WO2022211508A1 - 인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 - Google Patents

인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 Download PDF

Info

Publication number
WO2022211508A1
WO2022211508A1 PCT/KR2022/004552 KR2022004552W WO2022211508A1 WO 2022211508 A1 WO2022211508 A1 WO 2022211508A1 KR 2022004552 W KR2022004552 W KR 2022004552W WO 2022211508 A1 WO2022211508 A1 WO 2022211508A1
Authority
WO
WIPO (PCT)
Prior art keywords
conjugate
acceptable salt
solvate
pharmaceutically acceptable
independently
Prior art date
Application number
PCT/KR2022/004552
Other languages
English (en)
French (fr)
Inventor
박창식
송호영
장태익
정철웅
정명진
Original Assignee
주식회사 레고켐바이오사이언스
하버 바이오메드 (쑤저우) 컴퍼니 리미티드
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 레고켐바이오사이언스, 하버 바이오메드 (쑤저우) 컴퍼니 리미티드 filed Critical 주식회사 레고켐바이오사이언스
Priority to AU2022250810A priority Critical patent/AU2022250810A1/en
Priority to EP22781627.9A priority patent/EP4321180A1/en
Priority to CA3213985A priority patent/CA3213985A1/en
Priority to BR112023020093A priority patent/BR112023020093A2/pt
Priority to IL307301A priority patent/IL307301A/en
Priority to CN202280026360.1A priority patent/CN117279663A/zh
Priority to US18/285,194 priority patent/US20240131178A1/en
Priority to JP2023555736A priority patent/JP2024515934A/ja
Publication of WO2022211508A1 publication Critical patent/WO2022211508A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/33—Heterocyclic compounds
    • A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/5513—1,4-Benzodiazepines, e.g. diazepam or clozapine
    • A61K31/5517—1,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
    • A61K38/05—Dipeptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/545—Heterocyclic compounds
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549—Sugars, nucleosides, nucleotides or nucleic acids
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6889—Conjugates wherein the antibody being the modifying agent and wherein the linker, binder or spacer confers particular properties to the conjugates, e.g. peptidic enzyme-labile linkers or acid-labile linkers, providing for an acid-labile immuno conjugate wherein the drug may be released from its antibody conjugated part in an acidic, e.g. tumoural or environment
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation

Definitions

  • the present invention provides a novel antibody-drug conjugate (ADC) targeting claudin 18 isoform 2 (claudin 18 isoform 2, CLDN18.2), active metabolites of these ADCs, methods for preparing these ADCs, and disease to the use of these ADCs for treatment and/or prophylaxis, and also to the use of these ADCs for the production of medicaments for the treatment and/or prophylaxis of diseases, more particularly hyperproliferative and/or angiogenic diseases such as cancer diseases. and, more particularly, to an antibody-drug conjugate comprising a novel antibody or antigen-binding fragment thereof that binds to CLDN18.2, and a pharmaceutical composition comprising the same.
  • ADC antibody-drug conjugate
  • Cancer refers to a disease caused by an abnormally grown mass caused by the autonomous overgrowth of body tissues, and is the result of uncontrolled cell growth in various tissues. Early stage tumors can be removed by surgery and radiation therapy, and metastases are usually treated with chemotherapy for palliative care.
  • chemotherapeutic agents can induce serious effects of unwanted side effects and even toxicity as a result of systemic administration, thus enabling improved and selective application of these chemotherapeutic agents in tumor cells or immediately adjacent tissues.
  • the focus has been on the development of novel chemotherapeutic agents to simultaneously achieve increased efficacy and minimized toxicity/side effects.
  • Antibody-drug conjugates are target-directed new technologies that bind to an antigen-binding antibody with a toxin or drug and then release a toxic substance from the inside of the cell, leading to apoptosis of cancer cells, etc. It is a technology that delivers drugs accurately to target cancer cells with minimal effect on healthy cells and releases them only under specific conditions, so it is more effective than the antibody treatment itself and can significantly lower the risk of side effects compared to existing anticancer drugs.
  • the basic structure of such an antibody-drug conjugate is composed of "antibody-linker-small molecule drug (toxin)".
  • the linker not only plays a functional role of simply linking the antibody and the drug, but also stably reaches the target cell when circulating in the body, and then the antibody-drug conjugate enters the cell and dissociates between the antibody and the drug (e.g., for enzyme hydrolysis). result), the drug should fall off well and show the drug effect on the target cancer cells. That is, depending on the stability of the linker, the linker plays a very important role in terms of safety such as efficacy and systemic toxicity of the antibody-drug conjugate (Discovery Medicine 2010, 10(53): 329-39). 85-8 2018-08-14)
  • the inventors of the present invention have developed a linker containing an effective self-immolative group that is more stable in plasma, stable even when circulating in the body, and that the drug is easily released in cancer cells to show drug efficacy.
  • a patent has been secured (Korea Patent No. 1,628,872).
  • monoclonal antibodies for the treatment of cancer has achieved considerable success.
  • Monoclonal antibodies are suitable for target-directed addressing of tumor tissues and tumor cells.
  • Antibody drug conjugates have become a powerful and new therapeutic option for the treatment of lymphoma and solid cancers, and immunomodulatory antibodies have recently achieved considerable clinical success.
  • the development of therapeutic antibodies is based on a deep understanding of cancer serology, protein engineering techniques and their actions, mechanisms of resistance, and interactions between the immune system and cancer cells.
  • an antigen expressed on the cell surface of human cancer refers to a wide range of targets that are overexpressed or mutated and selectively expressed compared to normal tissues.
  • a key challenge is to identify antigens suitable for antibody-based therapies. These therapeutics mediate changes in antigen or receptor function (i.e., function as stimulants or antagonists), modulate the immune system through Fc and T cell activation, and deliver specific drugs that bind to specific antigen-targeting antibodies. exert its effectiveness.
  • Molecular technologies that can change antibody pharmacokinetics, function, size and immune stimulation are emerging as key factors in the development of novel antibody-based therapies.
  • Evidence obtained from clinical trials of therapeutic antibodies in cancer patients shows that the affinity and binding of the antibodies to the target antigen, the selection of antibody structures, and the optimization of antibodies, including therapeutic approaches (blocking signal transduction or immune function), Emphasizes the importance of approaches to choice.
  • Human claudin 18 subtype 2 (claudin 18 isoform 2, CLDN18.2) is a transmembrane type membrane protein consisting of 261 amino acids in full length, 2 extracellular loops and 4 transmembrane domains. It differs from CLDN18.1, which is expressed in some normal tissues, in part of the amino acid sequence up to the extracellular domain loop 1.
  • CLDN18.2 belongs to the claudin family, which is an important component of tight junctions.
  • the claudin protein is expressed in various cancer tissues and is known as a potential target for diagnostic and therapeutic modalities. It is also known to play an important role in tumorigenesis and inflammatory response, and changes in claudin protein expression cause dysfunction of tight junctions, affect signal transduction pathways, and are known to have a tumor-promoting action in some epithelial cancers. .
  • CLDN18.2 is specifically expressed in primary and metastatic gastric cancer, except for expression in the apical region of some gastric mucosa, and is known as a cancer-specific antigen that is also associated with malignant transformation, pancreatic cancer , ectopic activation has been reported in esophageal cancer, ovarian cancer, and lung cancer.
  • An object of the present invention is to provide a novel antibody-linker drug conjugate targeting claudin 18 isoform 2 (CLDN18.2) or a salt or solvate thereof.
  • An object of the present invention is to provide an antibody-drug conjugate comprising an antibody that specifically binds to CLDN18.2 and a drug that binds thereto, and a pharmaceutical composition comprising the same.
  • An object of the present invention is to provide an antibody-linker-drug (toxin) system that can stably reach cells and effectively exhibit drug effects while significantly lowering toxicity.
  • Ab is an antibody or antigen-binding fragment that specifically binds to claudin 18 isoform 2 (CLDN18.2) comprising a heavy chain variable region and a light chain variable region,
  • the heavy chain variable region comprises a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 2, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 6,
  • the light chain variable region includes a light chain CDR1 consisting of the amino acid sequence represented by SEQ ID NO: 9, a light chain CDR2 consisting of the amino acid sequence represented by SEQ ID NO: 11, and a light chain CDR3 consisting of the amino acid sequence represented by SEQ ID NO: 13,
  • LINKER is a linker
  • l and m are each independently an integer selected from 1 to 20,
  • B may be the same as or different from each other.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 comprises a heavy chain variable region and a light chain variable region,
  • the heavy chain variable region comprises a heavy chain CDR1 consisting of the amino acid sequence represented by SEQ ID NO: 2, a heavy chain CDR2 consisting of the amino acid sequence represented by SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence represented by SEQ ID NO: 6,
  • the light chain variable region includes a light chain CDR1 comprising the amino acid sequence shown in SEQ ID NO: 9, a light chain CDR2 comprising the amino acid sequence shown in SEQ ID NO: 11, and a light chain CDR3 comprising the amino acid sequence shown in SEQ ID NO: 13.
  • the heavy chain variable region may include the heavy chain FR of a human antibody, and the gene encoding the heavy chain FR may be derived from the germline V gene IGHV3-23.
  • the heavy chain FR is a heavy chain FR1 consisting of the amino acid sequence shown in SEQ ID NO: 1, heavy chain FR2 consisting of the amino acid sequence shown in SEQ ID NO: 3, heavy chain FR3 consisting of the amino acid sequence shown in SEQ ID NO: 5, SEQ ID NO: 7 and a heavy chain FR4 consisting of the indicated amino acid sequence.
  • the light chain variable region includes the light chain FR of a human antibody, and the gene encoding the light chain FR may be derived from the germline V gene IGKV3-11 or IGKV3-15.
  • the light chain FR is a light chain FR1 consisting of the amino acid sequence shown in SEQ ID NO: 8, light chain FR2 consisting of the amino acid sequence shown in SEQ ID NO: 10, light chain FR3 consisting of the amino acid sequence shown in SEQ ID NO: 12, SEQ ID NO: 14 and a light chain FR4 consisting of the indicated amino acid sequence.
  • the light chain FR4 may include a moiety consisting of the amino acid sequence shown in SEQ ID NO: 19 at the C-terminus for binding to the linker.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 comprises an amino acid sequence represented by SEQ ID NO: 15; Or a heavy chain variable region consisting of an amino acid sequence having at least 80% homology thereto and an amino acid sequence represented by SEQ ID NO: 16; or a light chain variable region consisting of an amino acid sequence having at least 80% homology thereto.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 includes an amino acid sequence represented by SEQ ID NO: 15; Or a heavy chain variable region consisting of an amino acid sequence having at least 80% or more, 85% or more, 90% or more, 95% or more homology thereto and the amino acid sequence represented by SEQ ID NO: 16; Or it includes a light chain variable region consisting of an amino acid sequence having at least 80% or more, 85% or more, 90% or more, 95% or more homology thereto, and specifically binds to CLDN18.2.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 includes an amino acid sequence represented by SEQ ID NO: 15; or at least 80% or more, 81% or more, 82% or more, 83% or more, 84% or more, 85% or more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or more, 91% or more.
  • a heavy chain variable region and sequence comprising an amino acid sequence having at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% homology.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 comprises an amino acid sequence represented by SEQ ID NO: 17; or a heavy chain consisting of an amino acid sequence having at least 80% homology thereto and an amino acid sequence represented by SEQ ID NO: 18; or a light chain consisting of an amino acid sequence having at least 80% homology thereto.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 includes an amino acid sequence represented by SEQ ID NO: 17; or an amino acid sequence represented by SEQ ID NO: 18 and a heavy chain consisting of an amino acid sequence having at least 80% or more, 85% or more, 90% or more, 95% or more homology thereto; or a light chain consisting of an amino acid sequence having at least 80% or more, 85% or more, 90% or more, 95% or more homology thereto, and specifically binds to CLDN18.2.
  • the antibody or antigen-binding fragment that specifically binds to CLDN18.2 includes an amino acid sequence represented by SEQ ID NO: 17; or at least 80% or more, 81% or more, 82% or more, 83% or more, 84% or more, 85% or more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or more, 91% or more.
  • a heavy chain consisting of an amino acid sequence having at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% homology and SEQ ID NO: 18 amino acid sequence represented by; or at least 80% or more, 81% or more, 82% or more, 83% or more, 84% or more, 85% or more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or more, 91% or more. at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% homology, It binds specifically to CLDN18.2.
  • the heavy chain consisting of an amino acid sequence having at least 80% homology to the amino acid sequence represented by SEQ ID NO: 17 includes L237A and L238A mutations.
  • the antibody or antigen-binding fragment thereof is a monoclonal antibody, a domain antibody (dAb), a single chain antibody (scAb), a Fab fragment, a Fab' fragment, F(ab')2 fragment, scFab fragment, Fv fragment, dsFv fragment, single chain variable fragment (scFv), scFv-Fc fragment, single domain heavy chain antibody, single domain light chain
  • dAb domain antibody
  • scAb single chain antibody
  • Fab fragment fragment
  • Fab' fragment F(ab')2 fragment
  • scFab fragment Fv fragment
  • dsFv fragment single chain variable fragment
  • scFv-Fc fragment single domain heavy chain antibody
  • linker refers to a compound that covalently binds a cytotoxic compound to a ligand.
  • linkers described herein may be cleavable, non-cleavable, hydrophilic or hydrophobic.
  • the cleavable linker is cleavable under intracellular conditions such that cleavage of the linker releases the active agent from the antibody construct-activator conjugate in the intracellular environment.
  • a cleavable linker is cleavable by a cleaving agent present in the intracellular environment (eg, in a lysosome or endosome or caveolea).
  • the cleavable linker may be, for example, a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme including, but not limited to, a lysosomal or endosomal protease.
  • the peptidyl linker is at least 2 amino acids in length or at least 3 amino acids in length.
  • Cleavage agents may include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives to release the active drug in target cells (eg, Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123).
  • Peptidyl linkers cleavable by enzymes present in antigen-expressing cells are most common.
  • a peptidyl linker cleavable by the thiol-dependent protease cathepsin-B which is highly expressed in cancer tissues, can be used (eg, a Phe-Leu or Gly-Phe-Leu-Gly linker).
  • Other such linkers are described, for example, in US Pat. No. 6,214,345.
  • peptidyl linker cleavable by an intracellular protease is described in, for example, a Val-Cit linker, a Phe-Lys linker (eg, U.S. Patent No. 6,214,345, which describes the synthesis of doxorubicin using a Val-Cit linker). see) or a Val-Ala linker.
  • the Val-Cit linker or Val-Ala linker may contain a pentafluorophenyl group and may contain a succinimide group or a maleimide group.
  • it may contain a PABA group and a pentafluorophenyl group, and may contain a 4-aminobenzoic acid (PABA) group and a maleimide group, and may contain a PABA group and a succinimide group.
  • PABA 4-aminobenzoic acid
  • intracellularly cleaved and intracellular cleavage refer to a metabolic process or response inside a cell to an antibody construct-activator conjugate, whereby an active agent ( B) and the covalent attachment between the antibody construct (Ab), eg the linker is disrupted, resulting in free drug or other metabolites of the conjugate separated from the intracellular antibody.
  • the cleavable linker is pH-sensitive, i.e., can be readily hydrolyzed at certain pH values.
  • the pH-sensitive linker can be hydrolyzed under acidic conditions.
  • acid-labile linkers capable of being hydrolyzed in lysosomes (e.g., hydrazone, semicarbazone, thiosemicarbazone, cis-aconic amide (cis) -aconitic amide), orthoesters, acetals, ketals, etc.) can be used (e.g., U.S. Patent Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker, 1999, Pharm. Therapeutics 83).
  • linkers are relatively stable at neutral pH conditions, such as blood, but are unstable below pH 5.5 or 5.0, the approximate pH of lysosomes.
  • hydrolysable linkers include thioether linkers (eg, thioethers attached to a therapeutic agent via an acylhydrazone bond (see, eg, US Pat. No. 5,622,929)).
  • the linker is cleavable under reducing conditions (eg, a disulfide linker).
  • a disulfide linker For example, SATA (N-succinimidyl-5-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl- Formed using 3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyl-oxycarbonyl-alpha-methyl-alpha-(2-pyridyl-thio)toluene)-, SPDB and SMPT
  • SATA N-succinimidyl-5-acetylthioacetate
  • SPDP N-succinimidyl-3-(2-pyridyldithio)propionate
  • SPDB N-succinimidyl- Formed using 3-(2-pyrid
  • linkers include malonate linkers (Johnson et al., 1995, Anticancer Res. 15:1387-93), maleimidobenzoyl linkers (Lau et al., 1995, Bioorg-Med-Chem. 3(10):1299- 1304), 3'-N-amide analogs (Lau et al., 1995, Bioorg-Med-Chem. 3(10):1305-12), beta-glucuronide linker (Jeffery et al) ., 2006, Bioconjug Chem. 17(3):832-40), or beta-galactosidase linker (Kolodych et al., 2017, Eur J Med Chem. Dec 15;142:376- 382) may be.
  • the non-cleavable linker may be a maleimidocaproyl linker.
  • the maleimidocaproyl linker may comprise N-maleimidomethylcyclohexane-1-carboxylate.
  • the maleimidocaproyl linker may contain a succinimide group.
  • the maleimidocaproyl linker may contain a pentafluorophenyl group.
  • the linker may be a combination of a maleimide group and one or more polyethylene glycol molecules.
  • the linker may be a combination of a maleimidocaproyl group and one or more polyethylene glycol molecules.
  • the linker may be a maleimide-PEG4 linker.
  • the linker may be a combination of a maleimidocaproyl linker containing a succinimide group and one or more polyethylene glycol molecules.
  • the linker may be a combination of a maleimidocaproyl linker containing a pentafluorophenyl group and one or more polyethylene glycol molecules.
  • the linker may contain a maleimide linked to a polyethylene glycol molecule, wherein the polyethylene glycol allows for more linker flexibility or may use a longer linker.
  • the linker may be a (maleimidocaproyl)-(valine-citrulline)-(para-aminobenzyloxycarbonyl) linker.
  • the linker may be a cleavable linker.
  • the linker is a protease cleavable linker, an acid-cleavable linker, a disulfide linker, a self-immolative linker or a self-stabilizing linker, a malonate linker, maleimidobenzoyl linker, 3'-N-amide analog, beta-glucuronide linker, or beta-galactoside linker.
  • the protease cleavable linker may include a thiol-reactive spacer or a dipeptide, and more specifically, the protease cleavable linker is a thiol-reactive maleimidocaproyl spacer, valine -citrulline dipeptide or p-amino-benzyloxycarbonyl spacer.
  • the acid-cleavable linker may be a hydrazine linker or a quaternary ammonium linker.
  • the linker may have a structure of Formula II.
  • the tilde indicates a site linked to an antibody or antigen-binding fragment that specifically binds to CLDN18.2, * indicates a site linked to an active agent;
  • G is a glucuronic acid moiety or ego
  • R 3 is hydrogen or a carboxyl protecting group, and each R 4 is independently hydrogen or a hydroxyl protecting group;
  • R 1 and R 2 are each independently hydrogen, C 1-8 alkyl or C 3-8 cycloalkyl
  • W is -C(O)-, -C(O)NR'-, -C(O)O-, -SO 2 NR'-, -P(O)R''NR'-, -SONR'- or -PO 2 NR'-, wherein C, S or P is directly bonded to a phenyl ring, and R' and R'' are each independently hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di- C 1-8 alkylamino, C 3-20 heteroaryl or C 6-20 aryl;
  • Z is independently hydrogen, C 1-8 alkyl, halogen, cyano or nitro;
  • n is an integer from 0 to 3;
  • L is any one of the following A) or B):
  • L is 1 to 50 membered heteroalkylene
  • said alkylene is substituted with one or more C 1-20 alkyl
  • the conjugate may have a structure of the following general formula IIa.
  • Ab is an antibody or antigen-binding fragment that specifically binds to CLDN18.2 comprising a heavy chain variable region and a light chain variable region,
  • B' are each independently the same or different active agents
  • G is each independently a glucuronic acid moiety or ego;
  • R 3 is hydrogen or a carboxyl protecting group, and each R 4 is independently hydrogen or a hydroxyl protecting group;
  • R 1 and R 2 are each independently hydrogen, C 1-8 alkyl or C 3-8 cycloalkyl
  • W is each independently -C(O)-, -C(O)NR'-, -C(O)O-, -SO 2 NR'-, -P(O)R''NR'-, -SONR '- or -PO 2 NR'-, wherein C, S or P is directly bonded to a phenyl ring, wherein NR' is bonded to L, and R' and R'' are each independently hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di-C 1-8 alkylamino, C 3-20 heteroaryl or C 6- 20 is aryl;
  • each Z is independently hydrogen, C 1-8 alkyl, halogen, cyano or nitro;
  • n is an integer from 0 to 3, and when n is an integer of 2 or more, each Z may be the same as or different from each other;
  • Each L is independently any one of the following A) or B):
  • L is 1 to 50 membered heteroalkylene
  • said alkylene is further substituted with one or more C 1-20 alkyl
  • n is an integer selected from 1 to 20.
  • the present invention relates to a conjugate represented by the following general formula IIa or a pharmaceutically acceptable salt or solvate thereof.
  • Ab is an antibody or antigen-binding fragment that specifically binds to claudin 18 isoform 2 (CLDN18.2),
  • G is each independently a glucuronic acid moiety or ego;
  • R 3 is hydrogen or a carboxyl protecting group, and each R 4 is independently hydrogen or a hydroxyl protecting group;
  • R 1 and R 2 are each independently hydrogen, C 1-8 alkyl or C 3-8 cycloalkyl
  • W is each independently -C(O)-, -C(O)NR'-, -C(O)O-, -SO 2 NR'-, -P(O)R''NR'-, -SONR '- or -PO 2 NR'-, wherein C, S or P is directly bonded to a phenyl ring, wherein NR' is bonded to L, and R' and R'' are each independently hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di-C 1-8 alkylamino, C 3-20 heteroaryl or C 6- 20 is aryl;
  • each Z is independently hydrogen, C 1-8 alkyl, halogen, cyano or nitro;
  • n is an integer from 0 to 3;
  • Each L is independently any one of the following A) or B):
  • L is 1 to 50 membered heteroalkylene
  • said alkylene is substituted with one or more C 1-20 alkyl
  • B' is an active agent
  • l and m are each independently an integer selected from 1 to 20,
  • the active agents may each be the same or different.
