel peptide inhibitor (tagged with FAM5) and stained for cell surface expression of ACE2, LSD1 .
- Figure 7 shows graphical representations of ACE2 peptide inhibitor effect on nucleocapsid and Spike protein of SARS-Cov-2.
- A Representative image of Caco-2-SARS-CoV-2 infected cells treated with phenelzine (P400 mM), GSK (G400 mM), L1 (50 mM) or P604 (ACE2 peptide 50 mM) imaged with the ASI digital pathology system are shown, Scale bar represents 15 mm.
- B Cells were permeabilized with 0.5% Triton X-100 for 15 minutes and stained for with primary antibodies against ACE2, TMPRSS2 and SARS- CoV-2 Spike Protein.
- Dot graphs displays the nuclear fluorescence intensity in Caco-2 cells for ACE2, TMPRSS2 and SARS-CoV-2 Spike Protein.
- the PCC(r) was calculated for ACE2 and SARS-CoV-2.
- C Representative image of Caco-2-SARS-CoV-2 infected cells treated with phenelzine (P400 mM), GSK (G400 mM), L1 (50 mM) or P604 (ACE2 peptide 50 mM) imaged with the ASI digital pathology system are shown, Scale bar represents 15 mm.
- FIG. 8 Caco-2 or MRC5 cells were transfected with either VO or LSD1 WT plasmids. Cells were either permeabilized (intracellular) with 0.5% Triton X-100 for 15 minutes and stained for with primary antibodies against (A) ACE2 and (B) LSD1 and imaged with the ASI digital pathology system. Bar graphs displays the overall mean fluorescence intensity for LSD1 and Caco-2 cells >20 cells counted per group. Data represent mean ⁇ SE. Mann-Whitney-test. **p ⁇ 0.01 , ***p ⁇ 0.001 , ****p ⁇ 0.0001 denote significant differences n.s. denotes non-significant.
- FIG. 9 provides graphical representations of the ACE2 and spike protein interaction.
- A Structure of ACE2 bound to the SARS-CoV-2 spike domain (PDB 6M17). Binding of ACE2 and the spike domain involves a Lys31 (ACE2) and Gln493 (spike) interaction. ACE2 is shown in yellow in cartoon mode, and spike domain in grey. Residues are shown in stick format. Methylation of ACE2 Lys31 (right panel) would disrupt this interaction.
- C Cell proliferation analysis of Caco-2 control and ACE2-01/ACE2-02-treated cells over a 96-hour period. Proliferation was analysed using WST-1 reagent and absorbance read after 2-hour incubation. The graph depicts relative cell proliferation from three replicates expressed as a percentage of control cells (untreated, 0 hours). Statistical significance was calculated using one-way ANOVA at each time point.
- D Schematic of SARS-CoV-2 infection.
- Caco-2 cells were seeded for 24 hours and then infected with SARS-CoV-2 at MOI 1.0 in the presence of ACE2 peptide inhibitors (ACE2-01 or ACE2-02) for 1 hour. The virus inoculum was removed and inhibitor- containing medium was added. Then, cell culture supernatants were collected at 0 or 48 hpi and infected cells were harvested at 48 hpi. Antiviral activity was assessed with three viral assays: SARS-CoV-2 qRT-PCR, median tissue culture infective dose assay (TCID 5 o), and viral spike protein quantified by digital pathology (ASI system).
- SARS-CoV-2 qRT-PCR SARS-CoV-2 qRT-PCR
- TCID 5 o median tissue culture infective dose assay
- ASI system viral spike protein quantified by digital pathology
- Duolink ® proximity ligation assay measurements of protein interactions were performed on unpermeabilized Caco-2 cells infected with SARS-CoV-2 and treated with control, GSK, or ACE2-01 or ACE2-01 peptide inhibitors.
- the Duolink ® assay produces a single bright dot per interaction within the cell. Representative images (left) are shown for ACE2 and SARS-CoV-2 Spike Duolink ® .
- FIG. 10 The receptor-binding domain (RBD) sequence of SARS- CoV-2 showing the critical residue (Q; glutamine 493) that binds to ACE2 lysine 31 and the conservation of this sequence in different species. In silico prediction gave a probability of 0.7 of a methylation/demethylation signature at lysine 31.
- B LSD1 inhibition reduces ACE2 demethylation at lysine 31 , recombinant LSD1 protein alone or pre-incubated with di- methylated ACE2 peptide.
- FIG 11 provides a graphical representation of a mutagenesis study of ACE2 peptide inhibitors.
- A ACE2-01 Alanine walk peptides were created via an alanine substitution along the length of the peptide. Each peptide was then used to pre-treat CaCo2 cells, followed by treatment with SARS-CoV-2 Spike protein. Samples were then stained with antibodies specific for SARS-CoV-2 spike protein and visualized using an ASI high resolution microscopy. Fluorescent intensities of spike protein on non-permeabilized cells were quantified using ASI Digital pathology software. Data represent n > 300 cells per a group.
- Figure 12 provides a graphical representation of P604 ACE2 peptide disrupting nuclear ACE2 importin machinery and displaying minimal toxicity in animal safety studies.
- A The electrophoresis mobility shift assay was carried out to confirm the interaction between IMPa and ACE2 via the C-terminal domain. ACE2 C-terminal domain is FITC labeled. Left panel is Coomassie stained, right panel is visualized by UV.
- B The electrophoresis mobility shift assay was carried out to confirm the interaction between IMPa and ACE2 via the C-terminal domain. ACE2 C-terminal domain is FITC labeled. Left panel is Coomassie stained, right panel is visualized by UV.
- Figure 13 provides graphical representation showing P604 ACE2 peptide inhibitor treatment inhibits viral replication and protects against early lung inflammation associated with SARS-Cov-2 infection in SARS-COV2 Syrian golden hamster pre-clinical animal model.
- A qRT-PCR analysis to detect replicates of SARS- CoV-2 RNA in infected lungs from golden Syrian hamsters treated as described above (A). RNA yield is presented as Iog10 TCID 5 o eq/mL..
- (C) TCID 5 o assay to measure infectious viral titers in infected lungs. Data represent mean ⁇ SEM, n 5/group. Tukey’s post test, ** p ⁇ 0.01, *** p ⁇ 0.001 denotes significant differences.
- Figure 14 provides a graphical representation showing that aadministration of P604 ACE2 peptide inhibitor reduces SARS-Cov-2 viral infection and inflammation in the lungs of golden Syrian hamsters.
- H&E Hematoxylin and eosin stained tissue sections of lungs from vehicle and P604 ACE2 peptide inhibitor treated animals.
- Left panel bronchiolitis with degeneration, necrosis and exfoliation of epithelial cells accompanied by transmural leukocyte infiltration (widespread apoptosis).
- Middle panel vasculitis characterized by margination and transmural migration of heterophils and monocytes accompanied by endothelial cell and smooth muscle cell damage (arrow).
- Figure 15 provides a graphical representation showing that P604 ACE2 peptide inhibitor induces anti-viral signature/effector signature and abrogates nuclear ACE2.
- A Depicts example images of stained lung FFPE sections of a golden Syrian hamster SARS-CoV-2 infection model that has been infected with SARS-CoV-2 and treated with either vehicle control, P604 ACE2 peptide inhibitor IP or P604 ACE2 peptide inhibitor IV.
- Lung tissue FFPE was processed as described in the methods and stained for perforin and CD3. Analysis and imaging was carried out using ASI Digital analysis of captured images (n > 1000 cells analyzed). Data is plotted with mean ⁇ SEM and represents population dynamics of CD3 and Perforin positive cells.
- administering concurrently or “co-administering” and the like refer to the administration of a single composition containing two or more actives, or the administration of each active as separate compositions and/or delivered by separate routes either contemporaneously or simultaneously or sequentially within a short enough period of time that the effective result is equivalent to that obtained when all such actives are administered as a single composition.
- simultaneous is meant that the active agents are administered at substantially the same time, and desirably together in the same formulation.
- temporary it is meant that the active agents are administered closely in time, e.g., one agent is administered within from about one minute to within about one day before or after another.
- any contemporaneous time is useful. However, it will often be the case that when not administered simultaneously, the agents will be administered within about one minute to within about eight hours and suitably within less than about one to about four hours. When administered contemporaneously, the agents are suitably administered at the same site on the subject.
- the term “same site” includes the exact location, but can be within about 0.5 to about 15 cm, preferably from within about 0.5 to about 5 cm.
- the term “separately” as used herein means that the agents are administered at an interval, for example at an interval of about a day to several weeks or months.
- the active agents may be administered in either order.
- the term “sequentially” as used herein means that the agents are administered in sequence, for example at an interval or intervals of minutes, hours, days or weeks. If appropriate the active agents may be administered in a regular repeating cycle.
- agent includes a compound that induces a desired pharmacological and/or physiological effect.
- the term also encompasses pharmaceutically acceptable and pharmacologically active ingredients of those compounds specifically mentioned herein including but not limited to salts, esters, amides, prodrugs, active metabolites, analogues and the like.
- pharmaceutically acceptable and pharmacologically active ingredients of those compounds specifically mentioned herein including but not limited to salts, esters, amides, prodrugs, active metabolites, analogues and the like.
- agent is not to be construed narrowly but extends to small molecules, proteinaceous molecules such as peptides, polypeptides and proteins as well as compositions comprising them and genetic molecules such as RNA, DNA and mimetics and chemical analogues thereof as well as cellular agents.
- agent includes a cell that is capable of producing and secreting a polypeptide referred to herein as well as a polynucleotide comprising a nucleotide sequence that encodes that polypeptide.
- agent extends to nucleic acid constructs including vectors such as viral or non-viral vectors, expression vectors and plasmids for expression in and secretion in a range of cells.
- the “amount” or “level” of a biomarker is a detectable level in a sample. These can be measured by methods known to one skilled in the art and also disclosed herein. The expression level or amount of biomarker assessed can be used to determine the response to treatment.
- antagonist refers to a substance that prevents, blocks, inhibits, neutralizes, or reduces a biological activity or effect of another molecule, such as a receptor.
- binding refers to measurable and reproducible interactions such as binding between a target and a binding molecule, which is determinative of the presence of the target in the presence of a heterogeneous population of molecules including biological molecules.
- binding molecule that binds to or specifically binds to a target is a molecule that binds this target with greater affinity, avidity, more readily, and/or with greater duration than it binds to other targets.
- the extent of binding of a binding molecule to an unrelated target is less than about 10% of the binding of the molecule to the target as measured, e.g., by a radioimmunoassay (RIA).
- a binding molecule that specifically binds to a target has a dissociation constant (Kd) of £ mM, £100 nM, £ nM, £1 nM, or £0.1 nM.
- Kd dissociation constant
- a binding molecule specifically binds to a region on a protein that is conserved among the protein from different species.
- specific binding can include, but does not require exclusive binding.
- amino acid sequence that displays substantial sequence similarity or identity to a reference amino acid sequence.
- amino acid sequence will display at least about 70, 71 , 72, 73, 74,
- an “effective amount” is at least the minimum amount required to effect a measurable improvement or prevention of a particular disorder.
- An effective amount herein may vary according to factors such as the disease state, age, sex, and weight of the patient, and the ability of the antibody to elicit a desired response in the individual.
- An effective amount is also one in which any toxic or detrimental effects of the treatment are outweighed by the therapeutically beneficial effects.
- beneficial or desired results include results such as eliminating or reducing the risk, lessening the severity, or delaying the onset of the disease, including biochemical, histological and/or behavioural symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
- beneficial or desired results include clinical results such as decreasing one or more symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, enhancing effect of another medication such as via targeting, delaying the progression of the disease, and/or prolonging survival.
- an effective amount of the drug may have the effect in reducing pathogen (bacterium, virus, etc.) titres in the circulation or tissue; reducing the number of pathogen infected cells; inhibiting (i.e., slow to some extent or desirably stop) pathogen infection of organs; inhibit (i.e., slow to some extent and desirably stop) pathogen growth; and/or relieving to some extent one or more of the symptoms associated with the infection.
- an effective amount can be administered in one or more administrations.
- an effective amount of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
- an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
- an “effective amount” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
- RNA transcript e.g ., mRNA, antisense RNA, siRNA, shRNA, miRNA, etc.
- expression of a coding sequence results from transcription and translation of the coding sequence.
- expression of a non coding sequence results from the transcription of the non-coding sequence.
- infection refers to invasion of body tissues by disease-causing microorganisms, their multiplication and the reaction of body tissues to these microorganisms and the toxins they produce. “Infection” includes but are not limited to infections by viruses, prions, bacteria, viroids, parasites, protozoans and fungi. In the context of the present invention, however, “infection” generally refers to virus infection of the family Coronavitidae (e.g., coronaviruses).
- Coronavitidae e.g., coronaviruses
- “instructional material” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the invention.
- the instructional material of the kit of the invention may, for example, be affixed to a container which contains the therapeutic or diagnostic agents of the invention or be shipped together with a container which contains the therapeutic or diagnostic agents of the invention.
- patient refers to any subject, particularly a vertebrate subject, and even more particularly a mammalian subject, for whom therapy or prophylaxis is desired.
- Suitable vertebrate animals that fall within the scope of the invention include, but are not restricted to, any member of the subphylum Chordata including primates (e.g., humans, monkeys and apes, and includes species of monkeys such from the genus Macaca (e.g., cynomologus monkeys such as Macaca fascicularis, and/or rhesus monkeys ( Macaca mulatta)) and baboon (Papio ursinus), as well as marmosets (species from the genus Callithrix), squirrel monkeys (species from the genus Saimiri) and tamarins (species from the genus Saguinus), as well as species of apes such as chimpanzees ( Pan troglodytes)), rodents (e.g., mice rats, guinea pigs), lagomorphs (e.g., rabbits, hares), bovines (e.g., cattle),
- composition or “pharmaceutical formulation” refers to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the composition or formulation would be administered. Such formulations are sterile. “Pharmaceutically acceptable” excipients (vehicles, additives) are those which can reasonably be administered to a subject mammal to provide an effective dose of the active ingredient employed.