  • G is a glucuronic acid moiety or a compound of formula (IIIa):
  • R 3 is hydrogen or a carboxyl protecting group
  • each R 4 is each independently hydrogen or a hydroxyl protecting group.
  • each G is independently ego
  • R 3 is hydrogen or a carboxyl protecting group
  • Each of said R 4 is independently hydrogen or a hydroxyl protecting group.
  • R 3 is hydrogen, and each R 4 is hydrogen.
  • R 1 and R 2 are each hydrogen.
  • each Z is independently hydrogen, C 1-8 alkyl, halogen, cyano or nitro.
  • W is -C(O)-, -C(O)NR'- or -C(O)O-, and more specifically, W is -C(O)NR'-, wherein C( O) is connected to a phenyl ring, and NR' is connected to L.
  • R' is hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di- C 1-8 alkylamino, C 3 20 heteroaryl or C 6-20 aryl.
  • n 0, 1, 2 or 3, more specifically 0, 1 or 2, and even more specifically 0.
  • G is a compound of formula (IIIa):
  • R 3 is hydrogen or a carboxyl protecting group
  • each R 4 is each independently hydrogen or a hydroxyl protecting group
  • W is -C(O)NR'-, wherein C(O) is connected to a phenyl ring and NR' is bonded to L, each Z is C 1-8 alkyl, halogen, cyano or nitro, n is 0, m is 1, and R 1 and R 2 are each hydrogen.
  • At least one L is alkylene having 1 to 100 carbon atoms, wherein the carbon atoms of the alkylene are one or more heteroatoms selected from the group consisting of N, O and S. may be substituted, and the alkylene may be further substituted with one or more alkyl having 1 to 20 carbon atoms.
  • At least one L is C 1-50 alkylene or 1-50 membered heteroalkylene, and may satisfy one or more of the following:
  • L is 1 to 50 membered heteroalkylene
  • said alkylene is substituted with one or more C 1-20 alkyl.
  • the at least one L is a nitrogen-containing 1-50 membered heteroalkylene
  • the linker includes two or more atoms of a hydrophilic amino acid
  • the nitrogen is capable of forming a peptide bond with a carbonyl of the hydrophilic amino acid.
  • L is C 2-50 alkylene, C 2-50 heteroalkylene, hydrophilic amino acid, -C(O)-, -C(O)NR''-, -C(O)O -, -(CH 2 ) s -NHC(O)-(CH 2 ) t -, -(CH 2 ) u -C(O)NH-(CH 2 ) v -, -(CH 2 ) s -NHC( O)-(CH 2 ) t -C(O)-, -(CH 2 ) u -C(O)NH-(CH 2 ) v -C(O)-, -S(O) 2 NR''- , -P(O)R'''NR''-, -S(O)NR''-, or -PO 2 NR''-,
  • R'' and R''' are each independently hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di-C 1 -8 alkylamino, C 3-20 heteroaryl or C 5-20 aryl, and s, t, u and v are each independently an integer from 0 to 10.
  • L is a nitrogen-containing 1-5 membered heteroalkylene
  • the linker includes two or more atoms of a hydrophilic amino acid, and the nitrogen forms a peptide bond with the carbonyl of the hydrophilic amino acid.
  • L is covalently bonded to the antibody through a thioether bond, and the thioether bond includes a sulfur atom of cysteine of the antibody.
  • At least one L is a hydrophilic amino acid.
  • the hydrophilic amino acid may be arginine, aspartate, asparagine, glutamate, glutamine, histidine, lysine, ornithine, proline, serine, or threonine.
  • the hydrophilic amino acid may be an amino acid comprising a side chain having a residue having a charge at neutral pH in aqueous solution.
  • the hydrophilic amino acid is aspartate or glutamate.
  • the hydrophilic amino acid is ornithine or lysine.
  • the hydrophilic amino acid is arginine.
  • At least one L is -C(O)-, -C(O)NR''-, -C(O)O-, -S(O) 2 NR''-, -P (O)R'''NR''-, -S(O)NR''-, or -PO 2 NR''-, wherein R'' and R'' are each independently hydrogen, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, mono- or di-C 1-8 alkylamino, C 3-20 heteroaryl, or C 6-20 aryl.
  • At least one L is -C(O)NR''-, -(CH 2 ) s -NHC(O)-(CH 2 ) t -, -(CH 2 ) u -C( O)NH-(CH 2 ) v -, -(CH 2 ) s -NHC(O)-(CH 2 ) t -C(O)-, or -(CH 2 ) u -C(O)NH-( CH 2 ) v —C(O)—, wherein R′′ is hydrogen, C 1-5 alkyl, C 3-8 cycloalkyl, C 1-5 alkoxy, C 3-20 heteroaryl, or C 6 -20 aryl, and s, tu and v are each independently an integer from 0 to 10.
  • At least one L is -C(O)NR''- and R'' is hydrogen.
  • At least one L is -(CH 2 ) s -NHCO-, and s is an integer from 1 to 5.
  • At least one L is -(CH 2 ) u -C(O)NH-(CH 2 ) v -C(O)-, u is an integer from 1 to 5, and v is 1 to an integer of 5.
  • L is,
  • L 1 is a direct bond or alkylene having 1 to 30 carbon atoms
  • R 11 is hydrogen or alkyl having 1 to 10 carbon atoms
  • L 2 is alkylene having 1 to 30 carbon atoms.
  • L further comprises a second unit represented by the general formula VIII or IX.
  • the at least one second unit is represented by the general formula VIII or IX:
  • V is a single bond, -O-, -S-, -NR 21 -, -C(O)NR 22 -, -NR 23 C(O)-, -NR 24 SO 2 - or -SO 2 NR 25 - ego;
  • X is —O—, C 1-8 alkylene or —NR 21 —;
  • R 21 to R 25 are each independently hydrogen, C 1-6 alkyl, C 1-6 alkyl C 6-20 aryl or C 1-6 alkyl C 3-20 heteroaryl;
  • r is an integer from 0 to 10;
  • p is an integer from 0 to 10;
  • q is an integer from 1 to 20;
  • w is an integer from 1 to 20;
  • q may be 4 to 20, more specifically 5 to 20. Also, q may be 1 to 10, or 2 to 12, and more specifically 2, 4, 5, or 11. Also, r may be 1 or 2. Also, p may be 1 or 2. Also, V may be -O-.
  • r may be 2
  • p may be 2
  • q may be 2
  • 4 5 or 11
  • V may be -O-.
  • X may be -O-.
  • w may be an integer from 4 to 20.
  • X is -O-, and w may be 1 to 10, or 4 to 20.
  • the at least one second unit is at least one polyethylene glycol unit, or has the structure of
  • n 1 to 12.
  • the at least one second unit is 1 to 12 -OCH 2 CH 2 -units, or 3 to 12 -OCH 2 CH 2 -units, or 5 to 12 -OCH 2 CH 2 -units, or 6 to 12 -OCH 2 CH 2 -unit, or 3 -OCH 2 CH 2 -unit.
  • the at least one second unit is -(CH 2 CH 2 X) w -,
  • X is a single bond, —O—, C 1-8 alkylene, or —NR 21 —;
  • R 21 is hydrogen, C 1-6 alkyl, C 1-6 alkyl-C 6-20 aryl, or C 1-6 alkyl-C 3-20 heteroaryl, w is an integer from 1 to 20, specifically 1, 3, 6, or 12.
  • X is -O-, and w is an integer from 6 to 20.
  • L comprises an oxime, and at least one polyethylene glycol unit covalently bonds the oxime to the active agent.
  • the linker is 1,3-dipolar cycloaddition reactions, hetero-Diels-Alder reactions, nucleophilic substitutions formed by reactions, non-aldol type carbonyl reactions, addition to carbon-carbon multiple bond, oxidation reactions or click reactions a third unit.
  • the third unit is formed by a reaction between an alkyne and an azide, or between an aldehyde or ketone group and a hydrazine or alkoxyamine.
  • L further includes a third unit represented by the following general formula IVa, IVb, IVc, IVd, or IVe.
  • L 1 is a single bond or alkylene having 1 to 30 carbon atoms
  • R 11 is hydrogen or C 1-10 alkyl.
  • the third unit comprises:
  • L 1 is a single bond or alkylene having 1 to 30 carbon atoms, preferably alkylene having 10, 11, 12, 13, 14, 15 or 16 carbon atoms;
  • R 11 is hydrogen or alkyl having 1 to 10 carbon atoms, specifically methyl
  • L 2 is alkylene having 1 to 30 carbon atoms.
  • L 1 and L 2 are each independently a single bond or C 1-30 alkylene; R 11 is hydrogen or C 1-10 alkyl.
  • L 1 is a single bond, or alkylene having 11 carbon atoms, or alkylene having 12 carbon atoms.
  • the third unit or including,
  • V is a single bond , -O-, -S-, -NR 21 -, -C(O)NR 22 -, -NR 23 C(O)-, -NR 24 SO 2 -, or -SO 2 NR 25 - is;
  • R 21 to R 25 are each independently hydrogen, C 1-6 alkyl, C 1-6 alkyl C 6-20 aryl, or C 1-6 alkyl C 3-20 heteroaryl;
  • r is an integer from 1 to 10;
  • p is an integer from 0 to 10;
  • q is an integer from 1 to 20;
  • L 1 is a single bond.
  • r may be 2 or 3. Also, p may be 1 or 2. Also, q may be 1 to 6.
  • r is 2 or 3; p is 1 or 2; q may be 1 to 6.
  • the linker comprising the third unit is
  • tilde indicates a site connected to the antibody construct
  • * indicates a site connected to the active agent
  • n is an integer from 0 to 20.
  • the third unit comprises: or includes
  • the linker is in a precursor state
  • the third unit may be formed by a reaction between an alkyne and an azide in the above structure, specifically, a click reaction.
  • the linker is in the precursor state.
  • Including, through the structure can form a third unit, the third unit
  • L is 3 to 50 heteroalkylene including oxime
  • the oxygen atom of the oxime is on the side of L linked to W and the carbon atom of the oxime is on the side of L linked with Ab;
  • the carbon atom of the oxime is on the side of L linked to W, and the oxygen atom of the oxime is on the side of L linked to Ab.
  • L comprises an oxime, and at least one isoprenyl unit is to covalently bond the oxime to Ab.
  • the linker is It may further contain at least one isoprenyl unit having the structure of , wherein n is at least 2 or more.
  • the at least one isoprenyl unit is a substrate of an isoprenoid transferase or a product of an isoprenoid transferase.
  • the isoprenyl unit of the linker is covalently bound to the antibody by a thioether bond, the thioether bond comprising the sulfur atom of the cysteine of the antibody construct.
  • the isoprenyl unit can covalently bond the oxime included in the linker to the antibody construct.
  • the antibody construct comprises an amino acid motif recognized by an isoprenoid transferase and the thioether bond comprises a sulfur atom of a cysteine of the amino acid motif.
  • the antibody construct comprises an amino acid motif recognized by an isoprenoid transferase and the thioether bond comprises a sulfur atom of a cysteine of the amino acid motif.
  • the amino acid motif is a sequence selected from the group consisting of CXX, CXC, XCXC, XXCC, and CYYX, wherein C represents cysteine; Y at each occurrence independently represents an aliphatic amino acid; X independently for each occurrence represents glutamine, glutamate, serine, cysteine, methionine, alanine, or leucine; The thioether linkage contains the sulfur atom of the cysteine of the amino acid motif.
  • the amino acid motif is the sequence CYYX, and Y for each occurrence is independently alanine, isoleucine, leucine, methionine or valine.
  • the amino acid motif is a CVIM or CVLL sequence.
  • At least one of 1 to 20 amino acids preceding the amino acid motif may be independently selected from glycine, arginine, aspartic acid and serine.
  • At least one of 1 to 20 amino acids preceding the amino acid motif is glycine.
  • one or more of the 1 to 10 amino acids preceding the amino acid motif may each be independently selected from glycine, arginine, aspartic acid and serine.
  • at least one of the seven amino acids preceding the amino acid motif is glycine.
  • at least three of the seven amino acids preceding the amino acid motif are each independently selected from glycine, arginine, aspartic acid and serine.
  • 1 to 10 amino acids preceding the amino acid motif are glycine, specifically, at least 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids preceding the amino acid motif are glycine.
  • the antibody may comprise the amino acid sequence of GGGGGGGCVIM.
  • L may include the amino acid sequence GGGGGGGCVIM at the C-terminus.
  • the second unit connects L and the third unit, L and the fourth unit, or the third unit and the fourth unit,
  • the one or more fourth units are capable of releasing one or more drugs or toxins
  • L is for connecting the second unit and the fourth unit, the second unit and the third unit, or the second unit with another second unit.
  • the fourth unit has the structure of formula (IIb):
  • G is a sugar, sugar acid, or sugar derivatives
  • W is -C(O)-, -C(O)NR'-, -C(O)O-, -S(O) 2 NR'-, -P(O)R''NR'-, -S (O)NR'-, or -PO 2 NR'-,
  • R' and R'' are each independently hydrogen, (C 1-8 )alkyl, (C 3-8 )cycloalkyl, (C 1 - 8 )alkoxy, (C 1-8 )alkylthio, mono- or di-(C 1-8 )alkylamino, (C 3-20 )heteroaryl, or (C 6-20 )aryl, W is L or connected to the second unit,
  • each Z is independently hydrogen, (C 1-8 )alkyl, halogen, cyano or nitro;
  • n is an integer from 1 to 3
  • n 0 or 1
  • R 1 and R 2 are each independently hydrogen, (C 1-8 )alkyl or (C 3-8 )cycloalkyl, or R 1 and R 2 together with the carbon atom to which they are attached are (C 3-8 )cycloalkyl. form an alkyl ring.
  • the sugar or sugar acid is a monosaccharide.
  • G is a compound of the structure (IIIa):
  • R 3 is hydrogen or a carboxyl protecting group
  • each R 4 is each independently hydrogen or a hydroxyl protecting group.
  • R 3 is hydrogen and each R 4 is hydrogen.
  • W is -C(O)NR'-, wherein C(O) is connected to a phenyl ring and NR' is connected to L or a second unit.
  • Z is hydrogen
  • R 1 and R 2 are each hydrogen.
  • the second unit is -(CH 2 ) r (V(CH 2 ) p ) q -, -((CH 2 ) p V) q -, -(CH 2 ) r (V(CH ) 2 ) p ) q Y-, -((CH 2 ) p V) q (CH 2 ) r -, -Y((CH 2 ) p V) q - or -(CH 2 ) r (V(CH 2 ) p ) represented by q YCH 2 -,
  • r is an integer from 0 to 10;
  • p is an integer from 1 to 10;
  • q is an integer from 1 to 20,
  • V and Y are each independently a single bond, -O-, -S-, -NR 21 -, -C(O)NR 22 -, -NR 23 C(O)-, -NR 24 SO 2 -, or - SO 2 NR 25 -,
  • R 21 to R 25 are each independently hydrogen, (C 1-6 )alkyl, (C 1-6 )alkyl(C 6-20 )aryl or (C 1-6 )alkyl(C 3-20 )heteroaryl .
  • r is 2.
  • p is 2.
  • q is an integer from 6 to 20.
  • q is 2, 5, or 11.
  • V and Y are each independently -O-.
  • L or the third unit is , , or including,
  • L 1 is a direct bond or alkylene having 1 to 30 carbon atoms
  • R 11 is hydrogen or alkyl having 1 to 10 carbon atoms, specifically methyl
  • L 2 is alkyl having 1 to 30 carbon atoms it's ren
  • L 1 is alkylene having 12 carbon atoms.
  • R 11 is methyl
  • L 2 is alkylene having 11 carbon atoms.
  • the Binding Unit is covalently bound to the antibody by a thioether bond, the thioether bond comprising the sulfur atom of a cysteine of the antibody.
  • the antibody comprises an amino acid motif recognized by an isoprenoid transferase, and the thioether bond comprises a sulfur atom of a cysteine of the amino acid motif.
  • the amino acid motif is a sequence selected from the group consisting of CXX, CXC, XCXC, XXCC, and CYYX, wherein C represents cysteine; Y at each occurrence independently represents an aliphatic amino acid; X independently for each occurrence represents glutamine, glutamate, serine, cysteine, methionine, alanine, or leucine; The thioether linkage contains the sulfur atom of the cysteine of the amino acid motif.
  • the amino acid motif is the sequence CYYX, and Y for each occurrence is independently alanine, isoleucine, leucine, methionine or valine.
  • the amino acid motif is a CVIM or CVLL sequence.
  • At least one of the 1 to 20 amino acids preceding the amino acid motif is glycine.
  • one or more of the 1 to 20 amino acids preceding the amino acid motif may each be independently selected from glycine, arginine, aspartic acid and serine.
  • 1 to 20 amino acids preceding the amino acid motif are glycine, in particular at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids are glycine.
  • the antibody may comprise the amino acid sequence of GGGGGGGCVIM.
  • the isoprenoid transferase is farnesyl protein transferase (FTase) or geranylgeranyl transferase (GGTase).
  • FTase farnesyl protein transferase
  • GTTase geranylgeranyl transferase
  • L comprises one or more branched linkers covalently bonded to Ab
  • each branched linker comprises a fifth unit covalently linked to the Ab by a first linker (PL);
  • each branched linker comprises a first branch (B1) wherein the first active agent is covalently linked to the fifth unit by a second linker (SL) and a cleavage group (CG); and
  • each branched linker comprises: a) a second branch (B2) wherein the second active agent is covalently linked to the fifth unit by a second linker (SL) and a cleavage group (CG); or b) a second branch (B2) wherein the polyethylene glycol moiety is covalently bound to the fifth unit,
  • Each of the cleavage groups may be hydrolyzed to release the active agent from the antibody construct-active agent conjugate.
  • the branched linker comprises a fifth unit (BR) covalently bonded to the reactive moiety by a first linker (PL);
  • the fifth unit comprises a first active agent covalently bonded to the first branch (B1) and covalently bonded to a second linker (SL) and a cleavage group (CG);
  • the fifth unit comprises a second active agent covalently linked to a second branch (B2) and covalently linked to a second linker (SL) and a cleavage group (CG) or b) a polyethylene glycol moiety, wherein Each cleavage group can be hydrolyzed to release the active agent.
  • the cleavage group is as shown in Formula II.
  • the second linker (eg, connecting the active agent to the fifth unit) is a 1,3-dipolar cycloaddition reaction, a hetero-Diels-Elder reaction (hetero) -Diels-Alder reaction, nucleophilic substitution reaction, non-aldol type carbonyl reaction, addition to a carbon-carbon multiple bond ), an oxidation reaction or a click reaction may include a third unit formed.
  • the third unit may be formed by a reaction of an alkyne with an azide as above, or a non-aldol-type carbonyl reaction, such as a reaction of an aldehyde or ketone group with a hydrazine or hydroxylamine, which is an active agent and/or to allow mild coupling of the cleavage group and L.
  • a non-aldol-type carbonyl reaction such as a reaction of an aldehyde or ketone group with a hydrazine or hydroxylamine, which is an active agent and/or to allow mild coupling of the cleavage group and L.
  • the fifth unit , , , , or ego the fifth unit , or ego,
  • the L 2 , L 3 , L 4 are each independently a direct bond or -C n H 2n -, wherein n is an integer from 1 to 30,
  • the G 1 , G 2 , G 3 are independently a direct bond, ,
  • R 30 is hydrogen or C 1-30 alkyl
  • R 40 is hydrogen, C 1-10 alkyl or -L 5 -COOR 50 , wherein L 5 is a direct bond or -C n H 2n -,
  • n is an integer from 1 to 10
  • R 50 is hydrogen or C 1-30 alkyl.
  • the fifth unit , , or ego the fifth unit , or ego
  • L 2 , L 3 , L 4 , G 1 , G 2 , G 3 , R 30 , R 40 , and L 5 may be the same as described above.
  • the cleavage group is cleavable in a target cell.
  • the cleavage group is capable of releasing one or more active agents.
  • the conjugate comprises Ab;
  • each branched linker is associated with one or two or more active agents
  • active agents are each the same or different.
  • each of said active agents is bound to a branched linker by a cleavable bond.
  • L is a linker comprising at least one fifth unit and a first linker (PL).
  • the first linker of the antibody-drug conjugate comprises an alkylene having 1 to 100, preferably 1 to 50 carbon atoms, or:
  • alkylene contains at least one unsaturated bond
  • alkylene includes at least one heteroarylene
  • a carbon atom of the alkylene is replaced by one or more heteroatoms selected from nitrogen (N), oxygen (O), and sulfur (S); or
  • Alkylene is further substituted with one or more alkyl having 1 to 20 carbon atoms.
  • each of said branched linkers comprises a fifth unit, each active agent binds to the fifth unit via a secondary linker, said fifth unit being an antibody by a primary linker is coupled to
  • the fifth unit is an amide and the primary linker comprises a carbonyl of the amide.
  • the fifth unit is a lysine unit.
  • At least one carbon atom of the alkylene is replaced with a nitrogen
  • the first linker comprises at least two atoms of a hydrophilic amino acid
  • the nitrogen forms a peptide bond with the backbone carbonyl of the hydrophilic amino acid.
  • the hydrophilic amino acid may be, for example, arginine, aspartate, asparagine, glutamate, glutamine, histidine, lysine, ornithine, proline, serine or threonine.
  • the branched linker of the antibody-active agent comprises an amino acid having a side chain with a charged moiety at neutral pH in aqueous solution, preferably arginine, aspartate, glutamate, lysine or ornithine.
  • the amino acid may be located anywhere in the branched linker.
  • the oxime of the branched linker can be covalently bonded to the polyethylene glycol unit of the branched linker.
  • such amino acids may be present in a second linker, optionally in each second linker.
  • the linker-activator comprises a compound of the following structural formula.
  • B' and B'' represent active agents, which may be the same or different;
  • n1 to n3 each independently represent an integer of 0 to 30;
  • AA represents an amino acid group
  • AA represents an amino acid group
  • the amino acid group refers to a form in which one or more amino acids are bound.
  • the linker comprises a peptide sequence of a plurality of amino acids; ii) at least two active agents are covalently linked with the side chain of the amino acid.
  • the amino acid group is linked to a main chain of 1 to 20 amino acids; or a side chain bond.
  • the amino acid group comprises 1 to 20 main chain bonds of arginine, aspartate, asparagine, glutamate, glutamine, histidine, lysine, ornithine, proline, serine or threonine; or a group by a side chain bond.
  • the amino acid group comprises 1 to 20 main chain bonds of arginine, aspartate, glutamate, lysine or ornithine; or a group by a side chain bond.
  • the amino acid group comprises at least one lysine of 1 to 20 amino acids.
  • amino acid group includes main chain and side chain bonds of lysine.
  • the branched linker comprising the fifth unit is
  • activator moiety refers to a compound covalently bonded to a linker or a portion of the linker, including an active agent.
  • an activator moiety may be directly bonded to the linker, and one or more, specifically, two or more, three or more, four or more, activator moieties to the linker may be directly bonded to the linker.
  • the active agent moiety in the present invention may include a compound unit for directly bonding the active agent to the linker.
  • a portion of the active agent moiety is cleavable and the portion can be cleaved to release the active agent in the intracellular environment.
  • the active moiety and the linker can determine the number of bonds in consideration of the DAR, pharmacological activity, etc. of the conjugate.
  • the active agent moiety may refer to the whole including the following structure and the active agent, through which the active agent and the linker may be directly bonded. However, this is illustrative and not limited thereto.
  • the active agents are each independently selected from a chemotherapeutic agent and a toxin.
  • the active agent may be an immunomodulatory compound, an anticancer agent, an antiviral agent, an antibacterial agent, an antifungal agent, an antiparasitic agent, or a combination thereof, and may optionally be used among the active agents listed below:
  • affinity ligand is a substrate, an inhibitor, an activator, a neurotransmitter, a radioactive isotope, or a combination thereof;
  • radioactive label 32P, 35S, fluorescent die, electron dense reagent, enzyme, biotin, streptavidin, dioxigenin, hapten, an immunogenic protein, a nucleic acid molecule with a sequence complementary to a target, or a combination thereof;
  • immunomodulatory compounds anticancer agents, anti-viral agents, anti-bacterial agents, anti-fungal agents , and an anti-parasitic agent, or a combination thereof;
  • the active agent is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-oxidedoxedoxedoxedoxethyl
  • y is an integer from 1 to 10.
  • the active agent is a pyrrolobenzodiazepine dimer
  • the linker and the antibody are connected through the N10 or N10' position of the pyrrolobenzodiazepine dimer.
  • -C(O)O-*, -S(O)O-*, -C(O)-*, -C(O)NR-*, - at the N10 and N10' positions of the pyrrolobenzodiazepine dimer each independently any one selected from the group consisting of S(O) 2 NR-*, -(P(O)R')NR-*, -S(O)NR-*, and -PO 2 NR-* groups is attached,
  • R and R' are each independently H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, substituted or unsubstituted C 1-8 alkyl, substituted or unsubstituted substituted C 3-8 cycloalkyl, substituted or unsubstituted C 1-8 alkoxy, substituted or unsubstituted C 1-8 alkylthio, substituted or unsubstituted C 3-20 heteroaryl, substituted or unsubstituted C 5-20 aryl or mono- or di-C 1-8 alkylamino;
  • C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1-8 alkylthio, C 3-20 heteroaryl, C 5-20 aryl are substituted, H, OH, N substituted with a substituent selected from the group consisting of 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NNH 2 , halo, C 1-6 alkyl, C 1-6 alkoxy and C 6-12 aryl;
  • a pyrrolobenzodiazepine dimer prodrug, a pharmaceutically acceptable salt or solvate thereof may be used as the active agent.
  • the N10 position of the pyrrolobenzodiazepine dimer is substituted with X at the N'10 position or X' at the N'10 position, wherein X or X' connects the pyrrolobenzodiazepine dimer to the linker;
  • X and X' are each independently -C(O)O*, -S(O)O-*, -C(O)-*, -C(O)NR X -*, -S(O) 2 NR X -*, -P(O)R'NR X -*, -S(O)NR X -*, or -PO 2 NR X -*;
  • R X and R X ' are independently H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, C 1-8 alkyl, C 3-8 cycloalkyl, C 1 - 8 alkoxy, C 1-8 alkylthio, C 3-20 heteroaryl, C 5-20 aryl or mono- or di(di)-C 1-8 alkylamino.
  • a pyrrolobenzodiazepine dimer precursor is provided as the active agent.
  • a pyrrolobenzodiazepine dimer precursor is provided as the active agent.
  • the antibody-drug conjugate prepared by the conventional method in the case of the antibody-drug conjugate prepared by the conventional method, the content of impurities is high and the exposed imine group is attacked by nucleophiles, which may result in the production of a drug having an unwanted structure.
  • the antibody-drug conjugate prepared by the method according to the present invention has the advantage of easy separation due to high purity, and it has been shown that the physical properties are more improved compared to the existing PBD or PBD dimer.
  • the pyrrolobenzodiazepine dimer precursor is a pyrrolobenzodiazepine dimer precursor, a pharmaceutically acceptable salt or solvate thereof, characterized in that it has the structure of Formula X or Formula XI:
  • the dotted line indicates the optional presence of a double bond between C1 and C2, between C2 and C3, between C'1 and C'2, or between C'2 and C'3;
  • R m ′ is selected from R m , CO 2 R m , COR m , CHO, CO 2 H, and halo;
  • each R m is independently C 1-12 alkyl, C 2-12 alkenyl, C 2-12 alkynyl, C 5-20 aryl, C 5-20 heteroaryl, C 3-6 cycloalkyl, 3-7 - selected from the group consisting of -membered heterocyclyl, 3 to 7-membered heterocycloalkyl, and 5 to 7-membered heteroaryl;
  • R X2 , R X2 ' R X3 , R X3 ', R X5 , and R X5 ' are independently H, R m , OH, OR m , SH, SR m , NH 2 , NHR m , NR m 2 , NO 2 , and halo;
  • R X4 and R X4 ′ are independently H, R m , OH, OR m , SH, SR m , NH 2 , NHR m , NR m 2 , NO 2 , halo, C 1-6 alkyl C 1-6 alkoxy; C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3-7 membered heterocycloalkyl, C 5-12 aryl, 5-7 membered heteroaryl, -CN, -NCO, -OR n , -OC(O)R n , -OC(O)NR n R n ', -OS(O)R n , -OS(O) 2 R n , -SR n , -S(O)R n , -S(O) 2 R n , -S(O)NR n R n ', -S(O) 2 NR n R n
  • X and X' are independently -C(O)O*, -S(O)O-*, -C(O)-*, -C(O)NR X -*, -S(O) 2 NR X -*, -P(O)R'NR X -*, -S(O)NR X -*, or -PO 2 NR X -*;
  • R X and R X ' are independently H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, C 1-8 alkyl, C 3-8 cycloalkyl, C 1 - 8 alkoxy, C 1-8 alkylthio, C 3-20 heteroaryl, C 5-20 aryl or mono- or di(di)-C 1-8 alkylamino;
  • Y and Y' are independently selected from O, S, and N(H);
  • R X6 is independently selected from C 3-12 alkylene, C 3-12 alkenylene, or C 3-12 heteroalkylene;
  • R X7 and R X7 ' are independently H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3-7 membered heterocycloalkyl, C 6- 10 aryl, 5-7 membered heteroaryl, -OR r , -OC(O)R r , -OC(O)NR r R r ', -OS(O)R r , -OS(O) 2 R r , -SR r , -S(O)R r , -S(O) 2 R r , -S(O)NR r R r ', -S(O) 2 NR r R r ', -OS(O) NR r R r ', -OS(O) NR r R r ', -OS(O) 2 NR r R r ', -OS(O) NR r
  • each R r , R r ', R s , and R s ' is independently H, C 1-7 alkyl, C 2-7 alkenyl, C 2-7 alkynyl, C 3-13 cycloalkyl, 3 to 7-membered heterocycloalkyl, C 5-10 aryl, and 5 to 7-membered heteroaryl;
  • each R X8 and R X8 ′ is independently H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 heteroalkyl, 3-7 membered heterocycloalkyl, C 5 -10 aryl, 5-7 membered heteroaryl, -S(O)R m , -S(O) 2 R m , -S(O)NR m R m ', -S(O) 2 NR m R m ', -NR m R m ', -NR m C(O)R m , -NR m C(O)OR n , -NR m C(O)NR n R n ', -NR m S(O)R n , -NR m S(O) 2 R n , -NR m S(O)NR n R n ', -NR m S(O) 2 NR n , -
  • Z a is selected from OR X12a , NR X12a R X12a , or SR X12a ;
  • Z b is selected from OR X13a , NR X13a R X13a , or SR X13a ;
  • Z a ' is selected from OR X12a ', NR X12a 'R X12a ', or SR X12a ';
  • Z b ' is selected from OR X13a ', NR X13 'R X13a ' or SR X13a ';
  • each R X12a , R X12a ', R X13a ' and R X13a ' is independently H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3-7 - membered heterocycloalkyl, C 5-10 aryl, 5-7 membered heteroaryl, -C(O)R X15a , -C(O)OR X15a and -C(O)NR X15a R X15a '; and
  • each R X15a and R X15a ′ is independently C 1-12 alkyl, C 2-12 alkenyl, C 2-12 alkynyl, C 5-20 aryl, C 5-20 heteroaryl, C 3-6 cycloalkyl , 3 to 7-membered heterocyclyl, 3 to 7-membered heterocycloalkyl, and 5 to 7-membered heteroaryl;
  • Z a and Z b are optionally taken together with the atoms to which they are attached to form a 3 to 7-membered heterocyclyl, 3 to 7-membered heterocycloalkyl, or 3 to 7-membered heteroaryl, and Z a ' and Z b ' are optionally taken together with the atom to which they are attached to form a 3 to 7-membered heterocyclyl, 3 to 7-membered heterocycloalkyl, or 3 to 7-membered heteroaryl; and
  • each of R n , R n ', R o , R o ', R p , and R p ' is independently H, C 1-7 alkyl, C 2-7 alkenyl, C 2-7 alkynyl, C 3-13 cycloalkyl, 3 to 7-membered heterocycloalkyl, C 5-10 aryl, and 5 to 7-membered heteroaryl.
  • R m is independently C 1-12 alkyl, C 2-12 alkenyl, C 2-12 alkynyl, C 5-20 aryl, C 5-20 heteroaryl, C 3-6 selected from the group consisting of cycloalkyl, 3 to 7-membered heterocyclyl, 3 to 7-membered heterocycloalkyl, and 5 to 7-membered heteroaryl,
  • R m is additionally C 1-12 alkyl, C 2-12 alkenyl, C 2-12 alkynyl, C 5-20 aryl, C 5-20 heteroaryl, C 3-6 cycloalkyl , 3 to 7-membered heterocyclyl, 3 to 7-membered heterocycloalkyl, or 5 to 7-membered heteroaryl.
  • R X4 and R X4 ' are independently H, R m , OH, OR m , SH, SR m , NH 2 , NHR m , NR m R m ', NO 2 , halo, C 1-6 alkyl C 1-6 alkoxy, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3-7 membered heterocycloalkyl, C 5-12 aryl, 5-7- membered heteroaryl, -CN, -NCO, -OR n , -OC(O)R n , -OC(O)NR n R n ', -OS(O)R n , -OS(O) 2 R n , -SR n , -S(O)R n , -S(O) 2 R n , -S(O)NR n R n ', -S
  • R X4 or R X4 ' is C 1-6 alkyl, C 1-6 alkoxy, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3-7 membered heterocycloalkyl, C 5-12 aryl or 5-7 membered heteroaryl, additionally one or more C 1-6 alkyl, C 1-6 alkoxy, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl , 3-7-membered heterocycloalkyl, C 5-10 aryl, 5-7-membered heteroaryl, -OR p , -OC(O)R p , -OC(O)NR p R p ', -OS( O)R p , -OS(O) 2 R p , -SR p , -S(O)R p , -S(O) 2 R p , -S(O)NR p R
  • R X7 and R X7 ' are independently H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3 to 7- membered heterocycloalkyl, C 6-10 aryl, 5-7 membered heteroaryl, -OR r , -OC(O)R r , -OC(O)NR r R R r ', -OS(O)R r , -OS(O) 2 R r , -SR r , -S(O)R r , -S(O) 2 R r , -S(O)NR r R r ', -S(O) 2 NR r R r ', -OS(O)NR r R r ', -OS(O) 2 NR r R r ', -OS(O)NR r R r ', -OS(O) 2 NR
  • R X7 or R X7 ' is C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3 to 7-membered heterocycloalkyl, C 6-10 aryl, 5 to 7-membered heteroaryl, additionally C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, C 3-6 cycloalkyl, 3 to 7-membered heterocycloalkyl, C 6-10 aryl, 5-7 membered heteroaryl, -OR t , -OC(O)R t , -OC(O)NR t R t ', -OS(O)R t , -OS(O) 2 R t , -SR t , -S(O)R t , -S(O) 2 R t , -S(O)NR t R t ', -S(O) 2 NR
  • R r , R r ', R s , R s ', R t , R t ', R u and R u ' are independently H, C 1-7 alkyl, C 2-7 alkenyl, C 2-7 alkynyl, C 3-13 cycloalkyl, 3-7 membered heterocycloalkyl, C 5-10 aryl, and 5-7 membered heteroaryl.
  • R X1 and R X1 ' are independently selected from R m ;
  • R m is selected from C 1-6 alkyl, C 2-6 alkenyl, C 5-7 aryl and C 3-6 heteroaryl.
  • R X2 , R X2 ′, R X3 , R X3 ′, R X5 , and R X5 ′ are independently selected from H or OH.
  • R X4 and R X4 ′ are independently selected from R m ;
  • R m is C 1-6 alkoxy.
  • R X4 and R X4 ' are independently any one selected from the group consisting of methoxy, ethoxy and butoxy.
  • Y and Y' are O.
  • R X6 is C 3-12 alkylene, C 3-12 alkenylene or C 3-12 heteroalkylene, and R X6 is -NH 2 , -NHR m , -NHC(O )R m , —NHC(O)CH 2 —[OCH 2 CH 2 ] n —R XX , or —[CH 2 CH 2 O] n —R XX substituted;
  • R XX is H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1 -8 alkylthio, C 3-20 heteroaryl, C 5-20 aryl or mono- or di-C 1-8 alkyl amino; and
  • n is an integer from 1 to 6.
  • the pyrrolobenzodiazepine dimer is represented by the following general formula X.
  • the dotted line indicates the optional presence of a double bond between C1 and C2, between C2 and C3, between C'1 and C'2, or between C'2 and C'3;
  • R X2 , R X2 ′ R X3 , and R X3 ′ are each independently selected from H, R m , OH, OR m , NR m 2 , NO 2 , and halo;
  • R X4 and R X4′ are each independently selected from H, R m , OH, OR m , SH, SR m , NH 2 , NHR m , NR m 2 , halo, and C 1-6 alkyl;
  • R X5 and R X5' are each independently H, R m , OH, OR m , SH, SR m , NH 2 , NHR m , NR m 2 , -NR m R m ', NO 2 , -NR m C( O)R m' , -NR m C(O)OR m' , -NR m C(O)NR m R m' , -S(O)R m , -S(O) 2 R m , -S( O)NR m R m ', -S(O) 2 NR m R m ', -NR m S(O)R m ', -NR m S(O) 2 R m ', -P(O)R m , -P(O)NR m R m ', -P(O) 2 NR m R m ', -P(O) 2
  • Y and Y' are each independently O, S, or N(H);
  • R X6 is independently C 3-12 alkylene, C 3-12 alkenylene, or C 3-12 heteroalkylene; R X6 is -NH 2 , -NHR m , -NHC(O)R m , -NHC(O)CH 2 -[OCH 2 CH 2 ] n -R XX , or -[CH 2 CH 2 O] n -R XX is substituted or unsubstituted;
  • R XX is H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1 -8 alkyl thio, C 3-20 heteroaryl, C 5-20 aryl or mono- or di-C 1-8 alkylamino, wherein n is an integer from 1 to 6;
  • R X7 and R X7 ' are each independently H, C 1-6 alkyl, C 2-6 alkenyl, C 2-6 alkynyl, -C(O)R r , -C(O)OR s or -C (O)NR r R r ';
  • R r , R r ', and R s are each independently H, C 1-7 alkyl, C 2-7 alkenyl, C 2-7 alkynyl, C 3-13 cycloalkyl, 3-7 membered heterocyclo alkyl, C 5-10 aryl or 5 to 7 membered heteroaryl;
  • each R m' is independently selected from R m , CO 2 R m , COR m , CHO, CO 2 H, and halo;
  • R X2 , R X2 ′, R X3 , and R X3 ′ are each independently selected from H or OH.
  • the R X5 , and R X5 ' are each independently H, OH, -S(O)R m , S(O) 2 R m , -P(O)R m , and -P (O) 2 R m is selected from the group consisting of, wherein R m is H, OH, C 1-12 alkyl, C 1-12 alkoxy, C 2-12 alkenyl, or C 2-12 alkynyl.
  • R X4 and R X4 ' are each independently C 1-6 alkoxy.
  • R X4 and R X4 ' are independently any one selected from the group consisting of methoxy, ethoxy and butoxy.
  • Y and Y' are O.
  • R X6 is C 3-12 alkylene, C 3-12 alkenylene or C 3-12 heteroalkylene, and R X6 is -NH 2 , -NHR m , -NHC(O )R m , -NHC(O)CH 2 -[OCH 2 CH 2 ] n -R XX , or -[CH 2 CH 2 O] n -R XX ;
  • R XX is H, OH, N 3 , CN, NO 2 , SH, NH 2 , ONH 2 , NHNH 2 , halo, C 1-8 alkyl, C 3-8 cycloalkyl, C 1-8 alkoxy, C 1 -8 alkylthio, C 3-20 heteroaryl, C 5-20 aryl or mono- or di-C 1-8 alkyl amino; and
  • n is an integer from 1 to 6.
  • the active agent is a pyrrolobenzodiazepine dimer represented by the general formula XII or XIII:
  • X a and X a ' are independently selected from a bond or C 1-6 alkylene;
  • Z X ' and Z X are independently hydrogen, C 1-8 alkyl, halogen, cyano, nitro, , or -(CH 2 ) m -OCH 3 ;
  • n is an integer from 0 to 12;
  • Z X ' and Z X are independently hydrogen, , And -(CH 2 ) m -OCH 3 Any one selected from the group consisting of,
  • R 80 , R 90 and R 100 is any one selected from the group consisting of hydrogen, C 1-3 alkyl and C 1-3 alkoxy,
  • n 1 to 6.
  • the [LINKER-(B) l ] precursor is
  • the [LINKER-(B) l ] precursor is
  • MMAE is monomethyl auristatin E
  • MMAF is monomethyl auristatin F.
  • the [LINKER-(B) l ] precursor comprises the following structure.
  • B' and B'' represent an active agent, which may be the same or different;
  • n and n each independently represent an integer of 0-30.
  • the present invention relates to a pharmaceutical composition for the prevention or treatment of hyperproliferative, cancer, or angiogenic diseases comprising the conjugate.
  • the pharmaceutical composition further comprises a pharmaceutically effective amount of a chemotherapeutic agent.
  • the cancer is lung cancer, small cell lung cancer, gastrointestinal cancer, colorectal cancer, bowel cancer, breast cancer, ovarian cancer, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreatic cancer, brain cancer, sarcoma, osteosarcoma, Kaposi Any one selected from the group consisting of sarcoma and melanoma.
  • the present invention also relates to a pharmaceutical formulation comprising the conjugate.
  • parenteral means an administration route in a broad sense, for example, transdermal, intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, intranasal, sublingual, intrathecal (intrathecal), inhalation, ocular, rectal, vaginal, ventricular administration, and the like.
  • composition When formulating the composition, it is usually prepared using a diluent or excipient such as a filler, an extender, a binder, a wetting agent, a disintegrant, and a surfactant.
  • a diluent or excipient such as a filler, an extender, a binder, a wetting agent, a disintegrant, and a surfactant.
  • Solid preparations for oral administration include tablets, patients, powders, granules, capsules, troches, and the like, and such solid preparations include at least one compound according to the present invention and at least one excipient, for example, starch, calcium carbonate, It is prepared by mixing sucrose or lactose or gelatin.
  • excipients for example, starch, calcium carbonate, It is prepared by mixing sucrose or lactose or gelatin.
  • lubricants such as magnesium stearate talc are also used.
  • Liquid formulations for oral administration include suspensions, solutions, emulsions, or syrups.
  • various excipients such as wetting agents, sweeteners, fragrances, and preservatives may be included. can
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspension solutions, emulsions, injections, freeze-dried formulations, suppositories, and the like.
  • propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solutions and suspensions.
  • injectable esters such as ethyl oleate
  • witepsol, macrogol, tween 61, cacao butter, laurin fat, glycerol, gelatin, etc. may be used as the base of the suppository.
  • the conjugate according to the present invention is administered in a pharmaceutically effective amount.
  • pharmaceutically effective amount means an amount sufficient to treat a disease with a reasonable benefit/risk ratio applicable to medical treatment, and the effective dose level is the type, severity, and drug activity of the patient. , sensitivity to the drug, administration time, administration route and excretion rate, duration of treatment, factors including concurrent drugs, and other factors well known in the medical field.
  • the composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be administered single or multiple. In consideration of all of the above factors, it is important to administer an amount that can obtain the maximum effect with a minimum amount without side effects, which can be easily determined by those skilled in the art.
  • the effective amount of the conjugate according to the present invention may vary depending on the age, sex, and weight of the patient, and is generally 0.01 mg to 150 mg per kg body weight, more specifically 0.1 mg to 100 mg per kg body weight. It can be administered daily or every other day, or divided into 1 to 3 times a day. However, since it may increase or decrease depending on the route of administration, severity, sex, weight, age, etc., the dosage is not intended to limit the scope of the present invention in any way.
  • the antibody-drug conjugate according to the present invention contains an anti-CLDN18.2 antibody that specifically binds to claudin 18 isoform 2 (CLDN18.2) expressing cells and is internalized into the cells, thereby effectively and specific for the drug. It can be delivered selectively and selectively, and the drug is stably bound to the antibody to exhibit the desired cytotoxicity while maintaining in vivo stability.