- the terms “prevent”, “prevented”, or “preventing”, refer to a prophylactic treatment which increases the resistance of a subject to developing the disease or condition or, in other words, decreases the likelihood that the subject will develop the disease or condition as well as a treatment after the disease or condition has begun in order to reduce or eliminate it altogether or prevent it from becoming worse. These terms also include within their scope preventing the disease or condition from occurring in a subject which may be predisposed to the disease or condition but has not yet been diagnosed as having it.
- sequence identity refers to the extent that sequences are identical on a nucleotide-by-nucleotide basis or an amino acid-by-amino acid basis over a window of comparison.
- a “percentage of sequence identity” is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, I) or the identical amino acid residue (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, lie, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gin, Cys, and Met) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
- the identical nucleic acid base e.g., A, T, C, G, I
- the identical amino acid residue e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, lie, Phe, Tyr, Trp, Lys, Arg
- sequence identity will be understood to mean the “match percentage” calculated by an appropriate method.
- sequence identity analysis may be carried out using the DNASIS computer program (Version 2.5 for windows; available from Hitachi Software engineering Co., Ltd., South San Francisco, California, USA) using standard defaults as used in the reference manual accompanying the software.
- small molecule refers to a compound that has a molecular weight of less than 3 kilodalton (kDa), and typically less than 1 .5 kDa, and more preferably less than about 1 kDa.
- Small molecules may be nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic (carbon-containing) or inorganic molecules.
- extensive libraries of chemical and/or biological mixtures often fungal, bacterial, or algal extracts, may be screened with any of the assays of the invention to identify compounds that modulate a bioactivity.
- a “small organic molecule” is an organic compound (or organic compound complexed with an inorganic compound (e.g., metal)) that has a molecular weight of less than 3 kDa, less than 1.5 kDa, or even less than about 1 kDa.
- “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured DNA to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridisable sequence, the higher the relative temperature which can pbe used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).
- “Stringent conditions” or “high stringency conditions”, as defined herein, can be identified by those that: (1) employ low ionic strength and high temperature for washing, for example 15 mM sodium chloride/1.5 mM sodium citrate/0.1% sodium dodecyl sulphate at 50 e C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42 e C; or (3) overnight hybridization in a solution that employs 50% formamide, 5 x SSC (0.75 M NaCI, 75 mM sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5 x Denhardt's solution, sonicated salmon sperm DNA (50 pg/mL
- treatment refers to clinical intervention designed to alter the natural course of the individual or cell being treated during the course of clinical pathology. Desirable effects of treatment include decreasing the rate of disease progression, ameliorating or palliating the disease state, and remission or improved prognosis.
- an individual is successfully “treated” if one or more symptoms associated with a T cell dysfunctional disorder are mitigated or eliminated, including, but are not limited to, reducing the proliferation of (or destroying) cancerous cells, reducing pathogen infection, decreasing symptoms resulting from the disease, increasing the quality of life of those suffering from the disease, decreasing the dose of other medications required to treat the disease, and/or prolonging survival of individuals.
- underscoring or italicizing the name of a gene shall indicate the gene, in contrast to its protein product, which is indicated by the name of the gene in the absence of any underscoring or italicizing.
- ACE2 shall mean the ACE2 gene
- ACE2 shall indicate the protein product or products generated from transcription and translation and/or alternative splicing of the ACE2 gene.
- the present invention is based in part on the determination that the SARS- CoV virus utilises host machinery in order to obtain entry into a host cell, and that these essential host machinery are regulated at the post-translational level and the transcriptional level by methylation and ubiquitination.
- the post-translational methylation/demethylation plays a critical role in at least two levels: (1) regulation of the ACE2 protein interaction with the nuclear transporter, importin-a (IMPa) protein and therefore, nuclear translocation; and (2) regulation of ubiquitination of the ACE2 protein, which signals for protein for proteasomal degradation.
- ACE2 peptides which include a sequence that corresponds to one or more methylation/demethylation sites of the wild-type ACE2 protein will result in reduced ability for SARS-CoV to enter into a host cell, thus providing a novel treatment for coronavirus infections.
- the ACE2 peptides which include an amino acid sequence that corresponds to the nuclear localisation motif of the wild-type ACE2 protein, which result in inhibition of the interaction between ACE2 and IMPa.
- methods and compositions are provided that take advantage of these ACE2 peptides to reduce or abrogate the transcription of integral cellular machinery required for a coronavirus entry into a cell, as well as to attenuate the signalling of ACE2 protein to the proteasome.
- the ACE2 peptide is used in combination with an additional antiviral agent.
- the methods and compositions of the present invention are thus particularly useful in the treatment or prophylaxis of a coronavirus infection (e.g., a SARS-CoV-2 infection), as described hereafter.
- the present invention is based in part of the determination that the C- terminal tail region of the ACE2 protein plays a pivotal role in its nuclear translocation from the cell surface.
- the present inventors have also determined that when proteinaceous molecules (e.g., peptides and/or polypeptides) comprising an amino acid sequence that corresponds to the ACE2 protein C-terminal tail region sequence are administered to a subject, these molecules are surprisingly effective as a treatment (including preventative treatment) of a SARS-CoV infection.
- This activity results, at least in part, from a number of functional capabilities of the ACE2 peptides, including but not limited to: (1) inhibiting the nuclear translocation of the host cell ACE2 protein; (2) inhibiting the ubiquitination of the host cell ACE2 protein; (3) preventing an interaction between an ACE2 peptide or polypeptide and/or an IMPa polypeptide.
- the ACE2 peptide comprises an amino acid sequence that corresponds to at least a portion of the wild-type human ACE2 protein.
- the wild-type human ACE2 protein amino acid sequence is that deposited under UniProt Accession No. Q9BYF1 , as set forth below:
- the ACE2 peptide comprises, consists, or consists essentially of an amino acid sequence that corresponds to the C-terminal tail region (i.e., residues 763-805) of the full-length human ACE2 protein sequence (as set forth in SEQ ID NO: 1 ), or a fragment thereof.
- the ACE2 peptide includes one or more lysine methylation site(s).
- lysine residues K26, K353, K769, K770, and K771 of the full-length human ACE2 protein sequence are identified as methylation residues, which are shown herein as being LSD-1 -mediated methylated/demethylated resides.
- the present invention provides a proteinaceous molecule that comprises an ACE2 peptide comprising one or more methylation site(s) corresponding to K26, K353, K769, K770, and K771 of the full-length wild-type human ACE2 protein.
- the proteinaceous molecule comprises an ACE2 peptides comprising one, two or all of the methylation sites corresponding to residues K769, K770, and K771 of the full-length ACE2 protein.
- the ACE2 peptide also comprises an amino acid residue corresponding to residue K773 of the wild-type human ACE2 protein, which may be a further methylation site.
- At least one of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein is methylated. In some embodiments, at least two of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein is methylated. In some embodiments, at least three of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein are methylated. In some embodiments, each of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein are methylated. In some preferred embodiments, amino acids corresponding to residues K769, K770, and K771 are all methylated.
- At least one of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein is acetylated. In some embodiments, at least two of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein is acetylated. In some embodiments, at least three of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein are acetylated.
- each of the amino acids corresponding to K769, K770, K771 , and K773 of the full-length ACE2 protein are acetylated. In some preferred embodiments, amino acids corresponding to residues K769, K770, and K771 are all acetylated.
- the ACE2 peptides comprise a residue that corresponds to a ubiquitination site of the wild-type human ACE2 protein.
- protein degradation is well known to be regulated by ubiquitination, and protein methylation has previously been reported as a precursor for protein ubiquitination.
- preventing or reducing demethylation of host ACE2 protein serves as a mechanism to increase ubiquitination of the protein, and thus stimulate degradation of the protein.
- Such regulation has previously been observed, for example, with respect to DNMT1 key epigenetic enzyme stability by LSD-1 (see, Yang, Epigenetics ).
- the ACE2 peptide may also comprise an amino acid residue that corresponds to amino acid residue K788 of the full length wild-type human ACE2 protein.
- the ACE2 polypeptide may comprise, consist, or consist essentially of the amino acid sequence selected from: DISKGENNPGFQNTDDVQTSF; ASIDISKGENNPGFQNTDD; or VQTSFDISKGENNPGFQNTDDVQTSF).
- the proteinaceous molecules prevent or otherwise reduce the binding of an ACE2 polypeptide to an importin-a (IMPa) polypeptide.
- the proteinaceous molecules of this type may comprise, consist or consist essentially of any of the ACE2 peptides as described above.
- the ACE2 peptide may comprise the amino acid sequence TGIRDRKKKNKARS [SEQ ID NO: 3].
- the ACE2 peptide may comprise, consist, or consist essentially of an amino acid sequence corresponding to an IMP-a binding region of the wild-type human ACE2 protein (e.g., residues 774 to 787 of the sequence set forth in SEQ ID NO: 1).
- the ACE2 peptide comprises, consists, or consists essentially of the amino acid sequence ARSGENPYASIDIS.
- the proteinaceous molecules of the invention generally comprise, consist, or consist essentially of an amino acid sequence represented by Formula III:
- Xi is selected from any small or polar amino acid (preferably, a T or S amino acid), or modified forms thereof;
- X2 is selected from a D or N amino acid, or modified forms thereof;
- X 3 , X 4 , and X 5 are each independently selected from K and Q amino acids, or modified forms thereof;
- X 6 is selected from any polar amino acid (e.g., an N, K, or D amino acid), or a modified form thereof;
- X is selected from a K or Q amino acid, or a modified form thereof
- X 8 is selected from an R, G, or S amino acid, or a modified form thereof.
- the ACE2 peptide comprises, consists, or consists essentially of an amino acid sequence that comprises: TGIRDRKKKNKARS.
- Such proteinaceous molecules suitably inhibit or reduce the interaction between an ACE2 protein and IMPa.
- peptides of this type reduce the nuclear localisation of ACE2 protein. This results in a lower level of nuclear ACE2 protein in a cell.
- the present invention provides ACE2 peptides in compositions and methods for preventing or reducing the coronavirus entry into a host cell.
- the present invention also provides compositions and methods for preventing or reducing the replication of a coronavirus in a cell of a subject.
- the ACE2 peptides are suitably combined with a pharmaceutically acceptable carrier or diluent.
- a pharmaceutically acceptable carrier or diluent for example, a pharmaceutically acceptable carrier or diluent.
- the ACE2 peptides of the present invention can be administered by any suitable route including, for example, by injection, by topical or mucosal application, by inhalation, or via the oral route including modified-release modes of administration to treat or prevent a coronavirus infection in a subject.
- the ACE2 peptides are obtained using recombinant DNA techniques or by chemical synthesis.
- the ACE2 peptides may be obtained (e.g., purified or isolated) from a mammalian cell sample.
- the ACE2 peptides of the present invention include peptides or polypeptides which arise as a result of the existence of alternative translational and post- translational events.
- the ACE2 peptides can be expressed in systems (e.g., cultured cells, which result in substantially the same post-translational modifications present when the ACE2 protein is expressed in a native cell, or in systems which result in the alteration or omission of post-translational modifications (e.g., glycosylation or cleavage) present when expressed in a native cell.
- the present invention contemplates full-length ACE2 polypeptides as well as their biologically active fragments.
- biologically active fragments of a full-length ACE2 polypeptide may participate in an interaction, for example, an intramolecular or an inter-molecular interaction (e.g., an interaction between an IMPa polypeptide).
- biologically active fragments include peptides comprising amino acid sequences sufficiently similar to or derived from the amino acid sequences of a (putative) full-length ACE2 polypeptide, for example, the amino acid sequences shown in SEQ ID NO: 1.
- a biologically active fragment of a full-length ACE2 peptide can be a peptide which is, for example, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
- the ACE2 peptide inhibitors contain a sequence that corresponds to lysine residue 31 of the wild-type human ACE2 sequence.
- This lysine residue is an integral methylation/demethylation site of the ACE2 polypeptide, the demethylation of which is necessary for interaction with the viral spike protein.
- the lysine 31 demethylation motif of ACE2 is important for SARS-CoV-2 replication, and thus peptide inhibitors corresponding to this lysine residue have antiviral activity by significantly reducing spike protein co-localization with ACE2.
- the invention provides proteinaceous molecules comprising a peptide with an amino acid sequence represented by Formula IV:
- Zi is absent or is selected from at least one of a proteinaceous moiety comprising from about 1 to about 50 amino acid residues, and/or a protecting moiety;
- Z 2 is absent or is selected from at least one of a proteinaceous moiety comprising from about 1 to about 50 amino acid residues.
- Z ⁇ may be absent, and Z 2 may comprise the amino acid sequence FNFIEAEDLFYQSSLASWNYNT.
- the proteinaceous molecule of comprises, consists, or consists essentially of, the amino acid sequence: IEEQAKTFLDKFNHEAEDLFYQSSLASWNYNT.
- Zi may comprise the amino acid sequence ST, and may be Z 2 absent. Accordingly, in some preferred embodiments, the proteinaceous molecule may comprise, consist, or consist essentially of the amino acid sequence STIEEQAKTFLDK.
- the peptide comprises, consists, or consists essentially of a peptide sequence according to Formula IV.
- the sequence comprises a polypeptide sequence according to Formula IV, with one or more single amino acid substitutions in the IEEQAKTFLDK region.
- a substitution of the lysine that corresponds to lysine 31 of the wild-type human ACE2 amino acid sequence is not tolerated. Accordingly the one or more substitutions may not occur at the lysine that corresponds to lysine 31 of the wild-type human ACE2 polypeptide sequence.
- the present invention also contemplates ACE2 peptides that are variants of wild-type or naturally-occurring ACE2 protein or their fragments.
- variant peptides include proteins derived from the native protein by deletion (so-called truncation) or addition of one or more amino acids to the N-terminal and/or C-terminal end of the native protein; deletion or addition of one or more amino acids at one or more sites in the native protein; or substitution of one or more amino acids at one or more sites in the native protein.
- Variant proteins encompassed by the present invention are biologically active, that is, they continue to possess a desired biological activity of the native protein (e.g., binding to an LSD1 polypeptide; or binding to an IMP a polypeptide). Such variants may result from, for example, genetic polymorphism or from human manipulation.
- An ACE2 peptide or polypeptide may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants of ACE2 peptides or polypeptides can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art (see, for example, Kunkel (1985, Proc. Natl. Acad. Sci. USA. 82: 488-492), Kunkel et al., (1987, Methods in Enzymol, 154: 367-382), U.S. Pat. No. 4,873,192, Watson, J. D.
- Recursive ensemble mutagenesis (REM), a technique which enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify ACE2 variants (see, Arkin and Yourvan (1992) Proc. Natl. Acad. Sci. USA 89: 7811 -7815; Delgrave et al., (1993) Protein Engineering, 6: 327-331 ). Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be desirable as discussed in more detail below.
- Variant ACE2 peptides or polypeptides may contain conservative amino acid substitutions at various locations along their sequence, as compared to a parent (e.g., naturally-occurring or reference) ACE2 amino acid sequence.
- a “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, which can be generally sub-classified as follows:
- Acidic The residue has a negative charge due to loss of H ion at physiological pH and the residue is attracted by aqueous solution so as to seek the surface positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium at physiological pH.
- Amino acids having an acidic side chain include glutamic acid and aspartic acid.
- Basic The residue has a positive charge due to association with H ion at physiological pH or within one or two pH units thereof (e.g., histidine) and the residue is attracted by aqueous solution so as to seek the surface positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium at physiological pH.
- Amino acids having a basic side chain include arginine, lysine and histidine.
- the residues are charged at physiological pH and, therefore, include amino acids having acidic or basic side chains (i.e., glutamic acid, aspartic acid, arginine, lysine and histidine).
- amino acids having acidic or basic side chains i.e., glutamic acid, aspartic acid, arginine, lysine and histidine.
- Hydrophobic The residues are not charged at physiological pH and the residue is repelled by aqueous solution so as to seek the inner positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium.
- Amino acids having a hydrophobic side chain include tyrosine, valine, isoleucine, leucine, methionine, phenylalanine and tryptophan.
- Neutral/polar The residues are not charged at physiological pH, but the residue is not sufficiently repelled by aqueous solutions so that it would seek inner positions in the conformation of a peptide in which it is contained when the peptide is in aqueous medium.
- Amino acids having a neutral/polar side chain include asparagine, glutamine, cysteine, histidine, serine and threonine.
- amino acids having a small side chain include glycine, serine, alanine and threonine.
- the gene-encoded secondary amino acid proline is a special case due to its known effects on the secondary conformation of peptide chains.
- proline differs from all the other naturally-occurring amino acids in that its side chain is bonded to the nitrogen of the a-amino group, as well as the a-carbon.
- amino acid similarity matrices e.g., PAM120 matrix and PAM250 matrix as disclosed for example by Dayhoff et al., (1978), A model of evolutionary change in proteins. Matrices for determining distance relationships In M. O. Dayhoff, (ed.), Atlas of protein sequence and structure, Vol. 5, pp.
- proline in the same group as glycine, serine, alanine and threonine. Accordingly, for the purposes of the present invention, proline is classified as a “small” amino acid.
- Amino acid residues can be further sub-classified as cyclic or non-cyclic, and aromatic or non-aromatic, self-explanatory classifications with respect to the side-chain substituent groups of the residues, and as small or large.
- the residue is considered small if it contains a total of four carbon atoms or less, inclusive of the carboxyl carbon, provided an additional polar substituent is present; three or less if not.
- Small residues are, of course, always non-aromatic.
- amino acid residues may fall in two or more classes. For the naturally-occurring protein amino acids, sub-classification according to this scheme is presented in Table 2.
- Conservative amino acid substitution also includes groupings based on side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide-containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulphur-containing side chains is cysteine and methionine.
- Amino acid substitutions falling within the scope of the invention are, in general, accomplished by selecting substitutions that do not differ significantly in their effect on maintaining (a) the structure of the peptide backbone in the area of the substitution, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. After the substitutions are introduced, the variants are screened for biological activity.
- amino acids for making conservative substitutions can be grouped into three categories based on the identity of the side chains.
- the first group includes glutamic acid, aspartic acid, arginine, lysine, histidine, which all have charged side chains;
- the second group includes glycine, serine, threonine, cysteine, tyrosine, glutamine, asparagine;
- the third group includes leucine, isoleucine, valine, alanine, proline, phenylalanine, tryptophan, methionine, as described in Zubay, G., Biochemistry, third edition, Wm:C. Brown Publishers (1993).
- a predicted non-essential amino acid residue in an ACE2 peptide or polypeptide is typically replaced with another amino acid residue from the same side chain family.
- mutations can be introduced randomly along all or part of an ACE2 gene coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for an activity of the parent polypeptide, as described for example herein, to identify mutants which retain that activity.
- the encoded peptide or polypeptide can be expressed recombinantly and its activity determined.
- a “nonessential” amino acid residue is a residue that can be altered from the wild-type sequence of an embodiment peptide or polypeptide without abolishing or substantially altering one or more of its activities.
- the alteration does not substantially alter one of these activities, for example, the activity is at least 20%, 40%, 60%, 70% or 80% of wild-type.
- an “essential” amino acid residue is a residue that, when altered from the wild-type sequence of a reference ACE2 peptide or polypeptide, results in abolition of an activity of the parent molecule such that less than 20% of the wild- type activity is present.
- such essential amino acid residues include those that are conserved in ACE2 peptides or polypeptides across different species.
- the present invention also contemplates as ACE2 peptides or polypeptides, variants of the naturally-occurring ACE2 polypeptide sequences or their biologically-active fragments, wherein the variants are distinguished from the naturally- occurring sequence by the addition, deletion, or substitution of one or more amino acid residues.
- variants will display at least about 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69% 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% similarity to a parent or reference ACE2 peptide or polypeptide sequence as, for example, set forth in SEQ ID NO: 1 , as determined by sequence alignment programs described elsewhere herein using default parameters.
- variants will have at least 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69% 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to a parent ACE2 peptide or polypeptide sequence as, for example, set forth in SEQ ID NO: 1 , as determined by sequence alignment programs described elsewhere herein using default parameters.
- variants of a wild-type ACE2 polypeptide may differ from the wild-type molecule generally by as much 15, 14, 13, 12, or 11 amino acid residues or suitably by as few as 10, 9, 8, 7, 6, 54, 3, 2, or 1 amino acid residue(s).
- a variant polypeptide differs from the corresponding sequences in SEQ ID NO: 1 by at least 1 but by less than or equal to 15, 14, 13, 12, 11 , 10, 9, 8, 7, 6, 5, 4, 3, or 2 amino acid residues.
- it differs from the corresponding sequence in any one of SEQ ID NO: 1 by at least one 1% but less than or equal to 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, or 2% of the residues. If the sequence comparison requires alignment, the sequences are typically aligned for maximum similarity or identity. “Looped” out sequences from deletions or insertions, or mismatches, are generally considered differences. The differences are, suitably, differences or changes at a non-essential residue or a conservative substitution, as discussed in more detail below.
- the ACE2 peptides of the present invention also encompass ACE2 peptide or polypeptides comprising amino acids with modified side chains, incorporation of unnatural amino acid residues and/or their derivatives during peptide, polypeptide or protein synthesis and the use of cross-linkers and other methods which impose conformational constraints on the peptides, portions, and variants of the invention.
- side chain modifications include modifications of amino groups such as by acylation with acetic anhydride; acylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; amidination with methylacetimidate; carbamoylation of amino groups with cyanate; pyridoxylation of lysine with pyridoxal-5-phosphate followed by reduction with NaBRt; reductive alkylation by reaction with an aldehyde followed by reduction with NaBhU; and trinitrobenzylation of amino groups with 2, 4, 6-trinitrobenzene sulphonic acid (TNBS).
- modifications of amino groups such as by acylation with acetic anhydride; acylation of amino groups with succinic anhydride and tetrahydrophthalic anhydride; amidination with methylacetimidate; carbamoylation of amino groups with cyanate; pyridoxylation of lysine with pyridoxal-5-phosphate followed by reduction with NaBRt; reductive
- the carboxyl group may be modified by carbodiimide activation via O- acylisourea formation followed by subsequent derivatization, by way of example, to a corresponding amide.
- the guanidine group of arginine residues may be modified by formation of heterocyclic condensation products with reagents such as 2,3-butanedione, phenylglyoxal and glyoxal.
- Sulphydryl groups may be modified by methods such as performic acid oxidation to cysteic acid; formation of mercurial derivatives using 4- chloromercuriphenylsulphonic acid, 4-chloromercuribenzoate; 2-chloromercuri-4-nitrophenol, phenylmercury chloride, and other mercurials; formation of a mixed disulphides with other thiol compounds; reaction with maleimide, maleic anhydride or other substituted maleimide; carboxymethylation with iodoacetic acid or iodoacetamide; and carbamoylation with cyanate at alkaline pH.
- Tryptophan residues may be modified, for example, by alkylation of the indole ring with 2-hydroxy-5-nitrobenzyl bromide or sulphonyl halides or by oxidation with N- bromosuccinimide.
- Tyrosine residues may be modified by nitration with tetranitromethane to form a 3-nitrotyrosine derivative.
- the imidazole ring of a histidine residue may be modified by N- carbethoxylation with diethylpyrocarbonate or by alkylation with iodoacetic acid derivatives.
- Examples of incorporating unnatural amino acids and derivatives during peptide synthesis include but are not limited to, use of 4-amino butyric acid, 6- aminohexanoic acid, 4-amino-3 -hydroxy- 5 -phenylpentanoic acid, 4-amino-3-hydroxy-6- methylheptanoic acid, t-butylglycine, norleucine, norvaline, phenylglycine, ornithine, sarcosine, 2-thienyl alanine and/or D-isomers of amino acids.
- Table 4 A list of unnatural amino acids contemplated by the present invention is shown in Table 4.
- the ACE2 peptides of the present invention also include those that are encoded by polynucleotides that hybridize under stringency conditions as defined herein, especially medium or high stringency conditions, to ACE2-encoding polynucleotide sequences, or the non-coding strand thereof, as described below.
- An illustrative ACE2 polynucleotide sequence is set forth below:
- the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes).
- the length of a reference sequence aligned for comparison purposes is at least 30%, usually at least 40%, more usually at least 50%, 60%, and even more usually at least 70%, 80%, 90%, 100% of the length of the reference sequence.
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared.
- the percent identity between the two sequences is a function of the number of identical amino acid residues shared by the sequences at individual positions, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the percent similarity between the two sequences is a function of the number of identical and similar amino acid residues shared by the sequences at individual positions, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
- the comparison of sequences and determination of percent identity or percent similarity between sequences can be accomplished using a mathematical algorithm.
- the percent identity or similarity between amino acid sequences is determined using the Needleman and Wunsch, (1970, J. Mol. Biol. 48: 444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at http://www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1 , 2, 3, 4, 5, or 6.
- the percent identity between nucleotide sequences is determined using the GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1 , 2, 3, 4, 5, or 6.
- An non-limiting set of parameters includes a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
- the percent identity or similarity between amino acid or nucleotide sequences can be determined using the algorithm of E. Meyers and W. Miller (1989, Cabios, 4: 1 1-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- nucleic acid and protein sequences described herein can be used as a “query sequence” to perform a search against public databases to, for example, identify other family members or related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al., (1990, J. Mol. Biol, 215: 403-10).
- Gapped BLAST can be utilized as described in Altschul et al., (1997, Nucleic Acids Res, 25: 3389-3402).
- the default parameters of the respective programs e.g., XBLAST and NBLAST.
- Variants of a reference ACE2 peptide or polypeptide can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of an ACE2 peptide or polypeptide. Libraries or fragments e.g., N-terminal, C-terminal, or internal fragments, of an ACE2 coding sequence can be used to generate a variegated population of fragments for screening and subsequent selection of variants of a reference ACE2.
- the ACE2 peptides and polypeptides of the present invention may be prepared by any suitable procedure known to those of skill in the art.
- the ACE2 peptides or polypeptides may be produced by any convenient method such as by purifying the peptides or polypeptides from naturally-occurring reservoir. Methods of purification include size exclusion, affinity or ion exchange chromatography/separation. The identity and purity of derived ACE2 peptides is determined for example by SDS-polyacrylamide gel electrophoresis (SDS-PAGE) or chromatographically such as by high performance liquid chromatography (HPLC).
- SDS-PAGE SDS-polyacrylamide gel electrophoresis
- HPLC high performance liquid chromatography
- the ACE2 peptides or polypeptides may be synthesized by chemical synthesis, e.g., using solution synthesis or solid phase synthesis as described, for example, in Chapter 9 of Atherton and Shephard (supra) and in Roberge et al., (1995, Science, 269: 202).
- the ACE2 peptides or polypeptides are prepared by recombinant techniques.