  • grafting linker technology that includes a self-immolative group that is more stable in plasma and is stable even in circulation in the body, and the drug is easily released within cancer cells to maximize drug efficacy, drugs and/or toxins are transferred to target cells. It has the effect of providing a drug-linker-ligand system that can stably reach and effectively exhibit drug effects while significantly lowering toxicity.
  • FIGS. 2 and 3 are diagrams showing the in vivo experimental results of ADC samples.
  • FIGS 4 to 7 are schematic diagrams of the manufacturing process of the ADC according to the present invention.
  • the present invention is an antibody or antigen-binding fragment, wherein the antibody specifically binds to claudin 18 isoform 2 (CLDN18.2) comprising a heavy chain variable region and a light chain variable region, and the heavy chain variable region is SEQ ID NO: 2 a heavy chain CDR1 consisting of the amino acid sequence shown in SEQ ID NO: 4, a heavy chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 4, and a heavy chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 6, wherein the light chain variable region has an amino acid sequence shown in SEQ ID NO: 9 It relates to a conjugate comprising a light chain CDR1 consisting of, a light chain CDR2 consisting of the amino acid sequence shown in SEQ ID NO: 11, and a light chain CDR3 consisting of the amino acid sequence shown in SEQ ID NO: 13.
  • PR002726-heavy chain SEQ ID NO: FR1 EVQLLESGGGLVQPGGSLRLSCAAS One CDR1 GFTFSSFVMS 2 FR2 WVRQAPGKGLEWVS 3 CDR2 TISGSGRSTYYADSVKG 4 FR3 RFTISRDNSKNTLHLQMNSLRAEDTAVYYCAK 5 CDR3 DAAAAGTKFDY 6 FR4 WGQGTLVTVSS 7 V H EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFVMSWVRQAPGKGLEWVSTISGSGRSTYYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCAKDAAAAGTKFDYWGQGTLVTVSS 15 HC EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFVMSWVRQAPGKGLEWVSTISGSGRSTYYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCAKDAAAAGTKFDYWGQGTLVTV
  • the light chain FR4 (SEQ ID NO: 14) C-terminus of the antibody of Table 1 (PR002726) was fused with a CaaX peptide moiety (GGGGGGGCVIM; SEQ ID NO: 19) to prepare an antibody clone PR301839, and CHO cell-based Antibodies were produced through transient expression.
  • the produced PR301839 antibody was used for the next ADC synthesis.
  • the compounds 1 and 2 were prepared by the method described in Korean Patent Application Laid-Open No. 10-2018-0110645.
  • the compound 3 was prepared by the method described in International Patent Publication No. WO2017-089895.
  • the compound 4 and compound 5 were prepared by the method described in patent WO2017-089890.
  • ADC was prepared through the following two steps, and LCB14-0606 and LCB14-0512, which were commonly used, were prepared by the method described in Korean Patent Application Laid-Open No. 10-2014-0035393.
  • the structural formulas of LCB14-0606 and LCB14-0512 are as follows:
  • a prenylation reaction mixture of the antibody prepared in Example 1 was prepared and reacted at 30° C. for 16 hours.
  • the reaction mixture was prepared in a buffer containing 24 ⁇ M antibody, 400 nM FTase (Calbiochem #344145) and 0.25 mM LCB14-0511 or LCB14-0606 (50 mM Tris-HCl (pH 7.4), 5 mM MgCl 2 , 10 ⁇ M ZnCl 2 ) , 0.25 mM DTT).
  • the prenylated antibody was decontaminated with a G25 Sepharose column (AKTA purifier, GE healthcare) equilibrated with PBS buffer.
  • Step 2 Drug-conjugation method
  • the oxime bond generation reaction mixture between the prenylated antibody and the linker-drug was prepared in 100 mM Na-acetate buffer pH 5.2, 10% DMSO, 20 ⁇ M antibody and 200 ⁇ M linker-drug (in house, the compounds of Examples 1 and 2) 1, 2, 3, 4, 5, 7, and 8) were mixed and stirred gently at 30°C. After 6 hours or 24 hours of reaction, excess low molecular weight compounds were removed through FPLC (AKTA purifier, GE healthcare) process, and protein fractions were collected and concentrated.
  • FPLC AKTA purifier, GE healthcare
  • ADC using a copper-free click binding reaction between prenylated antibody and linker-drug was performed in PBS buffer (pH 7.4), 1% DMSO, 10 ⁇ M prenylated antibody and 100 ⁇ M linker-drug (in house, carried out)
  • Compound No. 2 of Example 1 was mixed to prepare a reaction mixture, and after reaction at 25 ° C for 6 hours, FPLC (AKTA purifier, GE healthcare) or G25 Sepharose column process was performed to remove excess low molecular weight compounds. concentrated.
  • the cancer cell binding ability of the Anti-CLDN18.2 antibody (PR002726) and the antibody (PR301839) used to prepare the ADC in the form of a CaaX peptide fused to the light chain FR4 C-terminus was confirmed by a cell binding experiment using a flow cytometer (FACS).
  • gastric cancer cell lines SNU-601 and SNU-620 known to express CLDN18.2, and pancreatic cancer cell line PATU-8988s were used as cancer cells.
  • a group treated with human IgG as a control antibody and a group treated with only a secondary antibody were used. .
  • PR002726 and PR301839 in SNU-601 were 22.95 times and 17.5 times stronger than the IgG control group, respectively.
  • PR002726 and PR301839 were confirmed to bind 15.09 times and 11.21 times stronger than the control group.
  • PATU-8988s PR301839 was confirmed to bind 16.21 times stronger than the control.
  • the two antibodies PR002726 and PR301839 were capable of binding to cancer cells expressing CLDN18.2. (See Fig. 1)
  • the cell proliferation inhibitory activity of the drugs and ADCs shown in Table 4 below was measured against cancer cell lines.
  • cancer cell lines commercially available human gastric cancer cell lines NUGC-4, SNU-601 SNU-602 and pancreatic cancer cell line PATU-8988s were used, and normal cell lines HaCaT, Fa2N-4, HK-2, and HS738.st/Int were used.
  • drugs MMAE and SG2057 were used as ADCs, and the ADCs in Table 3 were used.
  • Each cancer cell line was inoculated in a 96-well plate for 144 hours in a 144-hour treatment group, and 2,500 to 10,000 per well were seeded and cultured for 24 hours.
  • the auristatin-based antibody-drug complex (ADC3) showed equivalent or higher cytotoxicity than the pyrrolobenzodiazepine-based antibody-drug complex (ADC1, ADC2) in the cytotoxicity test with the same time response.
  • the pyrrolobenzodiazepine-based antibody-drug complex (ADC3, ADC4, ADC5) was compared to the auristatin-based antibody-drug complex (ADC3, ADC4, ADC5) in the same time response cytotoxicity test. of the antibody-drug complex (ADC1, ADC2) was confirmed to show strong cytotoxicity.
  • both 0.2 and 0.4 mg/kg of the pyrrolobenzodiazepine-based antibody-drug complex ADC1 confirmed the tumor growth inhibitory efficacy compared to the control group.
  • the tumor growth inhibitory efficacy was confirmed in a dose-dependent manner compared to the control group.
  • the experimental results (primary) of the in vivo efficacy of the ADC samples are shown in FIG. 2.
  • the secondary experimental results it was confirmed that the tumor growth inhibitory efficacy of the ADC3 1 mg/kg group was similar to the results of the primary experiment.
  • all doses of ADC4 and ADC5 the tumor growth inhibitory efficacy was confirmed in a dose-dependent manner.
  • the in vivo efficacy comparison experiment results (secondary) of ADC samples are as shown in FIG. 3 .
  • Fc ⁇ RI and Fc ⁇ RII interact with distinct but overlapping sites on human
  • the present invention can be usefully used in the pharmaceutical field through novel antibody-drug conjugates targeting claudin 18 subtype 2, active metabolites thereof, methods for preparing the same, uses thereof, and pharmaceutical compositions comprising the same.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Gastroenterology & Hepatology (AREA)

Abstract

본 발명은 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)를 타겟팅하는 신규한 항체-약물 접합체(antibody-drug conjugate, ADC), 이들 ADC의 활성 대사물, 이들 ADC의 제조방법, 병의 치료 및/또는 예방을 위한 이들 ADC의 용도, 및 또한 병, 더 상세하게는 과증식 및/또는 혈관신생질환 예컨대, 암 질환의 치료 및/또는 예방을 위한 약제를 생산하기 위한 이들 ADC의 용도에 관한 것이며, 보다 구체적으로, CLDN18.2에 결합하는 항체 또는 이의 항원 결합단편을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물에 관한 것이다.

Description

인간 CLDN18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도
본 발명은 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)를 타겟팅하는 신규한 항체-약물 접합체(antibody-drug conjugate, ADC), 이들 ADC의 활성 대사물, 이들 ADC의 제조방법, 병의 치료 및/또는 예방을 위한 이들 ADC의 용도, 및 또한 병, 더 상세하게는 과증식 및/또는 혈관신생질환 예컨대, 암 질환의 치료 및/또는 예방을 위한 약제를 생산하기 위한 이들 ADC의 용도에 관한 것이며, 보다 구체적으로, CLDN18.2에 결합하는 신규한 항체 또는 이의 항원 결합 단편을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물에 관한 것이다.
암(cancer)은 신체 조직의 자율적인 과잉 성장에 의해 비정상적으로 자라난 덩어리로 인한 질환을 말하며, 다양한 조직에서 조절되지 않는 세포 성장의 결과이다. 초기 단계 종양은 수술 및 방사선치료 조치에 의해 제거될 수 있으며, 전이된 종양의 경우 일반적으로 화학요법제에 의해 완화치료를 하게 된다.
비경구로 투여되는 대다수 화학요법제는 전신 투여의 결과로서 원치 않는 부작용 및 심지어 독성이라는 심각한 효과를 유도할 수 있으며, 따라서 종양 세포 또는 바로 인접한 조직에서 이들 화학요법제의 개선되었으면서도 선택적인 적용을 통해 약효 증가 및 독성/부작용의 최소화를 동시에 이루기 위한 신규한 화학 요법제의 개발에 초점이 맞추어져 왔다.
항체-약물 접합체(antibody-drug conjugate, ADC)는 항원과 결합하는 항체에 독소 또는 약물을 결합시킨 후 세포 내부에서 독성물질을 방출하면서 암 세포 등을 사멸에 이르게 하는 표적지향성 신기술이다. 건강한 세포에는 최소한으로 영향을 주면서 약물을 타겟 암세포에 정확하게 전달하고, 특정한 조건하에서만 방출되도록 해주기 때문에 항체 치료제 자체보다 효능이 우수하고 기존의 항암제들에 비해 부작용의 위험성을 크게 낮출 수 있는 기술이다.
이러한 항체-약물 접합체의 기본 구조는 "항체-링커-저분자 약물(독소)"로 구성되어 있다. 여기서 링커는 단순히 항체와 약물을 연결시켜 주는 기능적인 역할뿐 아니라, 체내 순환시 안정하게 타겟 세포까지 도달 후 항체-약물 접합체가 세포 내로 들어가 항체-약물간 해리현상(예, 효소에 의한 가수분해에 의한 결과)에 의해 약물이 잘 떨어지면서 타겟 암세포에 약효를 나타내도록 해야 한다. 즉 링커의 안정성에 따라 항체-약물 접합체의 효능 및 전신독성(systemic toxicity) 등의 안전성 면에서 링커는 매우 중요한 역할을 한다(Discovery Medicine 2010, 10(53): 329-39). 85-8 2018-08-14)
본 발명의 발명자는 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며 약물이 암세포 내에서 쉽게 방출되어 약효를 나타낼 수 있는 효과적인 자가-희생 기(self-immolative group)을 포함하는 링커를 개발하여 이에 대해 특허를 확보한바 있다(한국등록특허 제1,628,872호). 한편 암 치료를 위한 단일클론 항체의 사용은 상당한 성공을 거두고 있다. 단일클론 항체는 종양 조직 및 종양 세포의 표적-지향된 어드레싱(addressing)에 적당하다. 항체 약물 접합체들은 림프종과 고형암 치료를 위해 강력하고 새로운 치료의 옵션이 되었으며, 최근 들어 면역 조절 항체들도 임상에서 상당한 성공을 거두고 있다. 치료 항체들의 개발은 암 혈청학, 단백질 엔지니어링 기술과 그 작용, 저항성의 기작들 및 면역 시스템과 암세포들 간의 상호 작용에 대한 깊은 이해를 바탕으로 한다.
인간 암의 세포 표면에서 발현되는 항원의 정의는 정상 조직에 비해 과다 발현되거나 돌연변이 및 선택적으로 발현되는 광범위한 목표물들을 의미한다. 핵심적인 문제는 항체를 기반으로 한 치료법들에 적절한 항원을 동정하는 것이다. 이러한 치료제들은 항원이나 수용체 기능(즉, 자극제로서나 길항제로서의 기능)의 변화를 매개하고 Fc 과 T 세포 활성화를 통해 면역 시스템을 조절하며 특정한 항원을 목표로 하는 항체에 결합되는 특정한 약물의 전달을 통해 그 효능을 발휘한다. 항체 약동학(pharmacokinetics), 작용 기능, 사이즈와 면역 자극성을 변화시킬 수 있는 분자 기술들은 새로운 항체를 기반으로 한 치료법들의 개발에서 핵심적인 요소로 등장하고 있다. 암 환자들을 대상으로 한 치료 항체들의 임상 시도에서 얻은 증거들은 목표 항원과 항체들의 친화성 및 결합성, 항체 구조의 선택, 치료적 접근법(신호전달 차단이나 면역 작용 기능)을 포함하는 최적화된 항체들의 선택을 위한 접근법들의 중요성을 강조하고 있다.
인간 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)는 전장(full length) 261개의 아미노산으로 구성되며, 2개의 세포 외 루프와 4개의 막관통 도메인으로 이루어진 막관통형의 막단백질이다. 일부 정상 조직에 발현하는 CLDN18.1과는 세포외 도메인 루프 1까지의 아미노산 서열 일부가 다르다.
CLDN18.2는 밀착연접(tight junction)의 중요한 구성 요소인 클라우딘 계열(claudin family)에 속하는데 클라우딘(claudin) 단백질은 다양한 암 조직에서 발현하여, 진단 및 치료 양식의 잠재적 표적으로 알려져 있다. 또한 종양 형성과 염증 반응에 중요한 역할을 수행하는 것으로 알려져 있으며, 클라우딘 단백질 발현의 변화는 밀착연접의 기능 장애를 유발하고, 신호 전달 경로에 영향을 미치며, 일부 상피암에서 종양 촉진 작용을 하는 것으로 알려져 있다. 또한, CLDN18.2는 일부 위 점막의 정단부(apical region)에서의 발현을 제외하면, 원발성 및 전이성 위암에서 특이적으로 발현하며, 악성 형질 전환과도 연관이 있는 암특이적 항원으로 알려져 있고, 췌장암, 식도암, 난소암, 폐암 등에서 이소성 활성화가 보고되어 있다.
이러한 기술적 배경하에서, 본 발명의 발명자는 정상 조직에서도 발현하는 CLDN18.1과는 구분되는 종양특이적 발현을 보이는 CLDN18.2에 특이적으로 결합하는 항체를 개발하기 위하여 노력한 결과, CLDN18.2에 우수한 결합력을 나타내는 항-CLDN18.2 항체를 개발하였으며, 항체의 효과를 더욱 강화하기 위하여 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며 약물이 암세포 내에서 쉽게 방출되어 약효를 나타낼 수 있는 효과적인 자가-희생 기(self-immolative group)을 포함하는 링커를 CLDN18.2에 특이적으로 결합하는 항암 치료용 항체에 적용하여, 과증식 및/또는 전이암 질환의 치료 및/또는 예방에 효과적인 CLDN18.2를 타겟팅하는 신규한 항체-약물 접합체(ADC)를 제공할 수 있음을 확인하고, 본 발명을 완성하게 되었다.
본 발명은 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)를 타겟팅하는 신규한 항체-링커 약물 접합체 또는 이의 염, 용매화물을 제공하고자 한다.
본 발명은 CLDN18.2에 특이적으로 결합하는 항체 및 이에 결합하는 약물을 포함하는 항체-약물 접합체 및 이를 포함하는 약학 조성물을 제공하고자 한다.
본 발명에서는 또한 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며, 약물이 암세포 내에서 쉽게 방출되어 약효를 극대화할 수 있는 자가-희생기를 포함하는 링커 기술을 접목시켜, 약물 및/또는 톡신이 표적 세포에 안정적으로 도달하여 약효를 효과적으로 발휘하면서도 독성을 크게 낮출 수 있는, 항체-링커-약물(톡신) 시스템을 제공하고자 한다.
본 발명의 일 양태에서, 하기 일반식 I로 표시되는 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물이 제공된다:
[일반식 I]
Ab-[LINKER-(B)l]m
상기 식에서,
Ab는 중쇄 가변영역 및 경쇄 가변영역을 포함하는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
중쇄 가변영역은 서열번호 2로 표시되는 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 4로 표시되는 아미노산 서열로 이루어진 중쇄 CDR2, 서열번호 6으로 표시되는 아미노산 서열로 이루어진 중쇄 CDR3을 포함하고,
경쇄 가변영역은 서열번호 9로 표시되는 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 11로 표시되는 아미노산 서열로 이루어진 경쇄 CDR2, 서열번호 13 으로 표시되는 아미노산 서열로 이루어진 경쇄 CDR3을 포함하며,
LINKER는 링커이고,
B는 활성제 모이어티이며,
l 및 m은 각각 독립적으로 1 내지 20 중에서 선택되는 정수이며,
l이 2 이상의 정수인 경우, B는 각각 서로 동일하거나 상이할 수 있다.
본 발명의 일 양태에서, 상기 CLDN18.2(claudin 18 isoform 2)에 특이적으로 결합하는 항체 또는 항원 결합단편은 중쇄 가변영역 및 경쇄 가변영역을 포함하고,
중쇄 가변영역은 서열번호 2로 표시되는 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 4로 표시되는 아미노산 서열로 이루어진 중쇄 CDR2, 서열번호 6 으로 표시되는 아미노산 서열로 이루어진 중쇄 CDR3을 포함하고,
경쇄 가변영역은 서열번호 9로 표시되는 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 11로 표시되는 아미노산 서열로 이루어진 경쇄 CDR2, 서열번호 13 으로 표시되는 아미노산 서열로 이루어진 경쇄 CDR3을 포함한다.
또한, 상기 중쇄 가변영역은 인간 항체의 중쇄 FR을 포함하고, 상기 중쇄 FR을 암호화하는 유전자는 배선 V 유전자 IGHV3-23(germline V gene IGHV3-23)으로부터 유래될 수 있다. 구체적으로, 상기 중쇄 FR은 서열번호 1로 표시되는 아미노산 서열로 이루어진 중쇄 FR1, 서열번호 3으로 표시되는 아미노산 서열로 이루어진 중쇄 FR2, 서열번호 5로 표시되는 아미노산 서열로 이루어진 중쇄 FR3, 서열번호 7로 표시되는 아미노산 서열로 이루어진 중쇄 FR4를 포함할 수 있다.
또한, 상기 경쇄 가변영역은 인간 항체의 경쇄 FR을 포함하고, 상기 경쇄 FR을 암호화하는 유전자는 배선 V 유전자 IGKV3-11 또는 IGKV3-15로부터 유래될 수 있다. 구체적으로, 상기 경쇄 FR은 서열번호 8로 표시되는 아미노산 서열로 이루어진 경쇄 FR1, 서열번호 10으로 표시되는 아미노산 서열로 이루어진 경쇄 FR2, 서열번호 12로 표시되는 아미노산 서열로 이루어진 경쇄 FR3, 서열번호 14로 표시되는 아미노산 서열로 이루어진 경쇄 FR4를 포함할 수 있다.
또한, 상기 경쇄 FR4는 링커와의 결합을 위해 C-말단에 서열번호 19로 표시되는 아미노산 서열로 이루어지는 모이어티를 포함할 수 있다.
본 발명의 일 양태에서, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 15로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 가변영역 및 서열번호 16으로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄 가변영역을 포함한다.
보다 구체적으로, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 15로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 85% 이상, 90% 이상, 95% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 가변영역 및 서열번호 16으로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 85% 이상, 90% 이상, 95% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄 가변영역을 포함하고, CLDN18.2에 특이적으로 결합한다.
보다 더 구체적으로, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 15로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 81% 이상, 82% 이상, 83% 이상, 84% 이상, 85% 이상, 86% 이상, 87% 이상, 88% 이상, 89% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 99.5% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 가변영역 및 서열번호 16으로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 81% 이상, 82% 이상, 83% 이상, 84% 이상, 85% 이상, 86% 이상, 87% 이상, 88% 이상, 89% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 99.5% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄 가변영역을 포함하고, CLDN18.2에 특이적으로 결합한다.
본 발명의 일 양태에서, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 17로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 및 서열번호 18로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄를 포함한다.
보다 구체적으로, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 17로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 85% 이상, 90% 이상, 95% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 및 서열번호 18로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 85% 이상, 90% 이상, 95% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄를 포함하고, CLDN18.2에 특이적으로 결합한다.
보다 더 구체적으로, 상기 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 17로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 81% 이상, 82% 이상, 83% 이상, 84% 이상, 85% 이상, 86% 이상, 87% 이상, 88% 이상, 89% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 99.5% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 및 서열번호 18로 표시되는 아미노산 서열; 또는 이에 대해 적어도 80% 이상, 81% 이상, 82% 이상, 83% 이상, 84% 이상, 85% 이상, 86% 이상, 87% 이상, 88% 이상, 89% 이상, 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 99.5% 이상의 상동성을 갖는 아미노산 서열로 이루어진 경쇄를 포함하고, CLDN18.2에 특이적으로 결합한다.
일 구현예에서 상기 서열번호 17로 표시되는 아미노산 서열에 대해 적어도 80% 이상의 상동성을 갖는 아미노산 서열로 이루어진 중쇄는 L237A, L238A 돌연변이를 포함한다.