- the ACE2 peptides or polypeptides of the invention may be prepared by a procedure including the steps of: (a) preparing a construct comprising a polynucleotide sequence that encodes an ACE2 peptide or polypeptide and that is operably linked to a regulatory element; (b) introducing the construct into a host cell; (c) culturing the host cell to express the polynucleotide sequence to thereby produce the encoded ACE2 peptide or polypeptide; and (d) isolating the ACE2 peptide or polypeptide from the host cell.
- the nucleotide sequence encodes at least a biologically active portion of the sequences set forth in SEQ ID NO: 3, or a variant thereof.
- Recombinant ACE2 peptides or polypeptides can be conveniently prepared using standard protocols as described for example in Sambrook, et al., (1989, supra), in particular Sections 16 and 17; Ausubel et al., (1994, supra), in particular Chapters 10 and 16; and Coligan et al., Current Protocols in Protein Science (John Wiley & Sons, Inc. 1995-1997), in particular Chapters 1 , 5 and 6.
- the ACE2 peptides are homologues or orthologues to the wild- type human ACE2 amino acid sequences. Although a high degree of sequence identity exists between orthologues, there is some tolerance for variant amino acid residues at several residues of the C-terminal tail.
- the ACE2 peptide may comprise any one of the following sequences: an ACE2 peptide from human
- TGIRDRRKKKQASTEENPYGSVDLSKGENNSGFQNGDDVQTSF or a fragment thereof; an ACE2 peptide from Macaca fascicularis (TGIRDRKKKNQARSEENPYASIDINKGENNPGFQNTDDVQTSF).
- the ACE2 peptide comprises an amino acid sequence that corresponds to the ACE2 protein NLS amino acid sequence from human ACE2 (DRKKKNKARS); the NLS peptide from Myotis lucifugus ACE2 (DRKKKKQAGN); Feiis cat us ACE2 (NRRKNNQARS); Canis lupus familiaris ACE2 (NRRKNDQARG); Camelus ferns ACE2 (DRRKKKQAST); or Macaca fascicularis ACE2 (DRKKKNQARS).
- Exemplary nucleotide sequences that encode the ACE2 peptides and polypeptides of the invention encompass full-length ACE2 genes as well as portions of the full-length or substantially full-length nucleotide sequences of the ACE2 genes or their transcripts or ACE2 copies of these transcripts. Portions of an ACE2 nucleotide sequence may encode polypeptide portions or segments that retain a biological activity of the native polypeptide (e.g., nuclear translocation).
- a portion of an ACE2 nucleotide sequence that encodes a biologically active fragment of an ACE2 polypeptide may encode at least about 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, or more contiguous amino acid residues, or almost up to the total number of amino acids present in a full-length ACE2 polypeptide.
- the invention also contemplates variants of the ACE2 nucleotide sequences.
- Nucleic acid variants can be naturally-occurring, such as allelic variants (same locus), homologues (different locus), and orthologues (different organism) or can be non- naturally occurring.
- Naturally occurring nucleic acid variants also referred to herein as polynucleotide variants
- Non-naturally occurring polynucleotide variants can be made by mutagenesis techniques, including those applied to polynucleotides, cells, or organisms.
- the variants can contain nucleotide substitutions, deletions, inversions and insertions.
- Variation can occur in either or both the coding and non-coding regions.
- the variations can produce both conservative and non-conservative amino acid substitutions (as compared in the encoded product).
- conservative variants include those sequences that, because of the degeneracy of the genetic code, encode the amino acid sequence of a reference ACE2 peptide or polypeptide.
- Variant nucleotide sequences also include synthetically derived nucleotide sequences, such as those generated, for example, by using site-directed mutagenesis but which still encode an ACE2 peptide or polypeptide.
- variants of a particular ACE2 nucleotide sequence will have at least about 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69% 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to that particular nucleotide sequence as determined by sequence alignment programs described elsewhere herein using default parameters.
- the ACE2 nucleotide sequence displays at least about 40%, 45%, 50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59% 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69% 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, .80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the nucleotide sequence of SEQ ID NO: 2, or its complement.
- ACE2 nucleotide sequences can be used to isolate corresponding sequences and alleles from other organisms, particularly other virus hosts. Methods are readily available in the art for the hybridization of nucleic acid sequences. Coding sequences from other organisms may be isolated according to well-known techniques based on their sequence identity with the coding sequences set forth herein. In these techniques all or part of the known coding sequence is used as a probe which selectively hybridizes to other ACE2-coding sequences present in a population of cloned genomic DNA fragments or cDNA fragments (i.e., genomic or cDNA libraries) from a chosen organism (e.g., a mammal).
- the present invention also contemplates polynucleotides that hybridize to reference ACE2 nucleotide sequences, or to their complements under stringency conditions described below.
- the term “hybridizes under low stringency, medium stringency, high stringency, or very high stringency conditions” describes conditions for hybridization and washing.
- Guidance for performing hybridization reactions can be found in Ausubel et al., (1998, supra), Sections 6.3.1 -6.3.6. Aqueous and non-aqueous methods are described in that reference and either can be used.
- Reference herein to low stringency conditions include and encompass from at least about 1% v/v to at least about 15% v/v formamide and from at least about 1 M to at least about 2 M salt for hybridization at 42°C, and at least about 1 M to at least about 2 M salt for washing at 42°C.
- Low stringency conditions also may include 1% Bovine Serum Albumin (BSA), 1 mM EDTA, 0.5 M NaHP0 4 (pH 7.2), 7% SDS for hybridization at 65°C, and (i) 2 x SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHP0 4 pH 7.2), 5% SDS for washing at room temperature.
- BSA Bovine Serum Albumin
- low stringency conditions includes hybridization in 6 x sodium chloride/sodium citrate (SSC) at about 45°C, followed by two washes in 0.2 x SSC, 0.1% SDS at least at 50°C (the temperature of the washes can be increased to 55°C for low stringency conditions).
- Medium stringency conditions include and encompass from at least about 16% v/v to at least about 30% v/v formamide and from at least about 0.5 M to at least about 0.9 M salt for hybridization at 42°C, and at least about 0.1 M to at least about 0.2 M salt for washing at 55°C.
- Medium stringency conditions also may include 1% Bovine Serum Albumin (BSA), 1 mM EDTA, 0.5 M NaHPO (pH 7.2), 7% SDS for hybridization at 65°C, and (i) 2 x SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHP0 4 (pH 7.2), 5% SDS for washing at 60-65°C.
- BSA Bovine Serum Albumin
- 1 mM EDTA 1 mM EDTA, 0.5 M NaHPO (pH 7.2), 7% SDS for hybridization at 65°C
- 2 x SSC 0.1% SDS
- BSA Bovine Serum Albumin
- High stringency conditions include and encompass from at least about 31% v/v to at least about 50% v/v formamide and from about 0.01 M to about 0.15 M salt for hybridization at 42°C, and about 0.01 M to about 0.02 M salt for washing at 55°C.
- High stringency conditions also may include 1% BSA, 1 mM EDTA, 0.5 M NaHPC (pH 7.2), 7% SDS for hybridization at 65°C, and (i) 0.2 x SSC, 0.1% SDS; or (ii) 0.5% BSA, 1 mM EDTA, 40 mM NaHPC> 4 (pH 7.2), 1% SDS for washing at a temperature in excess of 65°C.
- One embodiment of high stringency conditions includes hybridizing in 6 x SSC at about 45°C, followed by one or more washes in 0.2 x SSC, 0.1% SDS at 65°C.
- an ACE2 peptide or polypeptide is encoded by a polynucleotide that hybridizes to a disclosed nucleotide sequence under very high stringency conditions.
- very high stringency conditions includes hybridizing 0.5 M sodium phosphate, 7% SDS at 65°C, followed by one or more washes at 0.2 x SSC, 1%
- T m 81 .5 + 16.6 (logTM M) + 0.41 (%G + C) - 0.63 (% formamide) - (600/length)
- T m of a duplex DNA decreases by approximately 1°C with every increase of 1% in the number of randomly mismatched base pairs. Washing is generally carried out at T m - 15°C for high stringency, or T m - 30°C for moderate stringency.
- a membrane e.g., a nitrocellulose membrane or a nylon membrane
- immobilized DNA is hybridized overnight at 42°C in a hybridization buffer (50% deionized formamide, 5 x SSC, 5 x Denhardt's solution (0.1% Ficoll, 0.1% polyvinylpyrrolidone and 0.1% BSA), 0.1% SDS and 200 mg/ml_ denatured salmon sperm DNA) containing labelled probe.
- a hybridization buffer 50% deionized formamide, 5 x SSC, 5 x Denhardt's solution (0.1% Ficoll, 0.1% polyvinylpyrrolidone and 0.1% BSA), 0.1% SDS and 200 mg/ml_ denatured salmon sperm DNA
- the membrane is then subjected to two sequential medium stringency washes (i.e., 2 x SSC, 0.1% SDS for 15 min at 45°C, followed by 2 x SSC, 0.1% SDS for 15 min at 50°C), followed by two sequential higher stringency washes (i.e., 0.2 x SSC, 0.1% SDS for 12 min at 55°C followed by 0.2 x SSC and 0.1% SDS solution for 12 min at 65-68°C.
- 2 x SSC 0.1% SDS for 15 min at 45°C
- 2 x SSC 0.1% SDS for 15 min at 50°C
- two sequential higher stringency washes i.e., 0.2 x SSC, 0.1% SDS for 12 min at 55°C followed by 0.2 x SSC and 0.1% SDS solution for 12 min at 65-68°C.
- an ACE2 “chimeric protein” or “fusion protein” includes an ACE2 peptide or polypeptide linked to a non-ACE2 peptide or polypeptide.
- a “non-ACE2 peptide or polypeptide” refers to a peptide or polypeptide having an amino acid sequence corresponding to a protein which is different from native ACE2 and which is derived from the same or a different organism.
- the ACE2 peptide or polypeptide of the fusion protein can correspond to all or a portion e.g., a fragment described herein of an ACE2 polypeptide amino acid sequence.
- an ACE2 fusion protein includes at least one biologically active portion of an ACE2 polypeptide.
- the non-ACE2 peptide or polypeptide can be fused to the N-terminus or C-terminus of the ACE2 peptide or polypeptide.
- the fusion protein can include a moiety which has a high affinity for a ligand.
- the fusion protein can be a GST-ACE2 fusion protein in which the ACE2 sequence is fused to the C-terminus of the GST sequence.
- Such fusion proteins can facilitate the purification of recombinant ACE2 peptide or polypeptide.
- the fusion protein can be an ACE2 protein containing a heterologous signal sequence at its N- terminus. In certain host cells (e.g., mammalian host cells), expression and/or secretion of ACE2 peptides or polypeptides can be increased through use of a heterologous signal sequence.
- fusion proteins may include all or a part of a serum protein, e.g., an IgG constant region, or human serum albumin.
- the ACE2 fusion proteins of the invention can be incorporated into pharmaceutical compositions and administered to a subject in vivo. They can also be used to modulate the bioavailability of an ACE2 peptide or polypeptide.
- the C-terminal domain of the native ACE2 protein i.e., corresponding to amino acid residues 763-805 of the native human ACE2 protein as set forth in SEQ ID NO: 1 plays an important role in a number of activities important for SARS-CoV infection. Namely, these activities include: (i) facilitating virus entry (for example, by engaging the SARS-CoV Spike protein); (ii) nuclear translocation (by binding to the nuclear shuttle protein IMPa); and (iii) targeting the ACE2 protein for proteasomal degradation (through ubiquitination by E3 ligase).
- each of these functions is regulated directly or indirectly by the LSD1 -mediated methylation/demethylation of the methylation site(s) present on the C-terminal tail region of the ACE2 protein.
- prevention of SARS- CoV virus replication can be achieved using at least one ACE2 peptide as described above or elsewhere herein, or a polynucleotide from which one is expressible, and optionally an antiviral agent.
- bioactive agents selected from an ACE2 peptide or polypeptide; and optionally an antiviral agent are useful in compositions and methods for treating a coronavirus infection, and more particularly, for preventing or reducing coronavirus replication in a host cell. These compositions are useful, therefore, for treating or preventing a coronavirus infection.
- compositions suitable for use in the present invention include compositions wherein the bioactive agents are contained in an effective amount to achieve their intended purpose.
- the dose of active compound(s) administered to a patient should be sufficient to achieve a beneficial response in the patient over time such as a reduction in at least one symptom associated with the unwanted or deleterious immune response, which is suitably associated with a condition selected from an allergy, an autoimmune disease and a transplant rejection.
- the quantity or dose frequency of the pharmaceutically active compounds(s) to be administered may depend on the subject to be treated inclusive of the age, sex, weight and general health condition thereof. In this regard, precise amounts of the active compound(s) for administration will depend on the judgement of the practitioner.
- the practitioner may evaluate inflammation, pro-inflammatory cytokine levels, lymphocyte proliferation, cytolytic T lymphocyte activity and regulatory T lymphocyte function. In any event, those of skill in the art may readily determine suitable dosages of the antagonist and antigen.
- the bioactive agents are administered to a subject to be treated in a manner compatible with the dosage formulation, and in an amount that will be prophylactically and/or therapeutically effective.
- the amount of the composition to be delivered generally in the range of from 0.01 pg/kg to 100 pg/kg of bioactive molecule (e.g., ACE2 peptide, antiviral agent, etc.) per dose, depends on the subject to be treated.
- the ACE2 peptide- containing compositions will generally contain about 0.1% to 90%, about 0.5% to 50%, or about 1% to about 25%, by weight ACE2 the remainder being suitable pharmaceutical carriers and/or diluents etc and optionally the antiviral agent.
- the dosage of the inhibitor can depend on a variety of factors, such as mode of administration, the species of the affected subject, age and/or individual condition.