본 발명의 일 양태에서, 상기 항체 또는 이의 항원 결합 단편은 단일클론 항체(monoclonal antibody), 도메인 항체(domain antibody; dAb), 단일 사슬 항체(single chain antibody; scAb), Fab 단편, Fab'단편, F(ab')2 단편, scFab 단편, Fv 단편, dsFv 단편, 단일 사슬 가변 항체(single chain variable fragment; scFv), scFv-Fc 단편, 단일 도메인 중쇄 항체(single domain heavy chain antibody), 단일 도메인 경쇄 항체(single domain light chain antibody), 항체 변이체(variant antibody), 다중 결합 항체(multimeric antibody), 미니바디, 다이아바디, 이중 특이적 항체(bispecific antibody) 및 다중 특이적 항체로 이루어진 군으로부터 선택되는 어느 하나일 수 있다.
본 명세서에서 "링커"는 세포독성 화합물을 리간드에 공유결합시키는 화합물을 말한다.
본 발명에 기재된 링커는 절단성, 비절단성, 친수성 또는 소수성 일 수 있다.
절단성 링커는 세포 내 조건들 하에서 절단 가능하여 상기 링커의 절단으로 세포 내 환경에서 항체 구조물-활성제 접합체로부터 활성제를 방출한다.
절단성 링커는 세포 내 환경(예를 들어, 리소좀 또는 엔도좀 또는 카베올레아 (caveolea) 내)에 존재하는 절단제에 의해 절단 가능하다. 절단성 링커는, 예컨대, 리소좀의 또는 엔도좀의 프로테아제를 포함하는 이에 제한되지 않는 세포 내 펩티다아제 또는 프로테아제 효소에 의해 절단되는 펩티딜 링커(peptidyl linker)일 수 있다. 일반적으로, 상기 펩티딜 링커는 적어도 2개의 아미노산 길이 또는 적어도 3개의 아미노산 길이이다. 절단제들은 카텝신 B 및 D 및 플라스민을 포함할 수 있으며, 이들 모두는 디펩타이드 약물 유도체들 가수분해하여 표적 세포들 내에서 활성 약물을 방출하는 것으로 알려져 있다(예를 들어, Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123 참조). 항원 발현 세포들 내에 존재하는 효소들에 의해 절단 가능한 펩티딜 링커들이 가장 일반적이다. 예를 들어, 암 조직에서 고도로 발현되는 티올-의존성 프로테아제 카텝신-B에 의해 절단 가능한 펩티딜 링커가 사용될 수 있다(예를 들어, Phe-Leu 또는 Gly-Phe-Leu-Gly 링커). 다른 이러한 링커들은, 예를 들어, 미국 특허 번호 6,214,345에서 설명된다. 또한, 세포 내 프로테아제에 의해 절단 가능한 상기 펩티딜 링커는 예를 들어, Val-Cit 링커, Phe-Lys 링커(예를 들어, Val-Cit 링커를 이용한 독소루비신의 합성을 설명하는 미국 등록 특허 제6,214,345호 참조) 또는 Val-Ala 링커일 수 있다. Val-Cit 링커 또는 Val-Ala 링커는 펜타플루오로페닐 그룹을 함유할 수 있고, 숙신이미드 그룹 또는 말레이미드 그룹을 함유할 수 있다. 또는, PABA 그룹 및 펜타플루오로페닐 그룹을 함유할 수 있고, 4-아미노벤조산(4-Aminobenzoic acid, PABA) 그룹 및 말레이미드 그룹을 함유할 수 있으며, PABA 그룹 및 숙신이미드 그룹을 함유할 수 있다.
본 발명의 명세서에서 사용된 용어 "세포 내 절단된(intracellularly cleaved)" 및 "세포 내 절단(intracellular cleavage)"은 항체 구조물-활성제 접합체에 대한 세포 내부의 대사 과정 또는 반응을 지칭하며, 이로써 활성제 (B) 및 항체 구조물 (Ab) 사이의 공유 부착, 예를 들어, 링커가 파괴되어 유리 약물 또는 세포 내 항체로부터 분리된 접합체의 다른 대사 산물이 야기된다.
또한, 절단성 링커는 pH-민감, 즉, 특정 pH 값에서 쉽게 가수분해 될 수 있다. 일반적으로, 상기 pH-민감성 링커는 산성 조건들에서 가수분해될 수 있다. 예를 들어, 리소좀에서 가수분해될 수 있는 산-불안정성 링커(예를 들어, 하이드라존(hydrazone), 세미카르바존(semicarbazone), 티오세미카르바존 (thiosemicarbazone), 시스-아코니틱 아미드(cis-aconitic amide), 오쏘에스테르(orthoester), 아세탈, 케탈 등)가 사용될 수 있다 (예를 들어, 미국 등록 특허 제5,122,368호; 제5,824,805호; 제5,622,929호; Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123; Neville et al., 1989, Biol. Chem. 264:14653-14661 참조). 이러한 링커들은 혈액과 같은 중성 pH 조건들에서 비교적 안정적이지만 리소좀의 대략적인 pH인 pH 5.5 또는 5.0 미만에서는 불안정하다. 가수분해성 링커의 예로는 티오에테르 링커(예를 들어, 아실하이드라존 결합을 통해 치료제에 부착된 티오에테르와 같은(예를 들어, 미국 등록 특허 제5,622,929호 참조)를 들 수 있다.
또한, 링커는 환원 조건들 하에서 절단 가능하다(예를 들어, 디설파이드 링커). 예를 들어, SATA (N-숙신이미딜-5-아세틸티오아세테이트), SPDP (N-숙신이미딜-3-(2-피리딜디티오)프로피오네이트), SPDB (N-숙신이미딜-3-(2-피리딜디티오)부티레이트) 및 SMPT (N-숙신이미딜-옥시카보닐-알파-메틸-알파-(2-피리딜-티오)톨루엔)-, SPDB 및 SMPT를 사용하여 형성될 수 있는 것들을 포함하는 다양한 디설파이드 링커들이 공지되어 있다 (예를 들어, Thorpe et al., 1987, Cancer Res. 47:5924-5931; 미국 등록 특허 제4,880,935호 참조).
또한, 링커는 말로네이트 링커(Johnson et al., 1995, Anticancer Res. 15:1387-93), 말레이미도벤조일 링커(Lau et al., 1995, Bioorg-Med-Chem. 3(10):1299-1304), 3'-N-아미드 유사체(Lau et al., 1995, Bioorg-Med-Chem. 3(10):1305-12), 베타-글루쿠로나이드(β-Glucuronide) 링커(Jeffery et al., 2006, Bioconjug Chem. 17(3):832-40), 또는 베타-갈락토시다아제(β-galactosidase) 링커(Kolodych et al., 2017, Eur J Med Chem. Dec 15;142:376-382)일 수 있다.
비절단성 링커는 말레이미도카프로일 링커일 수 있다. 말레이미도카프로일 링커는 N-말레이미도메틸사이클로헥산-1-카복실레이트를 포함할 수 있다. 말레이미도카프로일 링커는 숙신이미드 그룹을 함유할 수 있다. 말레이미도카프로일 링커는 펜타플루오로페닐 그룹을 함유할 수 있다. 링커는 말레이미드 그룹과 하나 이상의 폴리에틸렌 글리콜 분자의 조합일 수 있다. 링커는 말레이미도카프로일 그룹과 하나 이상의 폴리에틸렌 글리콜 분자의 조합일 수 있다. 링커는 말레이미드-PEG4 링커일 수 있다. 링커는 숙신이미드 그룹을 함유하는 말레이미도카프로일 링커 및 하나 이상의 폴리에틸렌 글리콜 분자의 조합일 수 있다. 링커는 펜타플루오로페닐 그룹 및 하나 이상의 폴리에틸렌 글리콜 분자를 함유하는 말레이미도카프로일 링커의 조합일 수 있다. 링커는 폴리에틸렌 글리콜 분자에 연결된 말레이미드를 함유할 수 있으며, 여기서 폴리에틸렌 글리콜은 더 많은 링커 가요성을 허용하거나 링커를 길게 사용할 수 있다. 링커는 (말레이미도카프로일)-(발린-시트룰린)-(파라-아미노벤질옥시카보닐) 링커일 수 있다.
본 발명의 일 양태에서, 링커는 절단성 링커일 수 있다.
본 발명의 일 양태에서, 링커는 프로테아제 절단성 링커, 산-절단성 링커, 디설파이드 링커, 자기-희생기 링커(self-immolative linker) 또는 자기-안정화 링커(self-stabilizing linker), 말로네이트 링커, 말레이미도벤조일 링커, 3'-N-아미드 유사체, 베타-글루쿠로나이드(β-Glucuronide) 링커, 또는 베타-갈락토사이드(β-galactoside) 링커일 수 있다.
본 발명의 일 양태에서, 상기 프로테아제 절단성 링커는 티올반응성 스페이서(thiol-reactive spacer) 또는 디펩타이드를 포함할 수 있고, 보다 구체적으로, 상기 프로테아제 절단성 링커는 티올반응성 말레이미도카프로일 스페이서, 발린-시트룰린 디펩타이드 또는 p-아미노-벤질옥시카보닐 스페이서를 포함할 수 있다.
본 발명의 일 양태에서, 상기 산 절단성 링커는 하이드라진(hydrazine) 링커 또는 제4급 암모늄 링커일 수 있다.
본 발명의 일 양태에서, 상기 링커는 일반식 Ⅱ의 구조를 갖는 것일 수 있다.
[일반식 Ⅱ]
Figure PCTKR2022004552-appb-img-000001
상기 식에서,
물결표시는 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편과 연결되는 부위, * 표시는 활성제와 연결되는 부위를 나타내며;
G는 글루쿠론산(glucuronic acid) moiety 또는
Figure PCTKR2022004552-appb-img-000002
이고,
상기 R3은 수소 또는 카르복실 보호기이며, 상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이고;
R1 및 R2는 각각 독립적으로 수소, C1-8 알킬 또는 C3-8 사이클로알킬이며;
W는 -C(O)-, -C(O)NR'-, -C(O)O-, -SO2NR'-, -P(O)R''NR'-, -SONR'- 또는 -PO2NR'-이고, 상기 C, S 또는 P는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 R' 및 R''는 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이- C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴인 화합물이고;
Z는 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 나이트로이며;
n은 0 내지 3의 정수이고;
L은, 하기 A) 또는 B) 중 어느 하나이다:
A) C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이며, 하기 중 하나 이상을 만족한다:
(i) L은 하나 이상의 불포화 결합을 포함하고;
(ii) L 내의 2 개의 원자가 치환체와 같은 2가 치환체로 치환되고, 이는 헤테로아릴렌(heteroarylene)을 완성시키며;
(iii) L은 1 내지 50 원자 헤테로알킬렌이고;
(iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 치환되고;
B) 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 하기 일반식 Ⅲ의 이소프레닐 유도체 유닛을 적어도 하나 이상 포함한다:
[일반식 Ⅲ]
Figure PCTKR2022004552-appb-img-000003
본 발명의 일 양태에서, 상기 접합체는 하기 일반식 IIa의 구조를 갖는 것일 수 있다.
[일반식 IIa]
Figure PCTKR2022004552-appb-img-000004
상기 식에서,
Ab는 중쇄 가변영역 및 경쇄 가변영역을 포함하는 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
B‘는 각각 독립적으로 동일하거나 상이한 활성제이며,
G는 각각 독립적으로 글루쿠론산 모이어티(glucuronic acid moiety) 또는
Figure PCTKR2022004552-appb-img-000005
이고;
상기 R3은 수소 또는 카복실 보호기이며, 상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이고;
R1 및 R2은 각각 독립적으로 수소, C1-8 알킬 또는 C3-8 사이클로알킬이며;
W은 각각 독립적으로 -C(O)-, -C(O)NR'-, -C(O)O-, -SO2NR'-, -P(O)R''NR'-, -SONR'- 또는 -PO2NR'-이고, 상기 C, S 또는 P는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 NR'은 L에 결합하고, 상기 R' 및 R''는 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이-C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이며;.
Z는 각각 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 나이트로이고;
n은 0 내지 3의 정수이며, n이 2 이상의 정수인 경우 각각의 Z는 서로 동일하거나 상이할 수 있고;
L은 각각 독립적으로, 하기 A) 또는 B) 중 어느 하나이고:
A) C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이며, 하기 중 하나 이상을 만족한다:
(i) L은 하나 이상의 불포화 결합을 포함하고;
(ii) L 내의 2개의 원자가 치환체와 같은 2가 치환체로 치환되고; 이는 헤테로아릴렌(heteroarylene)을 완성시키며;
(iii) L은 1 내지 50 원자 헤테로알킬렌이고;
(iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 더 치환된다;
B) 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 하기 일반식 Ⅲ의 이소프레닐 유도체 유닛을 하나 이상 포함한다:
[일반식 Ⅲ]
Figure PCTKR2022004552-appb-img-000006
;
m은 1 내지 20 중에서 선택되는 정수이다.
또한, 본 발명은 하기 일반식 IIa로 표시되는 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물에 관한 것이다.
[일반식 IIa]
Figure PCTKR2022004552-appb-img-000007
상기 식에서,
Ab는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
G는 각각 독립적으로 글루쿠론산 모이어티(glucuronic acid moiety) 또는
Figure PCTKR2022004552-appb-img-000008
이고;
상기 R3은 수소 또는 카복실 보호기이며, 상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이고;
R1 및 R2은 각각 독립적으로 수소, C1-8 알킬 또는 C3-8 사이클로알킬이며;
W은 각각 독립적으로 -C(O)-, -C(O)NR'-, -C(O)O-, -SO2NR'-, -P(O)R''NR'-, -SONR'- 또는 -PO2NR'-이고, 상기 C, S 또는 P는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 NR'은 L에 결합하고, 상기 R' 및 R''는 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이-C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이며;.
Z는 각각 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 나이트로이고;
n은 0 내지 3의 정수이며;
L은 각각 독립적으로, 하기 A) 또는 B) 중 어느 하나이고:
A) C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이며, 하기 중 하나 이상을 만족한다:
(i) L은 하나 이상의 불포화 결합을 포함하고;
(ii) L 내의 2개의 원자가 치환체와 같은 2가 치환체로 치환되고; 이는 헤테로아릴렌(heteroarylene)을 완성시키며;
(iii) L은 1 내지 50 원자 헤테로알킬렌이고;
(iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 치환된다;
B) 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 하기 일반식 Ⅲ의 이소프레닐 유도체 유닛을 하나 이상 포함한다:
[일반식 Ⅲ]
Figure PCTKR2022004552-appb-img-000009
;
B’는 활성제이고,
Ab는 물결표시된 부분에 결합되고;
l 및 m은 각각 독립적으로 1 내지 20 중에서 선택되는 정수이고,
l이 2 이상인 경우, 활성제는 각각 동일하거나 상이할 수 있다.
본 발명의 일 양태에서, 상기 G는 글루쿠론산 모이어티(glucuronic acid moiety) 또는 하기 화학식 (IIIa) 구조의 화합물이다:
[화학식 (IIIa)]
Figure PCTKR2022004552-appb-img-000010
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이다.
본 발명의 일 양태에서, 상기 G는 각각 독립적으로
Figure PCTKR2022004552-appb-img-000011
이고,
R3은 수소 또는 카복실 보호기이며,
상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이다.
본 발명의 일 양태에서, 상기 R3는 수소이고, 각 R4는 수소이다.
본 발명의 일 양태에서, 상기 R1 및 R2는 각각 수소이다.
또한, 상기 Z는 각각 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 니트로이다.
또한, 상기 W는 -C(O)-, -C(O)NR'- 또는 -C(O)O-이고, 보다 구체적으로 상기 W는 -C(O)NR'-이며, 여기에서 C(O)가 페닐링과 연결되고, NR'은 L에 결합된다. 여기에서, 상기 R'은 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이- C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이다.
또한, 상기 n은 0, 1, 2 또는 3이고, 보다 구체적으로 0, 1 또는 2이며, 보다 더 구체적으로 0이다.
보다 구체적으로, 상기 G는 하기 화학식 (IIIa) 구조의 화합물이고:
[화학식 (IIIa)]
Figure PCTKR2022004552-appb-img-000012
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이며,
W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐링과 연결되며 NR'은 L에 결합하며, 각 Z는 C1-8 알킬, 할로겐, 시아노 또는 니트로이며, n은 0이고, m은 1이며, R1 및 R2는 각각 수소이다.
본 발명의 일 양태에서, 최소 하나의 L은 1 내지 100개의 탄소 원자를 갖는 알킬렌이고, 여기에서 알킬렌의 탄소 원자는, N, O 및 S로 이루어진 그룹으로부터 선택되는 하나 또는 그 이상의 헤테로원자로 치환될 수 있으며, 알킬렌은 1 내지 20개의 탄소원자를 갖는 하나 이상의 알킬로 더 치환될 수 있다.
구체적으로, 최소 하나의 L은 C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이고, 하기 중 하나 이상을 만족할 수 있다:
(i) 하나 이상의 불포화 결합을 포함하고;
(ii) L 내의 2 개의 원자가 치환체와 같은 2가 치환체로 치환되고; 이는 헤테로아릴렌(heteroarylene)을 완성시키며
(iii) L은 1 내지 50 원자 헤테로알킬렌이고;
(iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 치환된다.
또한, 상기 최소 하나의 L은 질소 함유 1-50 원자 헤테로알킬렌이고, 링커는 친수성 아미노산의 2 이상의 원자를 포함하며, 상기 질소는 친수성 아미노산의 카르보닐과 펩타이드 결합을 형성할 수 있다.
본 발명의 일 양태에서, L은 C2-50 알킬렌, C2-50 헤테로알킬렌, 친수성 아미노산, -C(O)-, -C(O)NR''-, -C(O)O-, -(CH2)s-NHC(O)-(CH2)t-, -(CH2)u-C(O)NH-(CH2)v-, -(CH2)s-NHC(O)-(CH2)t-C(O)-, -(CH2)u-C(O)NH-(CH2)v-C(O)-, -S(O)2NR''-, -P(O)R'''NR''-, -S(O)NR''-, 또는 -PO2NR''- 이고,
여기에서, R'' 및 R'''는 각각 독립적으로 수소, C1-8알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 디-C1-8 알킬아미노, C3-20 헤테로아릴 또는 C5-20 아릴이며, s, t, u 및 v는 각각 독립적으로 0 내지 10의 정수이다.
본 발명의 일 양태에서, 상기 L은 질소 함유 1-5 원자 헤테로 알킬렌이고, 상기 링커는 친수성 아미노산의 2 이상의 원자를 포함하며, 상기 질소는 친수성 아미노산의 카르보닐과 펩타이드 결합을 형성한다.
본 발명의 일 양태에서, 상기 L은 티오에테르 결합에 의해 항체와 공유결합하고, 상기 티오에테르 결합은 항체의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 최소 하나의 L은 친수성 아미노산(hydrophilic amino acid)이다.
본 발명의 일 양태에서, 친수성 아미노산은 아르기닌, 아스파테이트, 아스파라긴, 글루타메이트, 글루타민, 히스티딘, 리신, 오르니틴, 프롤린, 세린, 또는 트레오닌일 수 있다.
본 발명의 일 양태에서, 친수성 아미노산은 수용액에서 중성 pH에서 전하를 갖는 잔기를 갖는 측쇄를 포함하는 아미노산일 수 있다.
본 발명의 일 양태에서, 친수성 아미노산은 아스파테이트 또는 글루타메이트이다.
본 발명의 일 양태에서, 친수성 아미노산은 오르니틴 또는 리신이다.
본 발명의 일 양태에서, 친수성 아미노산은 아르기닌이다.
본 발명의 일 양태에서, 최소 하나의 L은 -C(O)-, -C(O)NR''-, -C(O)O-, -S(O)2NR''-, -P(O)R'''NR''-, -S(O)NR''-, 또는 -PO2NR''-이고, R'' 및 R'''은 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 디-C1-8 알킬아미노, C3-20 헤테로아릴, 또는 C6-20 아릴이다.
본 발명의 일 양태에서, 최소 하나의 L은 -C(O)NR''-, -(CH2)s-NHC(O)-(CH2)t-, -(CH2)u-C(O)NH-(CH2)v-, -(CH2)s-NHC(O)-(CH2)t-C(O)-, 또는 -(CH2)u-C(O)NH-(CH2)v-C(O)-이고, 여기에서, R''은 수소, C1-5 알킬, C3-8 사이클로알킬, C1-5 알콕시, C3-20 헤테로아릴, 또는 C6-20 아릴이며, s, t u 및 v는 각각 독립적으로 0 내지 10의 정수이다.
본 발명의 일 양태에서, 최소 하나의 L은 -C(O)NR''- 이고, R''은 수소이다.
본 발명의 일 양태에서, 최소 하나의 L은 -(CH2)s-NHCO-이고, s는 1 내지 5의 정수이다.
본 발명의 일 양태에서, 최소 하나의 L은 -(CH2)u-C(O)NH-(CH2)v-C(O)-이고, u는 1 내지 5의 정수이며, v는 1 내지 5의 정수이다.
본 발명의 일 양태에서, L은,
Figure PCTKR2022004552-appb-img-000013
,
Figure PCTKR2022004552-appb-img-000014
,
Figure PCTKR2022004552-appb-img-000015
또는
Figure PCTKR2022004552-appb-img-000016
을 포함하고,
여기에서 L1은 직접 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고, R11은 수소 또는 1 내지 10개의 탄소원자를 갖는 알킬이며, L2는 1 내지 30개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, 상기 L은 일반식 VIII 또는 일반식 IX로 표시되는 제2 유닛을 더 포함한다.
본 발명의 일 양태에서, 최소 하나의 제2 유닛은 일반식 VIII 또는 일반식 IX로 표시된다:
[일반식 VIII]
-(CH2)r(V(CH2)p)q-
[일반식 IX]
-(CH2CH2X)w-
상기 V는 단일결합, -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2- 또는 -SO2NR25-이고;
X는 -O-, C1-8 알킬렌 또는 -NR21-이며;
R21 내지 R25는 각각 독립적으로 수소, C1-6 알킬, C1-6 알킬 C6-20 아릴 또는 C1-6 알킬 C3-20 헤테로아릴이고;
r은 0 내지 10의 정수이며;
p는 0 내지 10의 정수이고;
q는 1 내지 20의 정수이며; 및
w는 1 내지 20의 정수이다.
본 발명의 일 양태에서, q는 4 내지 20일 수 있고, 보다 구체적으로 5 내지 20일 수 있다. 또한, q는 1 내지 10, 또는 2 내지 12일 수 있고, 보다 구체적으로 2, 4, 5, 또는 11일 수 있다. 또한, r은 1 또는 2일 수 있다. 또한, p는 1 또는 2일 수 있다. 또한, V는 -O-일 수 있다.
보다 구체적으로, r은 2이고, p는 2이며, q는 2, 4, 5 또는 11이고, V는 -O-일 수 있다.
또한, 본 발명의 일 양태에서, X는 -O-일 수 있다. 또한, w는 4 내지 20의 정수일 수 있다.
보다 구체적으로, X는 -O-이고, w는 1 내지 10, 또는 4 내지 20일 수 있다.
본 발명의 일 양태에서, 최소 하나의 제2 유닛은 최소 하나의 폴리에틸렌 글리콜 유닛이고,
Figure PCTKR2022004552-appb-img-000017
또는
Figure PCTKR2022004552-appb-img-000018
의 구조를 가지며,
여기서 n은 1 내지 12이다.
본 발명의 일 양태에서, 최소 하나의 제2 유닛은 1 내지 12 -OCH2CH2-유닛, 또는 3 내지 12 -OCH2CH2-유닛, 또는 5 내지 12 -OCH2CH2-유닛, 또는 6 내지 12 -OCH2CH2-유닛, 또는 3 -OCH2CH2-유닛이다.
본 발명의 일 양태에서, 최소 하나의 제2 유닛은 -(CH2CH2X)w-이고,
여기에서 X는 단일 결합, -O-, C1-8 알킬렌, 또는 -NR21-이고;
R21은 수소, C1-6 알킬, C1-6 알킬-C6-20아릴, 또는 C1-6알킬-C3-20 헤테로아릴이며, w는 1 내지 20의 정수이고, 구체적으로는 1, 3, 6, 또는 12이다.
본 발명의 일 양태에서 X는 -O-이고, w는 6 내지 20의 정수이다.
구체적인 본 발명의 일 양태에서, 상기 L은 옥심을 포함하고, 적어도 하나의 폴리에틸렌 글리콜 유닛은 옥심을 활성제에 공유 결합시킨다.
본 발명의 일 양태에서, 링커는 1,3-양극성고리 첨가반응(1,3-dipolar cycloaddition reactions), 헤테로-디엘스-올더 반응(hetero-Diels-Alder reactions), 친핵성 치환(nucleophilic substitution) 반응, 비-알돌형 카르보닐 반응(non-aldol type carbonyl reactions), 탄소-탄소 다중 결합 첨가(addition to carbon-carbon multiple bond), 산화 반응(osidation reactions) 또는 클릭 반응(click reactions)에 의해 형성된 제3 유닛을 포함한다.
본 발명의 일 양태에서, 제3 유닛은 알카인 및 아자이드 사이의 반응, 또는 알데하이드 또는 케톤기 및 하이드라진 또는 알콕시아민 사이의 반응에 의해 형성된다.
본 발명의 일 양태에서, 상기 L은 하기 일반식 Ⅳa, Ⅳb, Ⅳc, Ⅳd, 또는 Ⅳe로 표시되는 제3 유닛을 더 포함한다.
[일반식 Ⅳa]
Figure PCTKR2022004552-appb-img-000019
[일반식 Ⅳb]
Figure PCTKR2022004552-appb-img-000020
[일반식 Ⅳc]
Figure PCTKR2022004552-appb-img-000021
[일반식 Ⅳd]
Figure PCTKR2022004552-appb-img-000022
[일반식 Ⅳe]
Figure PCTKR2022004552-appb-img-000023
상기 식에서, L1은 단일 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고,
R11은 수소 또는 C1-10의 알킬이다.
본 발명의 일 양태에서, 제3 유닛은,
Figure PCTKR2022004552-appb-img-000024
,
Figure PCTKR2022004552-appb-img-000025
,
Figure PCTKR2022004552-appb-img-000026
또는
Figure PCTKR2022004552-appb-img-000027
을 포함하고,
여기에서,
L1은 단일 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고, 바람직하게는 10, 11, 12, 13, 14, 15 또는 16개의 탄소원자를 갖는 알킬렌이며;
R11은 수소 또는 1 내지 10개의 탄소원자를 갖는 알킬이고, 구체적으로 메틸이고,
L2는 1 내지 30개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, 상기 L1 및 L2는 각각 독립적으로 단일결합 또는 C1-30의 알킬렌이고; R11은 수소 또는 C1-10의 알킬이다.
본 발명의 일 양태에서, L1은 단일 결합, 또는 11개의 탄소원자를 갖는 알킬렌, 또는 12개의 탄소원자를 갖는 알킬렌이다.
또한, 본 발명의 일 양태에서, 제3 유닛은
Figure PCTKR2022004552-appb-img-000028
또는
Figure PCTKR2022004552-appb-img-000029
을 포함하고,
상기 V는 단일 결합 , -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2-, 또는 -SO2NR25-이며;
R21 내지 R25는 각각 독립적으로 수소, C1-6 알킬, C1-6 알킬 C6-20 아릴, 또는 C1-6 알킬 C3-20 헤테로아릴이고;
r은 1 내지 10의 정수이며;
p는 0 내지 10의 정수이고;
q는 1 내지 20의 정수이며; 및
L1은 단일결합이다.
본 발명의 일 양태에서, 상기 r은 2 또는 3일 수 있다. 또한, p는 1 또는 2일 수 있다. 또한, q는 1 내지 6일 수 있다.
보다 구체적으로, 상기 제3 유닛에서 r은 2 또는 3; p는 1 또는 2; q는 1 내지 6일 수 있다.
또한, 본 발명의 일 양태에서, 상기 제3 유닛을 포함하는 링커는
Figure PCTKR2022004552-appb-img-000030
,
Figure PCTKR2022004552-appb-img-000031
,
Figure PCTKR2022004552-appb-img-000032
또는
Figure PCTKR2022004552-appb-img-000033
일 수 있고, 여기에서 물결표시는 항체 구조물과 연결되는 부위, * 표시는 활성제와 연결되는 부위를 나타내며, n은 0 내지 20의 정수이다.
본 발명의 일 양태에서, 제3 유닛은
Figure PCTKR2022004552-appb-img-000034
또는
Figure PCTKR2022004552-appb-img-000035
을 포함한다.
또한, 본 발명의 일 양태에서, 링커는 전구체 상태에서
Figure PCTKR2022004552-appb-img-000036
를 포함한다. 또한, 상기 구조에서 알카인 및 아자이드 사이의 반응, 상세하게는 클릭 반응에 의해 제3 유닛을 형성할 수 있다.
본 발명의 일 양태에서, 링커는 전구체 상태에서
Figure PCTKR2022004552-appb-img-000037
를 포함하고, 상기 구조를 통해 제3 유닛을 형성할 수 있으며, 제3 유닛은
Figure PCTKR2022004552-appb-img-000038
를 포함한다.
본 발명의 일 양태에서, 상기 L은 옥심을 포함하는 3 내지 50 헤테로알킬렌이고,
상기 옥심의 산소 원자는 W와 연결된 L의 측면에 있으며, 옥심의 탄소 원자는 Ab에 연결된 L의 측면에 있거나; 또는
상기 옥심의 탄소 원자는 W에 연결된 L의 측면에 있으며, 옥심의 산소 원자는 Ab에 연결된 L의 측면에 있는 것이다.
본 발명의 일 양태에서, 상기 L은 옥심을 포함하고, 하나 이상의 이소프레닐 유닛은 옥심을 Ab에 공유 결합시키는 것이다.
본 발명의 일 양태에서, 링커는
Figure PCTKR2022004552-appb-img-000039
의 구조를 갖는 최소 하나 이상의 이소프레닐 유닛을 추가로 함유할 수 있으며, 여기에서 n은 최소 2 이상이다.
본 발명의 일 양태에서, 최소 하나의 이소프레닐 유닛은 이소프레노이드 트랜스퍼라제의 기질 또는 이소프레노이드 트랜스퍼라제의 생성물이다.
본 발명의 일 양태에서, 링커의 이소프레닐 유닛은 티오에테르 결합에 의해 항체와 공유결합하며, 티오에테르 결합은 항체 구조물의 시스테인의 황원자를 포함한다.
또한, 이소프레닐 유닛은 링커에 포함된 옥심을 항체 구조물에 공유 결합시킬 수 있다.
본 발명의 일 양태에서, 항체 구조물은 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 항체 구조물은 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CXX, CXC, XCXC, XXCC, 및 CYYX로 이루어진 그룹으로부터 선택되는 서열이고, 여기에서 C는 시스테인을 나타내며; Y는 각 경우 독립적으로 지방족 아미노산을 나타내고; X는 각 경우 독립적으로 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌, 또는 루신을 나타내고; 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CYYX 서열이고, Y는 각 경우 독립적으로 알라닌, 이소루신, 루신, 메티오닌 또는 발린이다.
본 발명의 일 양태에서, 아미노산 모티프는 CVIM 또는 CVLL 서열이다.
본 발명의 일 양태에서, 상기 아미노산 모티프에 선행하는 1 내지 20 개의 아미노산 중 적어도 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택될 수 있다.
본 발명의 일 양태에서, 상기 아미노산 모티프에 선행하는 1 내지 20 개의 아미노산 중 적어도 하나가 글리신이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 10개의 아미노산 중 하나 이상이 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택될 수 있다. 예컨대, 본 발명의 일 양태에서, 아미노산 모티프에 선행하는 7개의 아미노산 중 적어도 하나는 글리신이다. 또는, 아미노산 모티프에 선행하는 7개의 아미노산 중 3개 이상이 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택된다. 또는, 아미노산 모티프에 선행하는 1 내지 10개의 아미노산이 글리신, 구체적으로는 아미노산 모티프에 선행하는 최소 1, 2, 3, 4, 5, 6, 7, 8, 9 또는 10개의 아미노산은 글리신이다.
본 발명의 일 양태에서, 항체는 GGGGGGGCVIM의 아미노산 서열을 포함할 수 있다.
본 발명의 일 양태에서, 상기 L이 C-말단에 아미노산 서열 GGGGGGGCVIM을 포함하는 것일 수 있다.
본 발명의 또 다른 일 양태에서, Linker는,
(a) 하나 이상의 L; (b) 하나 이상의 제2 유닛; (c) 하나 이상의 제3 유닛; 및 (d) 하나 이상의 제4 유닛을 함유하는 것일 수 있다.
여기에서 제2 유닛은 L과 제3 유닛, L과 제4 유닛 또는 제3 유닛과 제4 유닛을 연결하고,
여기에서 하나 이상의 제4 유닛은 하나 이상의 약물 또는 톡신을 방출할 수 있으며,
여기에서 L은 제2 유닛과 제4 유닛, 제2 유닛과 제3 유닛 또는 제2 유닛을 또 다른 제2 유닛과 연결하는 것이다.
본 발명의 일 양태에서, 제4 유닛은 다음 화학식 (IIb)의 구조를 갖는다:
[화학식 (IIb)]
Figure PCTKR2022004552-appb-img-000040
상기 식에서,
G는 당(sugar), 당산(sugar acid), 또는 당 유도체(sugar derivatives)이고,
W는 -C(O)-, -C(O)NR'-, -C(O)O-, -S(O)2NR'-, -P(O)R''NR'-, -S(O)NR'-, 또는 -PO2NR'-이고,
C(O), S, 또는 P가 페닐환과 바로 연결되는 경우, R' 및 R''은 각각 독립적으로 수소, (C1-8)알킬, (C3-8)사이클로알킬, (C1-8)알콕시, (C1-8)알킬티오, 모노- 또는 디-(C1-8)알킬아미노, (C3-20)헤테로아릴, 또는 (C6-20)아릴이며, W는 L 또는 제2 유닛과 연결되고,
각 Z는 각각 독립적으로 수소, (C1-8)알킬, 할로겐, 시아노 또는 나이트로이고,
n은 1 내지 3의 정수이며,
m은 0 또는 1이고,
R1 및 R2는 각각 독립적으로 수소, (C1-8)알킬 또는 (C3-8)사이클로알킬이거나, 또는 R1 및 R2는 이들이 부착된 탄소 원자와 함께 (C3-8)사이클로알킬 환을 형성한다.
본 발명의 일 양태에서, 상기 당 또는 당산은 모노사카라이드이다.
본 발명의 일 양태에서, G는 하기 화학식 (IIIa) 구조의 화합물이다:
[화학식 (IIIa)]
Figure PCTKR2022004552-appb-img-000041
여기에서,
R3는 수소 또는 카르복실 보호기이고,
각 R4는 각각 독립적으로 수소 또는 하이드록실 보호기이다.
본 발명의 일 양태에서, R3는 수소이고, 각 R4는 수소이다.
본 발명의 일 양태에서, W는 -C(O)NR'-이고, 여기에서 C(O)가 페닐환과 연결되며, NR'은 L 또는 제2 유닛과 연결된다.
본 발명의 일 양태에서, Z는 수소이다.
본 발명의 일 양태에서, R1 및 R2는 각각 수소이다.
본 발명의 일 양태에서, 제2 유닛은 -(CH2)r(V(CH2)p)q-, -((CH2)pV)q-, -(CH2)r(V(CH2)p)qY-, -((CH2)pV)q(CH2)r-, -Y((CH2)pV)q- 또는 -(CH2)r(V(CH2)p)qYCH2-로 나타내지며,
여기에서,
r은 0 내지 10의 정수이고;
p는 1 내지 10의 정수이며;
q는 1 내지 20의 정수이고,
V 및 Y는 각각 독립적으로 단일결합, -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2-, 또는 -SO2NR25-이고,
R21 내지 R25는 각각 독립적으로 수소, (C1-6)알킬, (C1-6)알킬(C6-20)아릴 또는 (C1-6)알킬(C3-20)헤테로아릴이다.
본 발명의 일 양태에서, r은 2이다.
본 발명의 일 양태에서, p는 2이다.
본 발명의 일 양태에서, q는 6 내지 20의 정수이다.
본 발명의 일 양태에서, q는 2, 5, 또는 11이다.
본 발명의 일 양태에서, V 및 Y는 각각 독립적으로 -O-이다.
본 발명의 일 양태에서, L 또는 제3 유닛은,
Figure PCTKR2022004552-appb-img-000042
,
Figure PCTKR2022004552-appb-img-000043
,
Figure PCTKR2022004552-appb-img-000044
또는
Figure PCTKR2022004552-appb-img-000045
을 포함하고,
여기에서 L1은 직접 결합 또는 1 내지 30개의 탄소원자를 갖는 알킬렌이고, R11은 수소 또는 1 내지 10개의 탄소원자를 갖는 알킬이며, 구체적으로 메틸이고, L2는 1 내지 30개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, L1은 12개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, R11은 메틸이다.
본 발명의 일 양태에서, L2는 11개의 탄소원자를 갖는 알킬렌이다.
본 발명의 일 양태에서, 바인딩 유닛은 티오에테르 결합에 의해 항체와 공유결합하며, 티오에테르 결합은 항체의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 항체는 이소프레노이드 트랜스퍼라제에 의해 인식되는 아미노산 모티프를 포함하고, 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CXX, CXC, XCXC, XXCC, 및 CYYX로 이루어진 그룹으로부터 선택되는 서열이고, 여기에서 C는 시스테인을 나타내며; Y는 각 경우 독립적으로 지방족 아미노산을 나타내고; X는 각 경우 독립적으로 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌, 또는 루신을 나타내고; 티오에테르 결합은 아미노산 모티프의 시스테인의 황원자를 포함한다.
본 발명의 일 양태에서, 아미노산 모티프는 CYYX 서열이고, Y는 각 경우 독립적으로 알라닌, 이소루신, 루신, 메티오닌 또는 발린이다.
본 발명의 일 양태에서, 아미노산 모티프는 CVIM 또는 CVLL 서열이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 20개의 아미노산 중 적어도 하나는 글리신이다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 20개의 아미노산 중 1개 이상이 글리신, 아르기닌, 아스파르트산 및 세린으로부터 각각 독립적으로 선택될 수 있다.
본 발명의 일 양태에서, 아미노산 모티프에 선행하는 1 내지 20개의 아미노산이 글리신, 구체적으로는 아미노산 모티프에 선행하는 최소 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 또는 20개의 아미노산은 글리신이다.
본 발명의 일 양태에서, 항체는 GGGGGGGCVIM의 아미노산 서열을 포함할 수 있다.
본 발명의 일 양태에서, 상기 이소프레노이드 트랜스퍼라제는 파네실 단백질 트랜스퍼라아제(FTase) 또는 게라닐게라닐 트랜스퍼라제(GGTase)이다.
본 발명의 일 양태에서, L은 Ab에 공유 결합된 하나 이상의 분지형 링커를 포함하고,
i) 각각의 분지형 링커는 제1 링커(PL)에 의해 Ab에 공유 결합된 제5 유닛을 포함하고;
ii) 각각의 분지형 링커는 제1 활성제가 제2 링커 (SL) 및 절단 그룹(CG)에 의해 제5 유닛에 공유 결합된 제1 분지(B1)를 포함하며; 및
iii) 각각의 분지형 링커는 a) 제2 활성제가 제2 링커 (SL) 및 절단 그룹(CG)에 의해 제5 유닛에 공유 결합된 제2 분지 (B2); 또는 b) 폴리에틸렌 글리콜 모이어티가 제5 유닛에 공유 결합된 있는 제2 분지(B2)를 더 포함하고,
상기 각각의 절단 그룹은 항체 구조물-활성제 접합체부터 활성제를 방출하기 위해 가수분해되는 것일 수 있다.
본 발명의 일 양태에서, i) 분지된 링커는 제1 링커(PL)에 의해 반응성 모이어티에 공유 결합된 제5 유닛(BR)을 포함하고;
ii) 제5 유닛은 제1 분지(B1)에 공유 결합되고, 제2 링커(SL) 및 절단 그룹(CG)에 공유 결합된 제1 활성제를 포함하며;
iii) 제5 유닛은 제2 분지(B2)와 공유 결합되고, a) 제2 링커(SL) 및 절단 그룹(CG)과 공유 결합된 제2 활성제 또는 b) 폴리에틸렌 글리콜 모이어티를 포함하며, 여기에서 각 절단 그룹은 가수분해되어 활성제를 방출시킬 수 있다.
본 발명의 일 양태에서, 상기 절단 그룹은 상기 화학식 II와 같다.
본 발명에서, 제2링커(예를 들어, 활성제를 제5 유닛과 연결하는 것)은 1,3-쌍극 부가환화 반응(1,3-dipolar cycloaddition reaction), 헤테로-디엘스-엘더 반응(hetero-Diels-Alder reaction), 친핵성 치환 반응(nucleophilic substitution reaction), 비-알돌형 카보닐 반응(non-aldol type carbonyl reaction), 탄소-탄소 다중 결합에의 첨가(addition to a carbon-carbon multiple bond), 산화 반응(oxidation reaction) 또는 클릭 반응(click reaction)에 의하여 형성된 제3 유닛을 포함할 수 있다. 여기에서, 제3 유닛은 상기와 같이 알카인과 아자이드와의 반응, 또는 비-알돌형 카보닐 반응, 예컨대 알데하이드 또는 케톤 그룹과 하이드라진 또는 하이드록실아민과의 반응으로 형성될 수 있으며, 이는 활성제 및/또는 절단 그룹과 L을 마일드 커플링(mild coupling)하도록 해준다.
본 발명의 일 양태에서, 상기 제5 유닛은
Figure PCTKR2022004552-appb-img-000046
,
Figure PCTKR2022004552-appb-img-000047
,
Figure PCTKR2022004552-appb-img-000048
,
Figure PCTKR2022004552-appb-img-000049
,
Figure PCTKR2022004552-appb-img-000050
또는
Figure PCTKR2022004552-appb-img-000051
이고,
상기 L2, L3, L4 는 각각 독립적으로 직접 결합 또는 -CnH2n-이며, 상기 n은 1 내지 30의 정수이고,
상기 G1, G2, G3은 독립적으로 직접 결합,
Figure PCTKR2022004552-appb-img-000052
,
Figure PCTKR2022004552-appb-img-000053
,
Figure PCTKR2022004552-appb-img-000054
또는
Figure PCTKR2022004552-appb-img-000055
이며,
상기 R30은 수소 또는 C1-30 알킬이고,
상기 R40은 수소, C1-10 알킬 또는 -L5-COOR50이며, 여기에서 L5는 직접 결합 또는 -CnH2n-이고,
여기에서 n은 1 내지 10의 정수이고, R50은 수소 또는 C1-30 알킬이다.
본 발명의 일 양태에서, 상기 제5 유닛은
Figure PCTKR2022004552-appb-img-000056
,
Figure PCTKR2022004552-appb-img-000057
,
Figure PCTKR2022004552-appb-img-000058
또는
Figure PCTKR2022004552-appb-img-000059
이고,
상기 L2, L3, L4 ,G1, G2, G3, R30, R40, 및 L5는 상기와 동일할 수 있다.
본 발명의 일 양태에서, 상기 절단 그룹은 표적 세포 내에서 절단가능하다.
본 발명의 일 양태에서, 상기 절단 그룹은 하나 이상의 활성제를 방출시킬 수 있다.
또한, 본 발명의 일 양태에서, 상기 접합체는 Ab를 포함하고;
Ab에 공유 결합 된 1, 2, 3 또는 4개 이상의 분지형 링커를 포함하며;
각 분지형 링커가 1 또는 2개 이상의 활성제와 결합하고;
여기에서 활성제는 각각 동일하거나, 상이한 것이다.
또한, 본 발명의 일 양태에서, 상기 각각의 활성제는 절단 가능한 결합에 의해 분지형 링커에 결합된다.
본 발명의 일 양태에서, 상기 L은 적어도 하나의 제5 유닛 및 제1 링커(PL)을 포함하는 링커이다.
본 발명의 일 양태에서, 항체-약물 접합체의 제1 링커는 1 내지 100개, 바람직하게는 1 내지 50개의 탄소원자를 갖는 알킬렌을 포함하고, 또는:
알킬렌은 적어도 하나의 불포화 결합을 포함하고;
알킬렌은 적어도 하나의 헤테로아릴렌을 포함하며;
알킬렌의 탄소원자는 질소(N), 산소(O), 및 황(S)으로부터 선택되는 하나 이상의 헤테로원자에 의해 대체되고; 또는
알킬렌은 1 내지 20개의 탄소원자를 갖는 하나 이상의 알킬로 더욱 치환된다.