- antiviral agent-containing compositions will generally contain about 0.1% to 90%, about 0.5% to 50%, or about 1% to about 25%, by weight of antiviral agent, the remainder being suitable pharmaceutical carriers and/or diluents etc and the ACE2 peptide or polypeptide.
- the particles may be formulated and administered systemically, locally, or topically.
- Techniques for formulation and administration may be found in “Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, Pa., latest edition. Suitable routes may, for example, include oral, rectal, transmucosal, or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, transcutaneous, intradermal, intramedullary delivery (e.g., injection), as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular delivery (e.g., injection).
- the bioactive agents of the invention may be formulated in aqueous solutions, suitably in physiologically compatible buffers such as Hanks’ solution, Ringer’s solution, or physiological saline buffer.
- physiologically compatible buffers such as Hanks’ solution, Ringer’s solution, or physiological saline buffer.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- compositions of the present invention may be formulated for administration in the form of liquids, containing acceptable diluents (such as saline and sterile water), or may be in the form of lotions, creams or gels containing acceptable diluents or carriers to impart the desired texture, consistency, viscosity and appearance.
- acceptable diluents such as saline and sterile water
- Acceptable diluents and carriers are familiar to those skilled in the art and include, but are not restricted to, ethoxylated and nonethoxylated surfactants, fatty alcohols, fatty acids, hydrocarbon oils (such as palm oil, coconut oil, and mineral oil), cocoa butter waxes, silicon oils, pH balancers, cellulose derivatives, emulsifying agents such as non-ionic organic and inorganic bases, preserving agents, wax esters, steroid alcohols, triglyceride esters, phospholipids such as lecithin and cephalin, polyhydric alcohol esters, fatty alcohol esters, hydrophilic lanolin derivatives, and hydrophilic beeswax derivatives.
- ethoxylated and nonethoxylated surfactants include, but are not restricted to, ethoxylated and nonethoxylated surfactants, fatty alcohols, fatty acids, hydrocarbon oils (such as palm oil, coconut oil, and mineral oil), cocoa butter waxes, silicon
- the bioactive agents of the present invention can be formulated readily using pharmaceutically acceptable carriers well known in the art into dosages suitable for oral administration, which is also contemplated for the practice of the present invention.
- Such carriers enable the bioactive agents of the invention to be formulated in dosage forms such as tablets, pills, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a patient to be treated.
- These carriers may be selected from sugars, starches, cellulose and its derivatives, malt, gelatine, talc, calcium sulphate, vegetable oils, synthetic oils, polyols, alginic acid, phosphate buffered solutions, emulsifiers, isotonic saline, and pyrogen-free water.
- compositions for parenteral administration include aqueous solutions of the particles in water-soluble form. Additionally, suspensions of the bioactive agents may be prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides. Aqueous injection suspensions may contain substances that increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilisers or agents that increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- compositions for oral use can be obtained by combining the bioactive agents with solid excipients and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
- suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as., for example, maize starch, wheat starch, rice starch, potato starch, gelatine, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP).
- PVP polyvinylpyrrolidone
- disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- Such compositions may be prepared by any of the methods of pharmacy but all methods include the step of bringing into association one or more therapeutic agents as described above with the carrier which constitutes one or more necessary ingredients.
- the pharmaceutical compositions of the present invention may be manufactured in a manner that is itself known, e.g.. by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
- Dragee cores are provided with suitable coatings.
- suitable coatings may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
- Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of particle doses.
- compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
- the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
- the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
- stabilizers may be added.
- the bioactive agents of the present invention may be administered over a period of hours, days, weeks, or months, depending on several factors, including the severity of the condition being treated, whether a recurrence of the condition is considered likely, etc.
- the administration may be constant, e.g., constant infusion over a period of hours, days, weeks, months, etc.
- the administration may be intermittent, e.g., bioactive agents may be administered once a day over a period of days, once an hour over a period of hours, or any other such schedule as deemed suitable.
- bioactive agents of the present invention may also be administered to the respiratory tract as a nasal or pulmonary inhalation aerosol or solution for a nebulizer, or as a microfine powder for insufflation, alone or in combination with an inert carrier such as lactose, or with other pharmaceutically acceptable excipients.
- the route of particle delivery is via the gastrointestinal tract, e.g., orally.
- the particles can be introduced into organs such as the lung (e.g., by inhalation of powdered microparticles or of a nebulized or aerosolized solution containing the microparticles), where the particles are picked up by the alveolar macrophages, or may be administered intranasally or buccally.
- organs such as the lung (e.g., by inhalation of powdered microparticles or of a nebulized or aerosolized solution containing the microparticles), where the particles are picked up by the alveolar macrophages, or may be administered intranasally or buccally.
- a phagocytic cell phagocytoses the particle the ACE2 peptide and optionally the antiviral agent are released into the interior of the cell.
- the present inventors have determined that post-translational modifications play a significant role in the regulation of functional activity of the viral cell entry receptor polypeptides, particularly, the ACE2 protein. For example, a plurality of methylation sites are identified in both (i) the nuclear localisation sequence (NLS) of the ACE2 protein; and (ii) the catalytic domain of the ACE2 protein.
- NLS nuclear localisation sequence
- administering the ACE2 peptides of the invention reduces the demethylation activity asserted on the host ACE2 protein (e.g., through competitive inhibition of the LSD1 protein), which results in a number of advantageous activities (e.g., allowing ubiquitination of the ACE2 to signal for proteasomal degradation; inhibition/reduction of the ACE2 protein binding to IMPa; and thus, a reduction of the ACE2 protein nuclear translocation, etc).
- ACE2 peptides or proteinaceous molecules that comprise ACE2 peptide sequences
- the proteinaceous molecules of the invention prevent ACE2 nuclear translocation by inhibiting or reducing the binding of the ACE2 to IMPa.
- the present invention comprises a polypeptide that corresponds to the NLS of ACE2 (i.e., the amino acid sequence set for the in SEQ ID NO: 3).
- the present invention extends to a method of inhibiting the entry of a betacoronavirus into a cell of the host, the method comprising administering to the subject an ACE2 peptide as described above and/or elsewhere herein.
- the protein is targeted for proteasomal degradation (by subsequent ubiquitination by a E3 ligase) rather than being transported to the nucleus.
- the nuclear translation of the ACE2 protein is essential for ACE2 to assert its activity in viral replication of the SARS-CoV.
- the coronavirus is a SARS-CoV-2.
- proteinaceous molecules that inhibit LSD1 -mediated demethylation of the ACE2 protein are useful as actives and/or pharmaceutical compositions for treating or preventing a virus infection (e.g., a SARS-CoV infection).
- a virus infection e.g., a SARS-CoV infection
- treatment or prevention includes the prevention of incurring a symptom, holding in check such symptoms, or treating existing symptoms associated with the SARS-CoV infection, when administered to an individual in need thereof.
- the proteinaceous molecules of the invention that reduce the ACE2 nuclear localisation (e.g., by preventing the interaction between ACE2 and IMPa) when administered to a subject result in an increased expression of CD3 + Perforin + cells in the lung.
- administering these proteinaceous molecules to a subject (e.g., a mammal) with a SARS-CoV-2 infection results in a decrease in inflammation.
- the decrease in inflammation occurs in the lung of the subject.
- the subject is a mammal, and even more preferably, a human.
- any of the ACE2 peptides described above, or elsewhere herein, can be used in the compositions and methods of the present invention, provided that the inhibitor is pharmaceutically active.
- a “pharmaceutically active” ACE2 peptide is in a form that results in the treatment and/or prevention of a SARS-CoV infection, particularly a SARS-CoV-2 infection, including the prevention of incurring a symptom, holding in check such symptoms, or treating existing symptoms associated with the infection, when administered to an individual in need thereof.
- Modes of administration, amounts of ACE2 peptide administered, and ACE2 peptide formulations, for use in the methods of the present invention, are routine and within the skill of practitioners in the art. Whether a SARS-CoV infection, particularly a SARS-CoV-2 infection, has been treated is determined by measuring one or more diagnostic parameters indicative of the course of the disease, compared to a suitable control. In the case of an animal experiment, a “suitable control” is an animal not treated with the ACE2 peptide, or treated with the pharmaceutical composition without the ACE2 peptide.
- a “suitable control” may be the individual before treatment, or may be a human (e.g., an age-matched or similar control) treated with a placebo.
- the treatment of a SARS-CoV infection includes and encompasses without limitation: (1) preventing the uptake of a SARS-CoV virus (e.g ., a SARS-CoV-2 virus) into a cell of the host; (2) treating a SARS-CoV infection (e.g., a SARS- CoV-2 infection) in a subject; (3) preventing a SARS-CoV infection (e.g., a SARS-CoV-2 infection) in a subject that has a predisposition to the SARS-CoV infection but has not yet been diagnosed with the SARS-CoV infection and, accordingly, the treatment constitutes prophylactic treatment of the SARS-CoV infection; or (iii) causing regression of a SARS-CoV infection (e.g.,
- compositions and methods of the present invention are thus suitable for treating an individual who has been diagnosed with a coronavirus infection, who is suspected of having a SARS-CoV infection, who is known to be susceptible and who is considered likely to develop a SARS-CoV infection, or who is considered likely to develop a recurrence of a previously treated SARS-CoV infection.
- the coronavirus infection is a SARS-CoV-1 or a SARS-CoV-2 infection.
- the coronavirus infection is a SARS-CoV — 2 infection.
- the ACE2 peptide-containing compositions will generally contain about 0.000001% to 90%, about 0.0001% to 50%, or about 0.01% to about 25%, by weight of ACE2 peptide, the remainder being suitable pharmaceutical carriers or diluents etc.
- the dosage of the ACE2 peptide can depend on a variety of factors, such as mode of administration, the species of the affected subject, age, sex, weight and general health condition, and can be easily determined by a person of skill in the art using standard protocols.
- the dosages will also take into consideration the binding affinity of the ACE2 peptide to its target molecule (e.g., IMPa, LSD1 etc), its bioavailability and its in vivo and pharmacokinetic properties.
- precise amounts of the agents for administration can also depend on the judgment of the practitioner.
- the physician or veterinarian may evaluate the progression of the disease or condition over time.
- those of skill in the art may readily determine suitable dosages of the LSD1 inhibitor without undue experimentation.
- the dosage of the actives administered to a patient should be sufficient to effect a beneficial response in the patient over time such as impairment, abrogation or prevention in the uptake of the virus into a cell of the host, and/or in the treatment and/or prevention of a SARS-CoV infection (e.g., a coronavirus infection, for example, a SARS-CoV-2 infection).
- the dosages may be administered at suitable intervals to ameliorating the symptoms of the hematologic malignancy. Such intervals can be ascertained using routine procedures known to persons of skill in the art and can vary depending on the type of active agent employed and its formulation. For example, the interval may be daily, every other day, weekly, fortnightly, monthly, bimonthly, quarterly, half- yearly or yearly.
- Dosage amount and interval may be adjusted individually to provide plasma levels of the active agent, which are sufficient to maintain its inhibitory effects.
- Usual patient dosages for systemic administration range from 1-2000 mg/day, commonly from 1- 250 mg/day, and typically from 10-150 mg/day. Stated in terms of patient body weight, usual dosages range from 0.02-25 mg/kg/day, commonly from 0.02-3 mg/kg/day, typically from 0.2-1.5 mg/kg/day. Stated in terms of patient body surface areas, usual dosages range from 0.5-1200 mg/m 2 /day, commonly from 0.5-150 mg/m 2 /day, typically from 5-100 mg/m 2 /day.
- the present invention further contemplates administering the ACE2 peptide concurrently with at least one antiviral agent.
- the ACE2 peptide may be used therapeutically after the antiviral agent or may be used before the antiviral agent is administered or together with the antiviral agent.
- combination therapies which employ an ACE2 peptide and concurrent administration of an antiviral agent, non-limiting examples of which include: broad-spectrum antiviral agents and coronavirus-specific antivirus agents.
- the ACE2 peptides described above or elsewhere herein are particularly effective antiviral agents for mono-therapeutic or combined-therapeutic use in treating SARS-CoV infection.
- One of the benefits of such combination therapies is that lower doses of the other antiviral agents can be administered while still achieving a similar level of antiviral efficacy.
- Such lower dosages can be particularly advantageous for drugs known to have genotoxicity and mitochondrial toxicity (for example, some nucleoside analogues).
- greater efficacy might be achieved using therapeutic doses of two drugs than could be achieved using only a single drug.
- the antiviral agent is suitably selected from antimicrobials, which include without limitation compounds that kill or inhibit the growth of microorganisms (including viruses), and antiviral drugs.
- Illustrative antiviral drugs include abacavir sulphate, acyclovir sodium, amantadine hydrochloride, amprenavir, chloroquine, cidofovir, delavirdine mesylate, didanosine, efavirenz, favipiravir, famciclovir, fomivirsen sodium, foscarnet sodium, ganciclovir, hydroxychloroquine, hydroquinone.
- indinavir sulphate lamivudine, lamivudine/zidovudine, lopinavir, nelfinavir mesylate, nevirapine, oseltamivir phosphate, ribavirin, remdesivir, rimantadine hydrochloride, ritonavir, saquinavir, saquinavir mesylate, stavudine, valacyclovir hydrochloride, zalcitabine, zanamivir, and zidovudine.
- the ACE2 peptide may be co administered with an antimicrobial agent including chloroquine, hydroxychloroquine and/or hydroquinone.
- the antiviral agent comprises a recombinant IFN-y polypeptide (UniProt Accession No. P01574). In some embodiments of this type, the antiviral agent comprises at least a portion of an IFN- Y polypeptide, or a variant of an IFN-g polypeptide.
- the present invention encompasses co-administration of an ACE2 peptide in concert with an additional agent.