또한, 본 발명의 일 양태에서, 상기 각각의 분지형 링커는 제5 유닛을 포함하고, 각각의 활성제는 2차 링커를 통해 제5 유닛에 결합하고, 상기 제5 유닛은 1차 링커에 의해 항체에 결합된다.
본 발명의 일 양태에서, 상기 제5 유닛은 아미드이고, 1차 링커는 아미드의 카르보닐을 포함한다.
본 발명의 일 양태에서, 상기 제5 유닛은 리신 유닛이다.
구체적인 본 발명의 일 양태에서, 알킬렌의 적어도 하나의 탄소원자는 질소로 대체되고, 제1 링커는 친수성 아미노산의 적어도 두 개의 원자를 포함하며, 그리고 질소는 친수성 아미노산의 주쇄 카보닐과 함께 펩타이드 결합을 형성한다. 친수성 아미노산은, 예를 들면, 아르기닌, 아스파테이트, 아스파라긴, 글루타메이트, 글루타민, 히스티딘, 리신, 오르니틴, 프롤린, 세린 또는 트레오닌일 수 있다.
본 발명의 일 양태에서, 항체-활성제의 분지형 링커는 수용액 중의 중성 pH에서 전하를 갖는 모이어티를 갖는 측쇄를 갖는 아미노산, 바람직하게는 아르기닌, 아스파테이트, 글루타메이트, 리신 또는 오르니틴을 포함한다. 아미노산은 분지된 링커의 어느 곳에도 위치될 수 있다. 예를 들면, 분지형 링커의 옥심을 분지형 링커의 폴리에틸렌 글리콜 유닛에 공유 결합시킬 수 있다. 택일적으로 또는 부가적으로, 이러한 아미노산은 제2 링커에, 임의로 각각의 제2 링커 내에 존재할 수 있다.
구체적인 본 발명의 일 양태에서, 상기 링커-활성제는 하기 구조식 화합물을 포함한다.
Figure PCTKR2022004552-appb-img-000060
을 포함하고,
상기 B‘ 및 B'’는 동일하거나 상이할 수 있는 활성제를 나타내며;
n1 내지 n3은 각각 독립적으로 0 내지 30의 정수를 나타내고;
AA는 아미노산 그룹을 나타낸다.
본 발명의 일 양태에서, 상기 AA는 아미노산 그룹을 나타내며, 아미노산 그룹은 하나 이상의 아미노산이 결합된 형태를 의미한다.
본 발명의 일 양태에서, i) 링커는 다수의 아미노산의 펩타이드 서열을 포함하고; ii) 적어도 두 개의 활성제는 아미노산의 측쇄와 공유 결합으로 연결된다.
구체적인 본 발명의 일 양태에서, 상기 아미노산 그룹은 1 내지 20의 아미노산의 주쇄 결합되거나; 또는 측쇄 결합이다.
구체적인 본 발명의 일 양태에서, 상기 아미노산 그룹은 1 내지 20의 아르기닌, 아스파테이트, 아스파라긴, 글루타메이트, 글루타민, 히스티틴, 리신, 오르니틴, 프롤린, 세린 또는 트레오닌의 주쇄 결합; 또는 측쇄 결합에 의한 그룹이다.
구체적인 본 발명의 일 양태에서, 상기 아미노산 그룹은 1 내지 20의 아르기닌, 아스파테이트, 글루타메이트, 리신 또는 오르니틴의 주쇄 결합; 또는 측쇄 결합에 의한 그룹이다.
구체적인 본 발명의 일 양태에서, 상기 아미노산 그룹은 1 내지 20의 아미노산 하나 이상의 리신을 포함한다.
또한, 상기 아미노산 그룹은 리신의 주쇄, 측쇄 결합을 포함한다.
본 발명의 일 양태에서, 상기 제5 유닛을 포함하는 분지형 링커는
Figure PCTKR2022004552-appb-img-000061
일 수 있다.
본 명세서에서, ‘활성제 모이어티’는 활성제를 포함하여 링커 또는 링커 일부에 공유결합시키는 화합물을 말한다.
본 발명에서, 활성제 모이어티는 링커에 직접결합할 수 있고, 링커에 하나 이상, 구체적으로, 2개 이상, 3개 이상, 4개 이상의 활성제 모이어티가 링커에 직접결합할 수 있다.
또한, 본 발명에서 활성제 모이어티는 활성제를 링커에 직접결합시키기 위한 화합물 단위를 포함할 수 있다. 또한, 본 발명에서 활성제 모이어티의 일부는 절단가능하고, 일부분이 절단되어 세포내 환경에서 활성제를 방출할 수 있다. 또한, 본 발명에서 활성제 모이어티 및 링커는 접합체의 DAR, 약리활성 등을 고려하여 결합개수를 정할 수 있다. 일 예에서, 활성제 모이어티는 하기 구조 및 활성제를 포함한 전체를 의미할 수 있고, 이를 통해 활성제와 링커를 직접결합할 수 있다. 다만, 이는 예시적인 것으로 이에 제한되는 것은 아니다.
Figure PCTKR2022004552-appb-img-000062
(여기에서, 각 부분은 상기 정의와 같다)
본 발명의 일 양태에서, 활성제는 각각 독립적으로 화학요법제 및 톡신으로부터 선택된다.
또한, 활성제는 면역 조절 화합물, 항암제, 항바이러스제, 항균제, 항진균제, 항기생충제 또는 이들의 조합일 수 있고, 하기 나열된 활성제 중 선택적으로 사용할 수 있다:
(a) 엘로티닙(erlotinib), 보르테조밉(bortezomib), 풀베스트란트(fulvestrant), 수텐트(sutent), 레트로졸(letrozole), 이마티닙 메실레이트(imatinib mesylate), PTK787/ZK 222584, 옥살리플라틴(oxaliplatin), 5-플루오로우라실(5-fluorouracil), 루코보린(leucovorin), 라파마이신(rapamycin), 라파티닙(lapatinib), 로나파르닙(lonafarnib), 소라페닙(sorafenib), 제피티닙(gefitinib), AG1478, AG1571, 티오테파(thiotepa), 사이클로포스파마이드(cyclophosphamide), 부술판(busulfan), 임프로술판(improsulfan), 피포술판(piposulfan), 벤조도파(benzodopa), 카르보콘(carboquone), 메츄도파(meturedopa), 유레도파(uredopa), 에틸렌이민(ethylenimine), 알트레타민(altretamine), 트리에틸렌멜라민(triethylenemelamine), 트리에틸렌포스포라미드(trietylenephosphoramide), 트리에틸렌티오포스포라미드(triethiylenethiophosphoramide), 트리메틸롤로멜라민(trimethylolomelamine), 불라타신(bullatacin), 불라타시논(bullatacinone), 캄토테신(camptothecin), 토포테칸(topotecan), 브리오스타틴(bryostatin), 칼리스타틴(callystatin), CC-1065, 아도젤레신(adozelesin), 카르젤레신(carzelesin), 비젤레신(bizelesin), 크립토피신 1(cryptophycin 1), 크립토피신 8(cryptophycin 8), 돌라스타틴(dolastatin), 듀오카마이신(duocarmycin), KW-2189, CB1-TM1, 엘루테로빈(eleutherobin), 판크라티스타틴(pancratistatin), 사르코딕티인(sarcodictyin), 스폰지스타틴(spongistatin), 클로람부실(chlorambucil), 클로르나파진(chlornaphazine), 클로로포스파미드(cholophosphamide), 에스트라무스틴(estramustine), 이포스파미드(ifosfamide), 메클로르에타민(mechlorethamine), 멜팔란(melphalan), 노벰비킨(novembichin), 페네스테린(phenesterine), 프레드니무스틴(prednimustine), 트로포스파미드(trofosfamide), 우라실 머스타드(uracil mustard), 카르무스틴(carmustine), 클로로코토신(chlorozotocin), 포테쿠스틴(fotemustine), 로무스틴(lomustine), 니무스틴(nimustine), 라니무스틴(ranimnustine), 칼리키아미신(calicheamicin), 칼리키아미신 감마 1(calicheamicin gamma 1), 칼리키아미신 오메가 1(calicheamicin omega 1), 디네미신(dynemicin), 디네미신 A(dynemicin A), 클로드로네이트(clodronate), 에스페르아미신(esperamicin), 네오카르지노스타틴크로모포어(neocarzinostatin chromophore), 아클라시노마이신(aclacinomysins), 악티노마이신(actinomycin), 안트르마이신(antrmycin), 아자세린(azaserine), 블레오마이신(bleomycins), 칵티노마이신(cactinomycin), 카라비신(carabicin), 카르니노마이신(carninomycin), 카르지노필린(carzinophilin), 크로모마이신(chromomycins), 닥티노마이신(dactinomycin), 다우노루비신(daunorubicin), 데토루부신(detorubucin), 6-디아조-5-옥소-L-노르루신(6-diazo-5-oxo-L-norleucine), 독소루비신(doxorubicin), 모르폴리노-독소루비신(morpholino-doxorubicin), 시아노모르폴리노-독소루비신(cyanomorpholino-doxorubicin), 2-피롤리노-독소루비신(2-pyrrolino-doxorubucin), 리포소말 독소루비신(liposomal doxorubicin), 데옥시독소루비신(deoxydoxorubicin), 에피루비신(epirubicin), 에소루비신(esorubicin), 마르셀로마이신(marcellomycin), 미토마이신 C(mitomycin C), 미코페놀산(mycophenolic acid), 노갈라마이신(nogalamycin), 올리보마이신(olivomycins), 페플로마이신(peplomycin), 포트피로마이신(potfiromycin), 퓨로마이신(puromycin), 쿠엘라마이신(quelamycin), 로도루비신(rodorubicin), 스트렙토미그린(streptomigrin), 스트렙토조신(streptozocin), 투베르시딘(tubercidin), 우베니멕스(ubenimex), 지노스타틴(zinostatin), 조루비신(zorubicin), 5-플루오로우라신(5-fluorouracil), 데노프테린(denopterin), 메토트렉세이트(methotrexate), 프테로프테린(pteropterin), 트리메트렉세이트(trimetrexate), 플루다라빈(fludarabine), 6-머캅토퓨린(6-mercaptopurine), 티아미프린(thiamiprine), 티구아닌(thiguanine), 안시타빈(ancitabine), 아자시티딘(azacitidine), 6-아자유리딘(6-azauridine), 카르모푸르(carmofur), 시타라빈(cytarabine), 디데옥시유리딘(dideoxyuridine), 독시플루리딘(doxifluridine), 에노시타빈(enocitabine), 플록수리딘(floxuridine), 칼루스테론(calusterone), 드로모스타놀론(dromostanolone), 프로피오네이트(propionate), 에피티오스타놀(epitiostanol), 메피티오스테인(mepitiostane), 테스토락톤(testolactone), 아미노글루테티미드(aminoglutethimide), 미토테인(mitotane), 트릴로스테인(trilostane), 폴린산(folinic acid), 아세글라톤(aceglatone), 알도포스파미드 글리코사이드(aldophosphamide glycoside), 아미노레불린산(aminolevulinic acid), 에닐우라실(eniluracil), 암사크린(amsacrine), 베스트라부실(bestrabucil), 비산트렌(bisantrene), 에다트락세이트(edatraxate), 데포파민(defofamine), 데메콜신(demecolcine), 디아지콘(diaziquone), 엘포르니틴(elfornithine), 엘립티니움 아세테이트(elliptinium acetate), 에토글루시드(etoglucid), 갈리움 나이트레이트(gallium nitrate), 하이드록시우레아(hydroxyurea), 렌티난(lentinan), 로니다이닌(lonidainine), 메이탄신(maytansine), 안사미토신(ansamitocins), 미토구아존(mitoguazone), 미토잔트론(mitoxantrone), 모피단몰(mopidanmol), 니트라에린(nitraerine), 펜토스타틴(pentostatin), 페나메트(phenamet), 피라루비신(pirarubicin), 로소잔트론(losoxantrone), 2-에틸하이드라지드(2-ethylhydrazide), 프로카르바진(procarbazine), 폴리사카라이드-k(polysaccharidek), 라족세인(razoxane), 리조신(rhizoxin), 시조피란(sizofiran), 스피로게르마늄(spirogermanium), 테누아존산(tenuazonic acid), 트리아지콘(triaziquone), 2,2',2''-트리클로로트리에틸아민(2,2',2''-trichlorotriethylamine), T-2 톡신, 베라큐린 A(verracurin A), 로리딘 A(roridin A), 안구이딘(anguidine), 우레탄(urethane), 빈데신(vindesine), 다카르바진(dacarbazine), 만노무스틴(mannomustine), 미토브로니톨(mitobronitol), 미토락톨(mitolactol), 피포브로만(pipobroman), 가시토신(gacytosine), 아라비노사이드(arabinoside), 사이클로포스파미드(cyclophosphamide), 티오테파(thiotepa), 파클리탁셀(paclitaxel), 파클리탁셀, 파클리탁셀의 알부민-엔지니어드 나노파티클(albumin-engineered nanoparticle formulation of paclitaxel), 도세탁셀, 클로람부실, 젬시타빈, 6-티오구아닌, 머캅토퓨린, 시스플라틴, 카보플라틴(carboplatin), 빈블라스틴(vinblastine), 플래티늄(platinum), 에토포사이드(etoposide), 이포스파미드(ifosfamide), 미톡산트론(mitoxantrone), 빈크리스틴, 비노렐빈(vinorelbine), 노반트론(novantrone), 테니포사이드(teniposide), 에다트렉세이트(edatrexate), 다우노마이신(daunomycin), 아미노프테린(aminopterin), 젤로다(xeloda), 이반드로네이트(ibandronate), CPT-11, 토포이소머라아제 저해제 RFS 2000, 디플루오로메틸오르니틴(difluoromethylornithine), 레티노산(retinoic acid), 카페시타빈(capecitabine), 또는 이의 약학적으로 허용되는 염, 용매화물 또는 산;
(b) 모노카인(monokine), 림포카인(lympokine), 폴리펩타이드 호르몬(traditional polypeptide hormone), 부갑상선 호르몬(parathyroid hormone), 티록신(thyroxine), 릴렉신(relaxin), 프로릴렉신(prorelaxin), 당단백 호르몬(glycoprotein hormone), 여포자극호르몬(follicle stimulating hormone), 갑상샘자극호르몬(thyroid stimulating hormone), 황체형성호르몬(luteinizing hormone), 간 성장인자 섬유모세포성장인자(hepatic growth factor fibroblast growth factor), 프롤락틴(prolactin), 태반성 락토젠(placental lactogen), 종양괴사인자 (tumor necrosis factor), 종양괴사인자-α, 종양괴사인자-β, 뮐러관 억제물질(mullerian inhibiting substance), 마우스 고나도트로핀-연관 펩타이드(mouse gonadotropin associated peptide), 인히빈(inhibin), 액티빈(activin), 혈관내피증식인자(vascular endothelial growth factor), 트롬보포이에틴(thrombopoietin), 에리스로포이에틴(erythropoietin), 골유도 인자(osteoinductive factor), 인터페론, 인터페론-α, 인터페론-β, 인터페론-γ, 콜로니자극인자(colony stimulating factor, CSF), 마크로파지-CSF, 과립구-마크로파지-CSF(granulocyte-macrophage-CSF), 과립구-CSF, 인터루킨(IL), IL-1, IL-1α, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, 종양괴사인자(tumor necrosis factor), 폴리펩타이드 인자, LIF, 키트 리간드(kit ligand), 또는 이들의 배합물;
(c) 디프테리아 톡신, 보툴리눔 톡신, 테타누스 톡신, 디센터리 톡신, 콜레라 톡신, 아마니틴, α-아마니틴, 피롤로벤조디아제핀, 피롤로벤조디아제핀 유도체, 인돌리노벤조디아제핀, 피리디노벤조디아제핀, 테트로도톡신, 브레베톡신(brevetoxin), 시구아톡신(ciguatoxin), 리신(ricin), AM 톡신, 오리스타틴(auristatin), 투불리신(tubulysin), 겔다나마이신(geldanamycin), 메이탄시노이드(maytansinoid), 칼리케아마이신(calicheamycin), 다우노마이신(daunomycin), 독소루비신(doxorubicin), 메토트렉세이트(methotrexate), 빈데신(vindesine), SG2285, 돌라스타틴(dolastatin), 돌라스타틴 유사체(dolastatin analog), 오리스타틴(auristatin), 크립토피신(cryptophycin), 캄토테신(camptothecin), 리족신(rhizoxin), 리족신 유도체(rhizoxin derivatives), CC-1065, CC-1065, 유사체 또는 유도체, 듀오카마이신(duocarmycin), 에네다인 항생제(enediyne antibiotic), 에스페라마이신(esperamicin), 에포틸론(epothilone), 톡소이드(toxoid), 또는 이들의 배합물;
(d) 친화성 리간드(affinity ligand), 여기에서 친화성 리간드는 기질, 저해제, 활성화제, 신경전달물질, 방사성 동위원소, 또는 이들의 배합물;
(e) 방사능표지(radioactive label), 32P, 35S, 형광다이, 전자밀도 반응제(electron dense reagent), 효소, 비오틴, 스트렙타비딘(streptavidin), 디옥시제닌(dioxigenin), 햅텐(hapten), 면역성 단백질(immunogenic protein), 타겟에 컴플러멘터리한 서열을 갖는 핵산 분자(nucleic acid molecule with a sequence complementary to a target) 또는 이들의 배합물;
(f) 면역조절 화합물(immunomodulatory compound), 항-암제(anticancer agent), 항-바이러스제(anti-viral agent), 항-박테리아제(anti-bacterial agent), 항-곰팡이제(anti-fungal agent), 및 항-기생충제(anti-parasitic agent), 또는 이들의 배합물;
(g) 타목시펜(tamoxifen), 랄록시펜(raloxifene), 드롤록시펜(droloxifene), 4-하이드록시타목시펜(4-hydroxytamoxifen), 트리옥시펜(trioxifene), 케옥시펜(keoxifene), LY117018, 오나프리스톤(onapristone) 또는 토레미펜(toremifene);
(h) 4(5)-이미다졸, 아미노글루테티미드(aminoglutethimide), 메제스톨 아세테이트(megestrol acetate), 엑스메스탄(exemestane), 레트로졸(letrozole), 또는 아나스트로졸(anastrozole)
(i) 플루타미드(flutamide), 닐루타미드(nilutamide), 비칼루타미드(bicalutamide), 리우프롤라이드(leuprolide), 고세렐린(goserelin), 또는 트록사시타빈(troxacitabine);
(j) 아로마타아제 저해제;
(k) 단백질 키나아제 저해제;
(l) 리피드 키나아제 저해제;
(m) 안티센스 올리고뉴클레오티드;
(n) 리보자임;
(o) 백신; 및
(p) 항-맥관형성제(anti-angiogenic agent)
본 발명의 일 양태에서, 활성제는
Figure PCTKR2022004552-appb-img-000063
,
Figure PCTKR2022004552-appb-img-000064
,
Figure PCTKR2022004552-appb-img-000065
,
Figure PCTKR2022004552-appb-img-000066
,
Figure PCTKR2022004552-appb-img-000067
,
Figure PCTKR2022004552-appb-img-000068
,
Figure PCTKR2022004552-appb-img-000069
,
Figure PCTKR2022004552-appb-img-000070
,
Figure PCTKR2022004552-appb-img-000071
,
Figure PCTKR2022004552-appb-img-000072
,
Figure PCTKR2022004552-appb-img-000073
,
Figure PCTKR2022004552-appb-img-000074
,
Figure PCTKR2022004552-appb-img-000075
,
Figure PCTKR2022004552-appb-img-000076
,
Figure PCTKR2022004552-appb-img-000077
, 또는
Figure PCTKR2022004552-appb-img-000078
이고,
여기에서 y는 1 내지 10의 정수이다.
또한, 본 발명의 다른 일 양태에서, 활성제는 피롤로벤조디아제핀 다이머이고, 상기 피롤로벤조디아제핀 다이머의 N10 또는 N10' 위치를 통해 링커와 항체가 연결된다.
피롤로벤조디아제핀 다이머의 N10 및 N10' 위치에 각각 독립적으로 -C(O)O-*, -S(O)O-*, -C(O)-*, -C(O)NR-*, -S(O)2NR-*, -(P(O)R')NR-*, -S(O)NR-*, 및 -PO2NR-*기로 이루어진 그룹으로부터 선택되는 어느 하나가 부착되며,
여기에서 *은 링커가 부착되는 부분이고,
여기에서, R 및 R'은 각각 독립적으로 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, 치환되거나 비치환된 C1-8알킬, 치환되거나 비치환된 C3-8사이클로알킬, 치환되거나 비치환된 C1-8알콕시, 치환되거나 비치환된 C1-8알킬티오, 치환되거나 비치환된 C3-20헤테로아릴, 치환되거나 비치환된 C5-20아릴 또는 모노- 또는 다이-C1-8알킬아미노이고,
여기에서 C1-8알킬, C3-8사이클로알킬, C1-8알콕시, C1-8알킬티오, C3-20헤테로아릴, C5-20아릴이 치환되는 경우, H, OH, N3, CN, NO2, SH, NH2, ONH2, NNH2, 할로, C1-6알킬, C1-6알콕시 및 C6-12아릴로 이루어진 그룹으로부터 선택되는 치환기로 치환되는,
피롤로벤조디아제핀 다이머 전구체(pyrrolobenzodiazepine dimer prodrug), 이의 약학적으로 허용되는 염 또는 용매화물은 활성제로 사용할 수 있다.
보다 구체적으로, 피롤로벤조디아제핀 다이머의 N10 위치에서 X 또는 N'10 위치에서 X '로 치환되고, 여기서 X 또는 X'는 피롤로벤조디아제핀 다이머를 링커에 연결하며;
X 및 X'는 각각 독립적으로 -C(O)O*, -S(O)O-*, -C(O)-*, -C(O)NRX-*, -S(O)2NRX-*, -P(O)R'NRX-*, -S(O)NRX-*, 또는 -PO2NRX-*로부터 선택되고;
RX 및 RX'는 독립적으로 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디(di)-C1-8 알킬아미노로부터 선택된다.