- the dosages of the actives in the combination may on their own comprise an effective amount and the additional agent(s) may further augment the therapeutic or prophylactic benefit to the patient.
- the ACE2 peptide and the additional agent(s) may together comprise an effective amount for preventing or treating the SARS-CoV-2 infection.
- effective amounts may be defined in the context of particular treatment regimens, including, e.g., timing and number of administrations, modes of administrations, formulations, etc.
- the ACE2 peptide and optionally the antiviral agent are administered on a routine schedule.
- the antiviral agent may be administered as symptoms arise.
- a “routine schedule” as used herein, refers to a predetermined designated period of time.
- the routine schedule may encompass periods of time which are identical or which differ in length, as long as the schedule is predetermined.
- the routine schedule may involve administration of the ACE2 peptide on a daily basis, every two days, every three days, every four days, every five days, every six days, a weekly basis, a monthly basis or any set number of days or weeks there-between, every two months, three months, four months, five months, six months, seven months, eight months, nine months, ten months, eleven months, twelve months, etc.
- the predetermined routine schedule may involve concurrent administration of the ACE2 peptide and the antiviral agent on a daily basis for the first week, followed by a monthly basis for several months, and then every three months after that. Any particular combination would be covered by the routine schedule as long as it is determined ahead of time that the appropriate schedule involves administration on a certain day.
- the present invention provides pharmaceutical compositions for reducing or abrogating the uptake of viruses (e.g., a SARS-CoV-2) to a cell of the host, the pharmaceutical compositions comprising an ACE2 peptide and optionally an antiviral agent useful for treating the infection.
- viruses e.g., a SARS-CoV-2
- the formulations of the invention are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
- the formulations may be administered systemically or locally. Techniques for formulation and administration may be found in “Remington’s Pharmaceutical Sciences”, Mack Publishing Co., Easton, Pa., latest edition.
- Suitable routes may, for example, include oral, rectal, transmucosal, or intestinal administration; parenteral delivery, including intramuscular, subcutaneous, intramedullary injections, as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections.
- the active agents or drugs of the invention may be formulated in aqueous solutions, suitably in physiologically compatible buffers such as Hanks’ solution, Ringer’s solution, or physiological saline buffer.
- penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
- Dosage forms of the drugs of the invention may also include injecting or implanting controlled releasing devices designed specifically for this purpose or other forms of implants modified to act additionally in this fashion.
- Controlled release of an agent of the invention may be achieved by coating the same, for example, with hydrophobic polymers including acrylic resins, waxes, higher aliphatic alcohols, polylactic and polyglycolic acids and certain cellulose derivatives such as hydroxypropyl methyl cellulose.
- controlled release may be achieved by using other polymer matrices, liposomes or microspheres.
- the drugs of the invention may be provided as salts with pharmaceutically compatible counterions.
- Pharmaceutically compatible salts may be formed with many acids, including but not limited to hydrochloric, sulphuric, acetic, lactic, tartaric, malic, succinic, etc. Salts tend to be more soluble in aqueous or other protonic solvents that are the corresponding free base forms.
- the therapeutically effective dose can be estimated initially from cell culture assays.
- a dose can be formulated in animal models to achieve a circulating concentration range that includes the IC50 as determined in cell culture (e.g., the concentration of an active agent, which achieves a half-maximal inhibition in activity of an ACE2 peptide). Such information can be used to more accurately determine useful doses in humans.
- Toxicity and therapeutic efficacy of such drugs can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50:ED50.
- Compounds that exhibit large therapeutic indices are preferred.
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilised.
- the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient’s condition (see, for example, Fingl et a/., 1975, in “The Pharmacological Basis of Therapeutics”, Ch
- the liposomes will be targeted to and taken up selectively by the tissue.
- the effective local concentration of the agent may not be related to plasma concentration.
- a series of protein domains within both the ACE2 protein were identified as being critical for the entry of the SARS-CoV-2 into the cell. These protein domains are subject to epigenetic post-translational modification (lysine methylation, de-methylation, sumoylation and phosphorylation).
- ACE2 PTMs are critical for interaction with SARS-CoV-2 and viral entry to the cell.
- Part of the replicative process of viruses include trafficking proteins into the nucleus to employ them as transcriptional regulators for more efficient transcription.
- putative nuclear localisation signal (NLS) within the ACE2 protein was identified. This peptide was selective and specific for the targeted proteins as well as being selective for the specific domains within each protein.
- LSD1 is a key eraser enzyme, that demethylates key histone proteins and key proteins such as transcription factors whereby this demethylation/methylation post- translational modification has resulted in induction, inhibition or stabilization of the expression of the targeted proteins, such as p53. Based on these data, the role of LSD1 as a key regulator of the receptor ACE2 and TMPRSS2 responsible for shuttling SARS-CoV-2 into the cell was investigated.
- ASI digital pathology analysis was used to examine non-permeabilized Caco-2 cells which monitor cell surface expression and permeabilized cells that monitor intracellular compartmentalisation.
- Cells were stained positive for the proteins ACE2, TMPRSS2 and LSD1 .
- LSD1 which is traditionally described as a cytoplasmic or nuclear protein, also stained positive on the cell surface (see, Figure 1).
- LSD1 significantly co-localized with ACE2 as demonstrated by the PCC(r) co-efficient which adjudicates the degree of co-localisation between two protein targets.
- This analysis shows strong co localisation between ACE2 and LSD1 on the cell surface. This was further validated by FACS analysis of Caco-2 cells.
- MRC5 cells, resistant to SARS-CoV-2 infection do not express ACE2 or TRMPSS2. However, these cells express LSD1 on the cell surface, albeit at 4-fold less compared to SARS-CoV-2 susceptible cell line Caco-2.
- the present inventors then investigated the effect of SARS-CoV-2 infection on the LSD1 and ACE2/TRMPSS2 co-expression.
- High resolution quantitative imaging and FACS analysis was used to examine Caco-2, or Caco-2/aMRC5 cells infected with SARS- CoV-2.
- Cells were stained with ACE2; and the epigenetic enzyme LSD1 ; or LSD1 and antibodies for the nucleocapsid or spike protein of SARS-CoV-2 (see, Figure 2A-C).
- LSD1 significantly co-localized higher with ACE2 in cells infected with SARS-CoV-2, as compared to ACE2/LSD1 expression in uninfected CaCo2 and MRC5 cells (which are not susceptible to SARS-CoV-2 infection) as demonstrated by the PCC(r) co-efficient which adjudicates the degree of co-localisation between two protein targets, as well as significantly upregulated expression of both LSD1 and ACE2 was demonstrated in infected cells.
- MRC5 had no expression of ACE2 and no staining of virus proteins (Figure 2D).
- LSD1 co localized with both SARS-CoV-2 spike protein and the nucleocapsid proteins.
- Ddigital images were also analysed using ImageJ software (ImageJ, NIH, Bethesda, MD, USA) to determine the total cell fluorescence or cell surface only fluorescence for non-permeabilised cells.
- Digital images were analysed using ImageJ software (ImageJ, NIH, Bethesda, MD, USA) to determine the either the Total Nuclear Fluorescent Intensity (TNFI), the Total Cytoplasmic Fluorescent Intensity (TCFI).
- ImageJ software with automatic thresholding and manual selection of regions of interest (ROIs) specific for cell nuclei was used to calculate the Pearson’s co-efficient correlation (PCC) for each pair of antibodies.
- the Mann-Whitney nonparametric test (GraphPad Prism, GraphPad Software, San Diego, CA) was used to determine significant differences between datasets.
- LSD1 Inhibitors Abrogate ACE2 Expression and Inhibit SARS-CoV-2 Expression
- Binding affinity measurements were performed on a Monolith NT.115 (NanoTemper Technologies).
- the fluorescein-Ahx tagged ACE2 peptide sequence RDRKKKNKARSGEN was manufactured by Genescript.
- Each reaction consisted of 10 pL of the labelled peptide at 444 nM, mixed with unlabelled LSD1 at the indicated concentrations. All experiments were measured at 25°C with laser off/on/off times of 5/30/5 s. Experiments were conducted at 20% light-emitting diode power and 20 ⁇ f0% MST infra-red laser power. Data from three independently performed experiments were fitted to the single binding model via the NT. Analysis software version 1.5.41 (NanoTemper Technologies) using the signal from Thermophoresis + T-Jump.
- LSD1 inhibition albeit at different degrees, impacts on key anti-viral processes, key proteins responsible for viral entry and the transcription and replication of the SARS-CoV-2 virus in the host cell (see, Figure 4).
- the different degrees of impact on these pathways by the LSD1 inhibitors can be attributed to the different modes of action of each inhibitor, with phenelzine impacting on both catalytic, nuclear and structural functions.
- Caco-2 cells susceptible to SARS-CoV-2 infection displayed increased cytoplasmic and nuclear expression of ACE2 in permeabilized cells ( Figures 5A-C).
- the Fn/c ratio (a score > than 1 indicates nuclear bias) of ACE2 also increased significantly upon infection. A similar pattern is observed for LSD1 .
- RNA-seq data were obtained from Caco-2 cell line infected with SARS- CoV-2. Three different treatments were tested (named Phe, Gsk, and L1), with each of the treatments targeting the same gene but in different ways. A total of 8 samples from four experimental groups were collected:
- the aim was to perform differential expression analysis using edgeR between the control group and each of the treated groups to find the differentially expressed genes.
- the present inventors then compared the genes between the treatment groups to find common and unique genes, and also perform pathway analysis.
- RNA-seq data were generated, fastq data were downloaded to the QIMR Berghofer Medical Research Institute server, and then archived to the HSM by Scott Wood. Sequence reads were trimmed for adapter sequences using Cutadapt (version 1 .9; Martin (2011)) and aligned using STAR (version 2.5.2a; Dobin et al. (2013)) to the GRCh37 assembly with the gene, transcript, and exon features of Ensembl (release 89) gene model, and the SARS-CoV-2 RefSeq accession NC_045512. Quality control metrics were computed using RNA-SeQC (version 1 .1.8; DeLuca et al. (2012)) and expression was estimated using RSEM (version 1.2.30; Li and Dewey (2011)).
- RNA-seq samples are an important step to guarantee quality and reproducible analytical results.
- RNA-SeQC was run for this purpose, the results of which can be found on the HPC cluster.
- Another common quality metric is whether the RNA sample is contaminated with mitochondrial DNA (mtDNA) or whether there is a high amount of ribosomal RNA (rRNA) in the sample.
- mtDNA mitochondrial DNA
- rRNA ribosomal RNA
- the aim of normalisation is to remove differences between samples based on systematic technical effects to warrant that these technical biases have a minimal effect on the results.
- the library size is important to correct for as differences in the initial RNA quantity sequenced will have an impact on the number of reads sequenced. Differences in RNA sequence composition occurs when RNAs are over-represented in one sample compared to others. In these samples, other RNAs will be under-sampled which will lead to higher false-positive rates when predicting differentially expressed genes.
- DE analysis was performed using the R package edgeR (Robinson, McCarthy, and Smyth (2010b)). Note that the inputs for DE analysis are the filtered but not normalised read counts, since edgeR performs normalisation (library size and RNA composition) internally.
- the glmQLFit() function was used to fit a quasi-likelihood negative binomial generalised log-linear model to the read counts for each gene. Using the glmQLFTestO function, we conducted gene-wise empirical Bayes quasi-likelihood F-tests for a given contrast.
- the present inventors proposed developing a competitive peptide inhibitor that interferes and blocks LSD1 targeting this site, which would abrogate ACE2 expression. Furthermore, the present inventors proposed that the nuclear localisation sequence (NLS) (i.e., RKKKNK) in the C-terminal domain is a site for binding by IMPa, a key nuclear shuttling protein. It was hypothesised that interaction of the IMPa polypeptide at this site is enhanced by demethylation will allow translocation of ACE2 and any bound virus to the nuclear of the cell. The present inventors also considered that ACE2 has a novel nuclear role in directly regulating transcription akin to that now identified for key signal kinases traditionally functioning as cytoplasmic proteins.
- NLS nuclear localisation sequence
- a peptide sequence (P604) was constructed to target the LSD1 -mediated demethylation motif and NLS on the C-terminal domain of ACE2 (TGIRDRKKKNKRS; SEQ ID NO: 3). It is also shown this domain interacts with IMPa.
- the PCC(r) of LSD1 and ACE2 was also significantly abrogated, which measures the degree of co-localisation between two protein markers (see Figure 6).
- the present inventors investigated whether the effect of the P604 ACE2 peptide inhibitor impacted on expression of host ACE2 gene or TMPRSS2 gene and the Spike protein of SARS-CoV-2, or the expression of the nucleocapsid of SARS-CoV-2.
- FIG. 7 shows that the ACE2 peptide inhibitor (P604) was able to significantly inhibit and downregulate the expression of both host ACE2, and the nucleocapsid and Spike proteins of SARS-CoV-2.
- MRC5 or Caco-2 cells were transfected with either VO (Plasmid Vector Only) or LSD1-WT (Plasmid Vector with LSD1 WT gene) using the Neon transfection system. Immunofluorescent analysis was carried out with antibodies against either ACE2 or LSD1 . As expected in light of the data presented above, there was also a significant increase of LSD1 in cells transfected with LSD1-WT compared to VO ( Figure 8). Analysis revealed that overexpression of LSD1 in cells transfected with LSD1-WT significantly increased expression of ACE2 in Caco-2 cells as well as strikingly increased expression of ACE2 in MRC5 cells.
- Caco-2 or MRC5 cells were transfected with LSD1 WT plasmid or VO constructs using the NEON electroporation transfection system (Life Technologies). Transfected cells were permeabilised by incubating with 0.5% Triton X-100 for 15 min and were probed with a rabbit anti-LSD1 and mouse anti-ACE2 antibodies. Cover slips were mounted on glass microscope slides with ProLong NucBlue Antifade reagent (Life Technologies). Protein targets were localised by confocal laser scanning microscopy. Single 0.5 pm sections were obtained using an ASI Digital pathology platform using 100x oil immersion lens running ASI software. The final image was obtained by averaging four sequential images of the same section.
- BALC Bronchoalveolar Lavage cells
- PBMC Peripheral Blood Mononuclear Cells
- BALF (20 mL/patient) will be obtained and processed within 2 hours in a BSL-3 laboratory. BALCs will be isolated by filtering and centrifugation before being resuspended in medium for future use. [0231] SARS-CoV-2 -infected cells with/without inhibitor treatments will be assayed by qRT-PCR for ACE2 and flow cytometry and digital pathology using antibodies targeting ACE2.
- PBMCs will be pre-treated with inhibitors and killing assays performed using the xCELLigence® Real Time Cell Analyzer.
- Both peptides are predicted to competitively block interactions between the spike protein and lysine 31 , either by interfering with ACE2/spike interactions or by binding to the spike protein as a decoy. These peptides also competitively block enzymatic access to lysine 31 as a decoy interaction, interfering with lysine 31 demethylation by mimicking the ACE2/spike binding domain/lysine d-methylation motif, meaning that the LSD1 catalytic pocket or the RBD spike domain interact with the peptide and not the target protein to prevent lysine 31 demethylation or spike-ACE2 interactions.
- infectious viral titers were quantified by median tissue culture infectious dose (TCID 5 o) of supernatants from infected cells treated with ACE2-01 and ACE2-02, which further confirmed reductions in viral load by 4.5-fold and 3.2-fold, respectively (Figure 9F). Furthermore, inhibition of SARS-CoV-2 infection was assessed using digital pathology to detect spike protein intensity ( Figures 2G and 2H). Both inhibitors significantly reduced SARS-CoV-2 spike protein at the cell surface and intracellularly in infected cells ( Figures 2G and 2H), with co-localization of spike and ACE2 also significantly reduced (Figure 2G).
- a proximity ligation assay was used to assess the co localization of ACE2 and spike protein at the surface of SARS-CoV-2 infected Caco-2 cells.
- GSK treatment significantly decreased interaction between ACE2 spike protein, and ACE2- 01 and ACE2-02 peptide inhibitors further disrupted ACE2/spike complexes at the cell surface ( Figure 2I). This suggests that methylation of ACE2 via inhibition of LSD1 activity contributes to blocking access to ACE2 by the SARS-CoV-2 spike protein.
- competitively blocking access to the lysine 31 motif with peptide inhibitors inhibits spike protein access to ACE2.
- the peptide contained the motif predicted to undergo methylation/de-methylation using the in silico prediction software PSSme (Sheng et al., 2018) and also representing the binding region between glutamine 493 in the receptor-binding domain (RBD) of the SARS- CoV-2 spike protein and ACE2 (Shang et al., 2020): QAKTFLD ⁇ Lys(Me2) ⁇ FNHEAED, with a di-methylated lysine at position 31 . LSD1 efficiently de-methylated the ACE2 peptide at lysine 31.
- Caco-2 cells (8 x 10 4 ) were seeded on coverslips for 48 hours before treatment with peptides from an alanine walk for ACE2-01 or ACE2-02 (10 mM for each peptide) for 24 hours followed by treatment with 20 pL of purified SARS-CoV-2755 spike protein S1 (Glu14-Ser680) containing a poly-histidine tag at the C-terminus (1.52 mg/mL) for 24 hours.
- Non-permeablized samples were then stained with antibodies specific for the SARS-CoV-2 spike protein and visualized with a secondary antibody targeting the host primary antibody. Protein targets were localized by digital pathology laser scanning microscopy.
- ASI Digital pathology is characterization of both the fluorescent intensity as per normal immunofluorescent imaging as well as the ability to count the population of cells positive or negative for antibodies, allow population dynamics to be investigation using powerful custom designed algorithms and automated stage. This also allows the imaging and counting of large cell numbers for statistical power) microscope using a 100x oil immersion lens running ASI software. The final image was obtained by averaging four sequential images of the same section. Digital images were analyzed using automated ASI software as described previously 63 (Applied Spectral Imaging, Carlsbad, CA) to determine the distribution and intensities automatically with automatic thresholding and background correction of the average fluorescence intensity (FI), allowing for the specific targeting of expression of proteins of interest.
- ASI Digital pathology is characterization of both the fluorescent intensity as per normal immunofluorescent imaging as well as the ability to count the population of cells positive or negative for antibodies, allow population dynamics to be investigation using powerful custom designed algorithms and automated stage. This also allows the imaging and counting of large cell numbers for statistical power) microscope using a 100x oil immersion lens running ASI software. The final image was obtained
- the P604 ACE2 peptide inhibitor inhibits the nuclear shuttling of the ACE2 via directly inhibiting the ACE2-importin complex in vitro ( Figure 12A, B) and in SARS-CoV-2 susceptible cell lines ( Figure 12C, D). Importantly, these data confirm that this peptide inhibitor specifically targets nuclear ACE2 and does not impact on other critical nuclear proteins targeted by the importin pathway.
- DUOLINK analysis which detects the close interaction of two protein targets, unmodified ACE2 (ACE2unmod) or IMPal , was performed on H1299 (lung cell line) treated with either control or increase concentrations of the P604 peptide.
- Fluorescence polarization assays were performed using the CLARIOstar Plus plate reader (BMG Labtech) with the fluorescein-Ahx-tagged ACE2 peptide sequence RDRKKKNKARSGEN (i.e., residues 776-779 of sequence set forth in SEQ ID NO: 1 ) manufactured by GeneScript Biotech (Piscataway, NJ), the P604 ACE2 peptide sequence Myristyl-TGIRDRKKKNKARS-OH manufactured by Mimitopes Pty Ltd (Melbourne,
- Each assay contained 50 nM ACE2 FITC, 10mM importin-a DIBB protein, and two-fold serially-diluted P604 ACE2 peptide (starting concentration 400 mM) across 10 wells to a total volume of 200 mI_. Fluorescence polarization readings were taken using 96-well black Fluotrac microplates (Greiner Bio-One; Kremsmunster, Austria). Assays were repeated in triplicate and contained a negative control (no inhibitor) and blank (no importin-a DIBB protein). Triplicate data was normalised and fitted to a single inhibition curve using GraphPad Prism.
- FITC-Ahx-tagged ACE2 peptide (90 mM) was mixed with importin-a DIBB protein (100 mM) and P604 ACE2 peptide inhibitor (500 mM) and electrophoresed through a 1% agarose gel in TB Buffer (45 mM boric acid, 45 mM Tris base, pH 8.5) for 90min at 40 V.
- ACE2 peptide alone, P604 ACE2 peptide inhibitor alone and importin-a DIBB alone were used as controls.
- the gel was first imaged under UV light using a Gel Doc XR+ system before being stained using Coomassie brilliant blue.
- the DUOLINK proximity ligation assay was employed using PLA probe anti-mouse PLUS (DU092001), PLA probe anti-rabbit MINUS (DU092005), and DUOLINK In Situ Detection Reagent Red Kit (DU092008) (Sigma Aldrich). Cells were fixed, permeabilized, and incubated with primary antibodies targeting ACE2umodified (ACE2unmod) and IMPa1. Cells were processed according to the manufacturer’s recommendations. Finally, coverslips were mounted onto slides and examined as above.
- FIG. 13D ASI Digital pathology imaging demonstrated that the population of cells in bronchial lung sections positive for the SARS-CoV-2 spike protein was significantly reduced by P604 ACE2 peptide treatment via either the IV or IP route. Additionally, even where cells were positive for SARS-CoV-2 spike protein, analysis of expression of the Spike protein revealed that overall intensity of signal was significantly reduced as well in both IP and IV administration treatment groups. [0245] To assess the impact of the P604 ACE2 peptide inhibitor treatment on SARS-Cov-2 induced lung pathology, haematoxylin and eosin (H&E) stained lung sections were scored by a single veterinary pathologist, blinded to the treatments, as previously described ( Figure 14A).
- H&E haematoxylin and eosin
- Histology scores for the following parameters: overall lesion extent, bronchitis, alveolitis, vasculitis, interstitial inflammation and pneumocyte hyperplasia were scored using a 0-4/0-5 scale and scores for each lung summed to obtain the total histopathological score (Figure 14B).
- Figure 14A-B mild-moderate pulmonary changes were observed ( Figure 14A-B), most notably within the bronchioles and no pneumocyte hyperplasia was observed.
- Figure 14A-B evidence of severe degeneration and necrosis of bronchiolar epithelial cells was visible in the vehicle group with intraepithelial leukocyte infiltration and widespread apoptosis
- mice Female golden Syrian Hamsters (6-8 weeks) were obtained from Janiver Labs (Le Genest-Saint-lsle, France) and studies conducted by Oncodesign® Biotechnology (Dijon Cedex, France). For tolerance experiments, animals (3 per group) received escalating doses of P604 ACE2 peptide inhibitor or ACE2i peptide via intraperitoneal injection. Doses were escalated daily (day 1 : 25 mg/kg, day 2: 50 mg/kg, day 3: 100 mg/kg) and animals monitored prior to culling on day 4. Animal viability, behaviour and rectal temperature were recorded every 2 hours over a 6 hour period post-administration and body weights were measured daily.
- P604 ACE2 peptide inhibitor efficacy studies animals (8 per group) were treated with vehicle (IP, daily day 0, 1 and 2) (Sodium chloride 0.9%, Osalia, Paris, France) or P604 ACE2 peptide inhibitor over a 2-day period via intravenous (IV, 15 mg/kg, day 0 once and day 1 twice, 8 hours apart) or intraperitoneal (IP, 100 mg/kg, daily Day 0, 1 , 2) injection.
- IV intravenous
- IP intraperitoneal
- animals were treated with vehicle or P604 ACE2 peptide inhibitor (30 mg/kg, IN, twice daily, Day 0, 1 8 hours apart).
- peptides were administered to animals 1 hr prior to SARS-Cov-2 infection on Day 0 (10 4 PFU; IN administration) with the SARS-CoV-2 strain “Slovakia/SK- BMC5/2020”, originally provided by the European Virus Archive global. All procedures on golden Syrian Hamsters were submitted to the Institutional Animal Care and Use Committee of CEA approved by French authorities.
- Virus load determination in lungs by genomic RT-gPCR determination in lungs by genomic RT-gPCR.
- Vero E6/TMPRSS2 cells were plated in 96-well plates at the density of 25,000 cells per well in a volume of 200 pL of complete growth medium (DMEM 10% FCS). Cells were infected with serial dilutions of the day 2 lung homogenate (triplicate) for 1 h at 37°C. Fresh medium was then added for 72 hours. After cell infection, an MTS/PMS assay roteinacwas performed according to provider protocol (Cat#G5430, Promega, Madison, Wl). Briefly, after discarding 100 pL of supernatant, a volume of 20 pL of MTS/PMS reagent was added to the remaining 100 pL supernatant. After 4 hours, plates were read using an Elisa Plate reader and data recorded.
- DMEM 10% FCS complete growth medium
- MTS/PMS assay roteinac was performed according to provider protocol (Cat#G5430, Promega, Madison, Wl). Briefly, after discarding 100 pL of superna
- CD3- positive T lymphocytes were detected in the peribronchial region at 5 dpi, which may facilitate the rapid clearance of the infected cells.
- IFA imaging and analysis was carried out using previously established and optimized protocols.
- Cells were fixed with formaldehyde (3.7%) and then immuno-stained with antibodies targeting the SARS-CoV-2 viral spike, custom antibodies ACE2me1 , ACE2unmod.
- Cells were permeabilized by incubating with 0.5% Triton X-100 for 15 min, blocked with 1% BSA in PBS, and were probed with primary antibodies followed by visualization with secondary donkey anti-rabbit, mouse, or goat antibodies conjugated to Alexa Fluor 488, 568, or 647.
- Coverslips were mounted on glass microscope slides with ProLong Glass Antifade reagent (Life Technologies, Carlsbad, CA). Protein targets were localized by digital pathology laser scanning microscopy.
- ASI Digital pathology is characterization of both the fluorescent intensity as per normal immunofluorescent imaging as well as the ability to count the population of cells positive or negative for antibodies, allow population dynamics to be investigation using powerful custom designed algorithms and automated stage. This also allows the imaging and counting of large cell numbers for statistical power) microscope using a 100x oil immersion lens running ASI software. The final image was obtained by averaging four sequential images of the same section. Digital images were analyzed using automated ASI software as described previously (Applied Spectral Imaging, Carlsbad, CA) to determine the distribution and intensities automatically with automatic thresholding and background correction of the average nuclear fluorescence intensity (NFI), allowing for the specific targeting of expression of proteins of interest.
- ASI Digital pathology is characterization of both the fluorescent intensity as per normal immunofluorescent imaging as well as the ability to count the population of cells positive or negative for antibodies, allow population dynamics to be investigation using powerful custom designed algorithms and automated stage. This also allows the imaging and counting of large cell numbers for statistical power) microscope using a 100x oil immersion lens running ASI software. The final image was obtained
- Digital images were also analyzed using ImageJ software (ImageJ, NIH, Bethesda, MD, USA) to determine the total cell fluorescence or cell surface only fluorescence for non-permeabilized cells. Appropriate controls were used for all experiments including no antibody controls, primary only, or secondary only controls.
- Opal Tyramide staining unlike traditional IFA allows the use of antibodies from the same host species. Imaging and analysis was carried out using previously established and optimized protocols for permeabilization and antigen retrieval. All FFPE sections were stained with Opal Tyramide staining. Samples were dewaxed using a decloaking chamber and were prepared using either 0.1% Triton X-100 20 min, Biocare Medical Denaturing Solution, or Dako pH6.0/pH 9.0 for antigen retrieval. Sniper+BSA was used for blocking (10 minutes). Primary antibodies employed include CD3, Perforin, SARS- CoV-2 Spike and custom antibody ACE2me1 with VGY or DVG buffers.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Virology (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Gastroenterology & Hepatology (AREA)
- General Chemical & Material Sciences (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Vascular Medicine (AREA)
- Immunology (AREA)
- Cell Biology (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/287,793 US20240352072A1 (en) | 2021-04-20 | 2022-04-20 | Novel compositions and methods for treating coronavirus infections |
| IL307872A IL307872A (en) | 2021-04-20 | 2022-04-20 | New compositions and methods for the treatment of corona virus infections |
| CN202280043436.1A CN117677631A (zh) | 2021-04-20 | 2022-04-20 | 用于治疗冠状病毒感染的新型组合物和方法 |
| KR1020237039897A KR20240027579A (ko) | 2021-04-20 | 2022-04-20 | 코로나바이러스 감염을 치료하기 위한 신규한 조성물 및 방법 |
| AU2022260860A AU2022260860A1 (en) | 2021-04-20 | 2022-04-20 | Novel compositions and methods for treating coronavirus infections |
| CA3216329A CA3216329A1 (en) | 2021-04-20 | 2022-04-20 | Novel compositions and methods for treating coronavirus infections |
| JP2023564191A JP2024516605A (ja) | 2021-04-20 | 2022-04-20 | コロナウイルス感染を処置するための新規組成物及び方法 |
| EP22790610.4A EP4326757A4 (en) | 2021-04-20 | 2022-04-20 | NEW COMPOSITIONS AND METHODS FOR TREATING CORONAVIRUS INFECTIONS |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021901169 | 2021-04-20 | ||
| AU2021901169A AU2021901169A0 (en) | 2021-04-20 | Novel compositions and methods for treating coronavirus infections | |
| AU2022900358A AU2022900358A0 (en) | 2022-02-18 | Novel compositions and methods for treating coronavirus infections | |
| AU2022900358 | 2022-02-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022221920A1 true WO2022221920A1 (en) | 2022-10-27 |
Family
ID=83723477
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/AU2022/050363 Ceased WO2022221920A1 (en) | 2021-04-20 | 2022-04-20 | Novel compositions and methods for treating coronavirus infections |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20240352072A1 (https=) |
| EP (1) | EP4326757A4 (https=) |
| JP (1) | JP2024516605A (https=) |
| KR (1) | KR20240027579A (https=) |
| AU (1) | AU2022260860A1 (https=) |
| CA (1) | CA3216329A1 (https=) |
| IL (1) | IL307872A (https=) |
| WO (1) | WO2022221920A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024020646A1 (en) * | 2022-07-27 | 2024-02-01 | The Council Of The Queensland Institute Of Medical Research | Methylation biomarker for infection resistance |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002012471A2 (en) * | 2000-08-09 | 2002-02-14 | Millennium Pharmaceuticals, Inc. | Angiotensin converting enzyme homolog and uses therefor |
| US20090130691A1 (en) * | 2005-09-16 | 2009-05-21 | Institut De Recherches Cliniques De Montreal | Screening proteinase modulators using a chimeric protein and ski-i proprotein convertase substrates and inhibitors |
| US20120237945A1 (en) * | 2006-05-08 | 2012-09-20 | Adaerata Limited Partnership | Chimeric pcsk9 proteins, cells comprising same, and assays using same |
| WO2021188966A1 (en) * | 2020-03-19 | 2021-09-23 | Massachusetts Institute Of Technology | Sars-cov-2 spike protein binding peptides |
| WO2021195723A1 (en) * | 2020-04-03 | 2021-10-07 | The Council Of The Queensland Institute Of Medical Research | "methods for treatment of coronavirus infections" |
| WO2021216845A1 (en) * | 2020-04-22 | 2021-10-28 | Dana-Farber Cancer Institute, Inc. | Antiviral structurally-stabilized ace2 helix 1 peptides and uses thereof |
| WO2022075921A1 (en) * | 2020-10-08 | 2022-04-14 | Hummingbird Bioscience Holdings Limited | Sars-cov-2 spike protein antigen-binding molecules |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6989363B1 (en) * | 1997-12-11 | 2006-01-24 | Millennium Pharmaceuticals, Inc. | Angiotensin converting enzyme homolog and therapeutic and diagnostic uses therefor |
| CN111920806B (zh) * | 2020-07-14 | 2023-01-03 | 中日友好医院(中日友好临床医学研究所) | 苹果酸舒尼替尼在制备抑制冠状病毒的药物中的应用 |
-
2022
- 2022-04-20 JP JP2023564191A patent/JP2024516605A/ja active Pending
- 2022-04-20 WO PCT/AU2022/050363 patent/WO2022221920A1/en not_active Ceased
- 2022-04-20 AU AU2022260860A patent/AU2022260860A1/en active Pending
- 2022-04-20 EP EP22790610.4A patent/EP4326757A4/en active Pending
- 2022-04-20 IL IL307872A patent/IL307872A/en unknown
- 2022-04-20 KR KR1020237039897A patent/KR20240027579A/ko active Pending
- 2022-04-20 CA CA3216329A patent/CA3216329A1/en active Pending
- 2022-04-20 US US18/287,793 patent/US20240352072A1/en active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002012471A2 (en) * | 2000-08-09 | 2002-02-14 | Millennium Pharmaceuticals, Inc. | Angiotensin converting enzyme homolog and uses therefor |
| US20090130691A1 (en) * | 2005-09-16 | 2009-05-21 | Institut De Recherches Cliniques De Montreal | Screening proteinase modulators using a chimeric protein and ski-i proprotein convertase substrates and inhibitors |
| US20120237945A1 (en) * | 2006-05-08 | 2012-09-20 | Adaerata Limited Partnership | Chimeric pcsk9 proteins, cells comprising same, and assays using same |
| WO2021188966A1 (en) * | 2020-03-19 | 2021-09-23 | Massachusetts Institute Of Technology | Sars-cov-2 spike protein binding peptides |
| WO2021195723A1 (en) * | 2020-04-03 | 2021-10-07 | The Council Of The Queensland Institute Of Medical Research | "methods for treatment of coronavirus infections" |
| WO2021216845A1 (en) * | 2020-04-22 | 2021-10-28 | Dana-Farber Cancer Institute, Inc. | Antiviral structurally-stabilized ace2 helix 1 peptides and uses thereof |
| WO2022075921A1 (en) * | 2020-10-08 | 2022-04-14 | Hummingbird Bioscience Holdings Limited | Sars-cov-2 spike protein antigen-binding molecules |
Non-Patent Citations (10)
| Title |
|---|
| G. ZHANG, POMPLUN S., LOFTIS A. R., TAN X., LOAS A., PENTELUTE B. L.: "The first-in-class peptide binder to the SARS-Cov-2 spike protein", BIORXIV, 30 March 2020 (2020-03-30), XP055759391, Retrieved from the Internet <URL:https://www.biorxiv.org/content/10.1101/2020.03.19.999318v1.full.pdf> DOI: 10.1101/2020.03.19.999318 * |
| GONZALEZ SANDRA M., SIDDIK ABU BAKAR, SU RUEY-CHYI: "Regulated Intramembrane Proteolysis of ACE2: A Potential Mechanism Contributing to COVID-19 Pathogenesis?", FRONTIERS IN IMMUNOLOGY, vol. 12, XP093000365, DOI: 10.3389/fimmu.2021.612807 * |
| KLICHE J. ET AL.: "Cytoplasmic short linear motifs in ACE2 and integrin (beta3 link SARS- CoV-2 host cell receptors to mediators of endocytosis and autophagy", SCI. SIGNAL., vol. 14, 12 January 2021 (2021-01-12), pages eabf1117, XP093000360 * |
| LUPALA C.S. ET AL.: "Computational analysis on the ACE2-derived peptides for neutralizing the ACE2 binding to the spike protein of SARS-CoV-2", BIORXIV, 2020, pages 1 - 27, XP055799136, DOI: 10.1101/ 2020.05.03.075473 * |
| MÉSZÁROS BÁLINT, SÁMANO-SÁNCHEZ HUGO, ALVARADO-VALVERDE JESÚS, ČALYŠEVA JELENA, MARTÍNEZ-PÉREZ ELIZABETH, ALVES RENATO, SHIELDS D: "Short linear motif candidates in the cell entry system used by SARS-CoV-2 and their potential therapeutic implications", SCI. SIGNAL, vol. 14, no. 12, 12 January 2021 (2021-01-12), pages 1 - 25, XP093000356 * |
| MORGAN DANIELLE C., MORRIS CAROLINE, MAHINDRA AMIT, BLAIR CONNOR M., TEJEDA GONZALO, HERBERT IMOGEN, TURNBULL MATTHEW L., LIEBER G: "Stapled ACE2 peptidomimetics designed to target the SARS-CoV-2 spike protein do not prevent virus internalization", PEPTIDE SCIENCE, vol. e24217., 8 January 2021 (2021-01-08), pages 1 - 8, XP055821578, ISSN: 2475-8817, DOI: 10.1002/pep2.24217 * |
| S ADREMOMTAZ A. ET AL.: "Synthetic Peptides That Antagonize the Angiotensin-Converting Enzyme-2 (ACE-2) Interaction with SARS-CoV-2 Receptor Binding Spike P rotein", JOURNAL OF MEDICINAL CHEMISTRY, vol. 65, no. 4, 30 July 2021 (2021-07-30), pages 2836 - 2847, XP055921590, DOI: 10.1021/acs.jmedchem.1c00477 * |
| See also references of EP4326757A4 * |
| SITTHIYOTHA T. ET AL.: "Computational Design of 25-mer Peptide Binders of SARS-CoV-2", J. PHYS. CHEM. B, vol. 124, 2020, pages 10930 - 10942, XP055866822, DOI: 10.1021/acs.jpcb.0c07890 * |
| TU WEN JUAN, MCCUAIG ROBERT D., MELINO MICHELLE, RAWLE DANIEL J., LE THUY T., YAN KEXIN, SUHRBIER ANDREAS, JOHNSTON REBECCA L., KO: "Targeting novel LSD1-dependent ACE2 demethylation domains inhibits SARS-CoV-2 replication", CELL DISCOVERY, vol. 7, no. 1, 1 December 2021 (2021-12-01), XP093000362, DOI: 10.1038/s41421-021-00279-w * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024020646A1 (en) * | 2022-07-27 | 2024-02-01 | The Council Of The Queensland Institute Of Medical Research | Methylation biomarker for infection resistance |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3216329A1 (en) | 2022-10-27 |
| US20240352072A1 (en) | 2024-10-24 |
| KR20240027579A (ko) | 2024-03-04 |
| IL307872A (en) | 2023-12-01 |
| JP2024516605A (ja) | 2024-04-16 |
| AU2022260860A1 (en) | 2023-12-07 |
| EP4326757A1 (en) | 2024-02-28 |
| EP4326757A4 (en) | 2025-07-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7554837B2 (ja) | 可溶性ace2及び融合タンパク質、並びにその適用 | |
| US11364276B2 (en) | Antiviral peptides for treatment of the middle east respiratory syndrome | |
| US20240218059A1 (en) | TGF-Beta 1 INHIBITORS FOR PREVENTING AND TREATING SARS-COV-2 | |
| ES2282666T3 (es) | Antagonistas de quimiocinas cxc de union a cxcr3. | |
| WO2022221920A1 (en) | Novel compositions and methods for treating coronavirus infections | |
| CN109593123B (zh) | 一种衍生自rps23rg1的多肽及其应用 | |
| CN117677631A (zh) | 用于治疗冠状病毒感染的新型组合物和方法 | |
| US20220242932A1 (en) | Ulinastatin polypeptides for treating diseases | |
| CN116075298B (zh) | 用于治疗冠状病毒感染的方法 | |
| KR102628158B1 (ko) | 제2형 중증급성호흡기증후군 코로나바이러스에 중화 활성을 갖는 펩타이드 | |
| US11376306B2 (en) | Peptides and uses therefor as antiviral agents | |
| CA2858957C (en) | Modified peptides and their use for treating autoimmune diseases | |
| JP2023546383A (ja) | アネキシンa5組成物及び方法 | |
| US20240002437A1 (en) | Compositions and methods of treating inflammatory lung diseases | |
| WO2022203981A1 (en) | K-ras inhibitor | |
| CN113150107A (zh) | 一种白细胞介素29突变体蛋白 | |
| CN115667291B (zh) | 一种白细胞介素29突变体蛋白 | |
| JP7185874B2 (ja) | 抗ウイルス剤としてのラビリントペプチン | |
| WO2015192223A1 (en) | Peptide inhibitors of respiratory syncytial virus replication | |
| HK40083738A (en) | Soluble ace2 and fusion protein, and applications thereof | |
| WO2022066798A1 (en) | Interferon tau fc-fusion proteins and methods for treating coronavirus infections |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22790610 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023564191 Country of ref document: JP Ref document number: 307872 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3216329 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022260860 Country of ref document: AU Ref document number: 2022790610 Country of ref document: EP Ref document number: 805517 Country of ref document: NZ Ref document number: AU2022260860 Country of ref document: AU |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022790610 Country of ref document: EP Effective date: 20231120 |
|
| ENP | Entry into the national phase |
Ref document number: 2022260860 Country of ref document: AU Date of ref document: 20220420 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280043436.1 Country of ref document: CN |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 307872 Country of ref document: IL |