본 발명의 일 양태에서, 상기 활성제로 피롤로벤조디아제핀 다이머 전구체가 제공된다. 본 발명에 따른 전구체 형태로 투여하는 경우, 혈중 노출 시 추가적인 반응에 의해 유효한 약물로 전환되어야 할 필요가 있기 때문에 예상치 못한 링커의 분해 시에 생길 수 있는 부작용의 발생가능성을 미연에 방지할 수 있고, 정상세포에 대한 독성이 감소하며, 약물이 보다 안정적이라는 점에서 기존 PBD 약물에 비해 유리한 점이 있다.
또한 항체-약물 접합체 제조 시, 기존 방법으로 제조한 항체-약물 접합체의 경우 불순물의 함량이 높고 노출된 이민 그룹이 뉴클레오필(nucleophile)의 공격을 받아 원치 않는 구조의 약물이 생성될 우려가 있는 반면, 본 발명에 따른 방법으로 제조된 항체-약물 접합체는 순도가 높아 분리가 용이하다는 장점이 있고, 기존 PBD 또는 PBD 다이머에 비하여 물성이 보다 향상되는 것으로 나타났다.
본 발명의 일 양태에서, 피롤로벤조디아제핀 다이머 전구체는 하기 일반식 X 또는 일반식 XI 구조를 갖는 것을 특징으로 하는, 피롤로벤조디아제핀 다이머 전구체, 이의 약학적으로 허용되는 염 또는 용매화물이다:
[일반식 X]
Figure PCTKR2022004552-appb-img-000079
[일반식 XI]
Figure PCTKR2022004552-appb-img-000080
상기 식에서,
상기 점선은 C1과 C2 사이, C2와 C3 사이, C'1과 C'2 사이, 또는 C'2과 C'3 사이의 이중 결합의 선택적 존재를 나타내며;
RX1 및 RX1'는 독립적으로 H, OH, =O, =CH2, CN, Rm, ORm, =CH-Rm' =C(Rm')2, O-SO2-Rm, CO2Rm, CORm, 할로 및 디할로로부터 선택되고;
Rm'는 Rm, CO2Rm, CORm, CHO, CO2H, 및 할로로부터 선택되며,
각각의 Rm는 독립적으로 C1-12 알킬, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴로 이루어진 군으로부터 선택되고;
RX2, RX2' RX3, RX3', RX5, 및 RX5'는 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, NO2, 및 할로로부터 선택되며;
RX4 및 RX4'는 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, NO2, 할로, C1-6 알킬 C1-6 알콕시, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-12 아릴, 5 내지 7-원 헤테로아릴, -CN, -NCO, -ORn, -OC(O)Rn, -OC(O)NRnRn', -OS(O)Rn, -OS(O)2Rn, -SRn, -S(O)Rn, -S(O)2Rn, -S(O)NRnRn', -S(O)2NRnRn', -OS(O)NRnRn', -OS(O)2NRnRn', -NRnRn', -NRnC(O)Ro, -NRnC(O)ORo, -NRnC(O)NRoRo', -NRnS(O)Ro, -NRnS(O)2Ro, -NRnS(O)NRoRo', -NRnS(O)2NRoRo', -C(O)Rn, -C(O)ORn 및 -C(O)NRnRn'로 부터 선택되고;
X 및 X'는 독립적으로 -C(O)O*, -S(O)O-*, -C(O)-*, -C(O)NRX-*, -S(O)2NRX-*, -P(O)R'NRX-*, -S(O)NRX-*, 또는 -PO2NRX-*로부터 선택되며;
RX 및 RX'는 독립적으로 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디(di)-C1-8 알킬아미노로 부터 선택되며;
Y 및 Y'는 독립적으로 O, S, 및 N(H)으로 부터 선택되고;
RX6는 독립적으로 C3-12 알킬렌, C3-12 알케닐렌, 또는 C3-12 헤테로알킬렌으로 부터 선택되며;
RX7 및 RX7' 는 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로 알킬, 3 내지 7-원 헤테로사이클로알킬, C6-10 아릴, 5 내지 7-원 헤테로아릴, -ORr, -OC(O)Rr, -OC(O)NRrRr', -OS(O)Rr, -OS(O)2Rr, -SRr, -S(O)Rr, -S(O)2Rr, -S(O)NRrRr', -S(O)2NRrRr', -OS(O)NRrRr', -OS(O)2NRrRr', -NRrRr', -NRrC(O)Rs, -NRrC(O)ORs, -NRrC(O)NRsRs', -NRrS(O)Rs, -NRrS(O)2Rs, -NRrS(O)NRsRs', -NRrS(O)2NRsRs, -C(O)Rr, -C(O)ORs 또는 -C(O)NRrRr'으로 부터 선택되고;
각각의 Rr, Rr', Rs, 및 Rs' 은 독립적으로 H, C1-7 알킬, C2-7 알케닐, C2-7 알키닐, C3-13 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 및 5 내지 7-원 헤테로아릴로 부터 선택되며;
각 RX8 및 RX8'는 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6 알키닐, C3-6 헤테로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 5 내지 7-원 헤테로아릴, -S(O)Rm, -S(O)2Rm, -S(O)NRmRm', -S(O)2NRmRm', -NRmRm', -NRmC(O)Rm, -NRmC(O)ORn, -NRmC(O)NRnRn', -NRmS(O)Rn, -NRmS(O)2Rn, -NRmS(O)NRnRn', -NRmS(O)2NRnRn', -C(O)Rm, -C(O)ORm 및 -C(O)NRmRm'로 부터 선택되고;
Za 는 ORX12a, NRX12aRX12a, 또는 SRX12a로 부터 선택되며;
Zb 는 ORX13a, NRX13aRX13a, 또는 SRX13a로 부터 선택되고;
Za'는 ORX12a', NRX12a'RX12a', 또는 SRX12a'로 부터 선택되며;
Zb'는 ORX13a', NRX13'RX13a' 또는 SRX13a'로 부터 선택되고;
각 RX12a, RX12a', RX13a' 및 RX13a'는 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 5 내지 7-원 헤테로아릴, -C(O)RX15a, -C(O)ORX15a 및 -C(O)NRX15aRX15a'로 부터 선택되고; 및
각각의 RX15a 및 RX15a' 는 독립적으로 C1-12 알킬, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴로부터 선택되며;
상기 Za 및 Zb는 이들이 부착된 원자와 함께 임의적으로 결합하여 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 또는 3 내지 7-원 헤테로아릴을 형성하고, 및 Za' 및 Zb'는 이들이 부착된 원자와 함께 임의적으로 결합하여 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 또는 3 내지 7-원 헤테로 아릴을 형성하며; 및
상기 각각의 Rn, Rn', Ro, Ro', Rp, 및 Rp' 는 독립적으로 H, C1-7 알킬, C2-7 알케닐, C2-7 알키닐, C3-13 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 및 5 내지 7-원 헤테로아릴로부터 선택된다.
본 발명의 일 양태에서, 상기 Rm는 독립적으로 C1-12 알킬, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴로 이루어진 군으로부터 선택되고,
본 발명의 일 양태에서, Rm는 추가적으로 C1-12 알킬, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 또는 5 내지 7-원 헤테로아릴로 치환된다.
본 발명의 일 양태에서, 상기 RX4 및 RX4'는 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRmRm', NO2, 할로, C1-6 알킬 C1-6 알콕시, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-12 아릴, 5 내지 7-원 헤테로아릴, -CN, -NCO, -ORn, -OC(O)Rn, -OC(O)NRnRn', -OS(O)Rn, -OS(O)2Rn, -SRn, -S(O)Rn, -S(O)2Rn, -S(O)NRnRn', -S(O)2NRnRn', -OS(O)NRnRn', -OS(O)2NRnRn', -NRnRn', -NRnC(O)Ro, -NRnC(O)ORo, -NRnC(O)NRoRo', -NRnS(O)Ro, -NRnS(O)2Ro, -NRnS(O)NRoRo', -NRnS(O)2NRoRo', -C(O)Rn, -C(O)ORn 및 -C(O)NRnRn'로 부터 선택되고,
상기 RX4 또는 RX4'는 C1-6 알킬, C1-6 알콕시, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-12 아릴 또는 5 내지 7-원 헤테로아릴이고, 추가적으로 하나 이상의 C1-6 알킬, C1-6 알콕시, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 5 내지 7-원 헤테로아릴, -ORp, -OC(O)Rp, -OC(O)NRpRp', -OS(O)Rp, -OS(O)2Rp, -SRp, -S(O)Rp, -S(O)2Rp, -S(O)NRpRp', -S(O)2NRpRp', -OS(O)NRpRp', -OS(O)2NRpRp', -NRpRp', -NRpC(O)Rq, -NRpC(O)ORq, -NRpC(O)NRqRq', -NRpS(O)Rq, -NRpS(O)2Rq, -NRpS(O)NRqRq', -NRpS(O)2NRqRq', -C(O)Rp, -C(O)ORp 또는 -C(O)NRpRp로 치환된다.
본 발명의 일 양태에서, 상기 RX7 및 RX7' 는 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C6-10 아릴, 5 내지 7-원 헤테로아릴, -ORr, -OC(O)Rr, -OC(O)NRrRr', -OS(O)Rr, -OS(O)2Rr, -SRr, -S(O)Rr, -S(O)2Rr, -S(O)NRrRr', -S(O)2NRrRr', -OS(O)NRrRr', -OS(O)2NRrRr', -NRrRr', -NRrC(O)Rs, -NRrC(O)ORs, -NRrC(O)NRsRs', -NRrS(O)Rs, -NRrS(O)2Rs, -NRrS(O)NRsRs', -NRrS(O)2NRsRs, -C(O)Rr, -C(O)ORs 또는 -C(O)NRrRr'으로부터 선택되고,
상기 RX7 또는 RX7' 는 C1-6 알킬, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C6-10 아릴, 5 내지 7-원 헤테로아릴이고, 추가적으로 C1-6 알킬, C2-6 알케닐, C2-6 알키닐, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C6-10 아릴, 5 내지 7-원 헤테로아릴, -ORt, -OC(O)Rt, -OC(O)NRtRt', -OS(O)Rt, -OS(O)2Rt, -SRt, -S(O)Rt, -S(O)2Rt, -S(O)NRtRt', -S(O)2NRtRt', -OS(O)NRtRt', -OS(O)2NRtRt', -NRtRt', -NRtC(O)Ru, -NRtC(O)ORu, -NRtC(O)NRuRu', -NRtS(O)Ru, -NRtS(O)2Ru, -NRtS(O)NRuRu', -NRtS(O)2NRuRu', -C(O)Rt, -C(O)ORt 또는 -C(O)NRtRt'로 치환되며,
상기 Rr, Rr', Rs, Rs', Rt, Rt', Ru 및 Ru'는 독립적으로 H, C1-7 알킬, C2-7 알케닐, C2-7 알키닐, C3-13 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴, 및 5 내지 7-원 헤테로아릴로부터 선택된다.
본 발명의 일 양태에서, 상기 RX1 및 RX1' 는 독립적으로 Rm 으로부터 선택되고; 및
Rm은 C1-6 알킬, C2-6 알케닐, C5-7 아릴 및 C3-6 헤테로아릴로부터 선택된다.
본 발명의 일 양태에서, 상기 RX2 , RX2', RX3, RX3', RX5, 및 RX5'은 독립적으로 H 또는 OH로부터 선택된다.
본 발명의 일 양태에서, RX4 및 RX4' 는 독립적으로 Rm으로부터 선택되고; 및
Rm 은 C1-6 알콕시이다.
본 발명의 일 양태에서, 상기 RX4 및 RX4' 는 독립적으로 메톡시, 에톡시 및 부톡시로 이루어진 군으로부터 선택되는 어느 하나이다.
본 발명의 일 양태에서, 상기 Y 및 Y'는 O이다.
본 발명의 일 양태에서, 상기 RX6 는 C3-12 알킬렌, C3-12 알케닐렌 또는 C3-12 헤테로알킬렌이고, 상기 RX6은 -NH2, -NHRm, -NHC(O)Rm, -NHC(O)CH2-[OCH2CH2]n-RXX, 또는 -[CH2CH2O]n-RXX치환되고;
상기 RXX는 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디-C1-8 알킬 아미노; 및
n은 1 내지 6의 정수이다.
본 발명의 일 양태에서, 상기 피롤로벤조디아제핀 다이머는 하기 일반식 X로 표현되는 것이다.
[일반식 X]
Figure PCTKR2022004552-appb-img-000081
상기 식에서,
상기 점선은 C1과 C2 사이, C2와 C3 사이, C'1과 C'2 사이, 또는 C'2과 C'3 사이의 이중 결합의 선택적 존재를 나타내며;
RX1 및 RX1'는 각각 독립적으로 H, OH, =O, =CH2, CN, Rm, ORm, =CH-Rm, =C(Rm')2, OSO2-Rm, CO2Rm, CORm, 할로 또는 디할로로부터 선택되고;
RX2, RX2' RX3, 및 RX3'는 각각 독립적으로 H, Rm, OH, ORm, NRm 2, NO2, 및 할로로부터 선택되며;
RX4 및 RX4'는 각각 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, 할로, 및 C1-6 알킬로부터 선택되고;
RX5 및 RX5'는 각각 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, -NRmRm', NO2, -NRmC(O)Rm‘, -NRmC(O)ORm‘, -NRmC(O)NRmRm‘, -S(O)Rm, -S(O)2Rm, -S(O)NRmRm', -S(O)2NRmRm', -NRmS(O)Rm', -NRmS(O)2Rm', -P(O)Rm, -P(O)2Rm, -P(O)NRmRm', -P(O)2NRmRm', -NRmP(O)Rm', -NRmP(O)2Rm', 및 할로로부터 선택되며;
Y 및 Y'는 각각 독립적으로 O, S, 또는 N(H)이고;
RX6는 독립적으로 C3-12 알킬렌, C3-12 알케닐렌, 또는 C3-12 헤테로알킬렌이며; RX6은 -NH2, -NHRm, -NHC(O)Rm, -NHC(O)CH2-[OCH2CH2]n-RXX, 또는 -[CH2CH2O]n-RXX로 치환되거나 비치환되고;
상기 RXX는 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 시클로알킬, C1-8 알콕시, C1-8 알킬 티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디-C1-8 알킬아미노이고, 여기에서 n은 1 내지 6의 정수이며;
RX7 및 RX7'는 각각 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6 알키닐, -C(O)Rr, -C(O)ORs 또는 -C(O)NRrRr'이고;
Rr, Rr', 및 Rs는 각각 독립적으로 H, C1-7 알킬, C2-7 알케닐, C2-7 알키닐, C3-13 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴 또는 5 내지 7-원 헤테로아릴로이며;
각 Rm'는 독립적으로 Rm, CO2Rm, CORm, CHO, CO2H, 및 할로로부터 선택되며,
각 Rm은 독립적으로 H, OH, C1-12 알킬, C1-12 알콕시, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴로 이루어진 군으로부터 선택되고, 여기에서 C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴의 하나 이상의 수소원자는 OH, =O, C1-12 알킬, 또는 C1-12 알콕시로 치환될 수 있다.
본 발명의 일 양태에서, 상기 RX1 및 RX1'는 각각 독립적으로 =CH2; C1-6 알킬; C1-6 알콕시; C2-6 알케닐; C5-7 아릴; C3-6 헤테로아릴; 또는 C1-6 알킬, 또는 C1-6 알콕시로 치환된 C5-7 아릴로부터 선택된다.
본 발명의 일 양태에서, 상기 RX2, RX2', RX3, 및 RX3'은 각각 독립적으로 H 또는 OH로부터 선택된다.
본 발명의 일 양태에서, 상기 RX5, 및 RX5'은 각각 독립적으로 H, OH, -S(O)Rm, S(O)2Rm, -P(O)Rm, 및 -P(O)2Rm로 이루어진 군에서 선택되고, 여기에서 Rm은 H, OH, C1-12 알킬, C1-12 알콕시, C2-12 알케닐, 또는 C2-12 알키닐이다.
본 발명의 일 양태에서, 상기 RX4 및 RX4'는 각각 독립적으로 C1-6 알콕시이다.
본 발명의 일 양태에서, 상기 RX4 및 RX4' 는 독립적으로 메톡시, 에톡시 및 부톡시로 이루어진 군으로부터 선택되는 어느 하나이다.
본 발명의 일 양태에서, 상기 Y 및 Y'는 O이다.
본 발명의 일 양태에서, 상기 RX6는 C3-12 알킬렌, C3-12 알케닐렌 또는 C3-12 헤테로알킬렌이고, 상기 RX6은 -NH2, -NHRm, -NHC(O)Rm, -NHC(O)CH2-[OCH2CH2]n-RXX, 또는 -[CH2CH2O]n-RXX로 치환되며;
상기 RXX는 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디-C1-8 알킬 아미노이고; 및
n은 1 내지 6의 정수이다.
또한, 본 발명의 일 양태에서, 상기 활성제는 일반식 XII 또는 일반식 XIII로 기재되는 피롤로벤조디아제핀 다이머이다:
[일반식 XII]
Figure PCTKR2022004552-appb-img-000082
[일반식 XIII]
Figure PCTKR2022004552-appb-img-000083
상기 Xa 및 Xa'는 독립적으로 결합 또는 C1-6 알킬렌으로부터 선택되고;
ZX' 및 ZX 는 독립적으로 수소, C1-8 알킬, 할로겐, 시아노, 나이트로,
Figure PCTKR2022004552-appb-img-000084
,
Figure PCTKR2022004552-appb-img-000085
또는 -(CH2)m-OCH3로부터 선택되며;
m은 0 내지 12의 정수이다.
상기 ZX' 및 ZX 는 독립적으로 수소,
Figure PCTKR2022004552-appb-img-000086
,
Figure PCTKR2022004552-appb-img-000087
및 -(CH2)m-OCH3로 이루어진 군으로 부터 선택되는 어느 하나이고,
상기 각각의 R80, R90 및 R100 는 수소, C1-3 알킬 및 C1-3 알콕시로 이루어진 군으로부터 선택되는 어느 하나이며,
m은 1 내지 6의 정수이다.
본 발명의 일 양태에서, 상기 [LINKER-(B)l] 전구체는
Figure PCTKR2022004552-appb-img-000088
,
Figure PCTKR2022004552-appb-img-000089
,
Figure PCTKR2022004552-appb-img-000090
,
Figure PCTKR2022004552-appb-img-000091
,
Figure PCTKR2022004552-appb-img-000092
,
Figure PCTKR2022004552-appb-img-000093
,
Figure PCTKR2022004552-appb-img-000094
,
Figure PCTKR2022004552-appb-img-000095
,
Figure PCTKR2022004552-appb-img-000096
,
Figure PCTKR2022004552-appb-img-000097
,
Figure PCTKR2022004552-appb-img-000098
,
Figure PCTKR2022004552-appb-img-000099
,
Figure PCTKR2022004552-appb-img-000100
,
Figure PCTKR2022004552-appb-img-000101
,
Figure PCTKR2022004552-appb-img-000102
,
Figure PCTKR2022004552-appb-img-000103
,
Figure PCTKR2022004552-appb-img-000104
,
Figure PCTKR2022004552-appb-img-000105
,
Figure PCTKR2022004552-appb-img-000106
,
Figure PCTKR2022004552-appb-img-000107
,
Figure PCTKR2022004552-appb-img-000108
,
Figure PCTKR2022004552-appb-img-000109
,
Figure PCTKR2022004552-appb-img-000110
,
Figure PCTKR2022004552-appb-img-000111
,
Figure PCTKR2022004552-appb-img-000112
및
Figure PCTKR2022004552-appb-img-000113
으로 이루어진 군으로부터 선택되는 어느 하나이다.
또한, 본 발명의 일 양태에서, 상기 [LINKER-(B)l] 전구체는
Figure PCTKR2022004552-appb-img-000114
,
Figure PCTKR2022004552-appb-img-000115
,
Figure PCTKR2022004552-appb-img-000116
,
Figure PCTKR2022004552-appb-img-000117
, 또는
Figure PCTKR2022004552-appb-img-000118
이고,
여기에서, MMAE는 모노메틸 오리스타틴 E(monomethyl auristatin E)이며,
MMAF는 모노메틸 오리스타틴 F(monomethyl auristatin F)이다.
본 발명의 일 양태에서, 상기 [LINKER-(B)l] 전구체는 하기 구조를 포함한다.
Figure PCTKR2022004552-appb-img-000119
,
Figure PCTKR2022004552-appb-img-000120
, 또는
Figure PCTKR2022004552-appb-img-000121
이고,
상기 B‘ 및 B’‘는 동일하거나 상이할 수 있는 활성제를 나타내고;
m 및 n은 각각 독립적으로 0 내지 30의 정수를 나타낸다.
구체적으로, 상기
Figure PCTKR2022004552-appb-img-000122
는 일반식 X의 X 및 X‘와 연결되는 부분을 의미한다. 더 구체적으로는
Figure PCTKR2022004552-appb-img-000123
이다.
또한, 본 발명은 상기 접합체를 포함하는 과증식, 암 또는 혈관신생질환의 예방 또는 치료용 약학적 조성물에 관한 것이다.
본 발명의 일 양태에서, 상기 약학적 조성물은 추가적으로 약학적으로 유효한 양의 화학 치료제(chemotherapeutic agent)를 포함한다.
본 발명의 일 양태에서, 상기 암은 폐암, 소세포성 폐암, 위장관암, 대장암, 장암, 유방암, 난소암, 전립선암, 고환암, 간암, 신장암, 방광암, 췌장암, 뇌암, 육종, 골육종, 카포시 육종 및 흑색종으로 이루어진 군으로부터 선택되는 어느 하나이다.
또한, 본 발명은 상기 접합체를 포함하는 약학 제제에 관한 것이다.
본 발명의 접합체 투여 경로는 예를 들면, 경구 또는 비경구 경로로 투여될 수 있다. 여기서, 비경구는 광의의 투여 경로를 의미하며, 예를 들면, 경피, 정맥내, 동맥내, 복강내, 근육내, 피하, 비내, 설하, 척추강내(초내, intrathecal), 흡입, 눈, 직장, 질, 뇌실 투여 등을 포함한다.
상기 조성물을 제제화할 경우, 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 제조된다.
경구투여를 위한 고형 제제에는 정제, 환자, 산제, 과립제, 캡슐제, 트로키제 등이 포함되며, 이러한 고형 제제는 하나 이상의 본 발명에 따른 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로스(sucrose) 또는 락토오스(lactose) 또는 젤라틴 등을 섞어 조제된다. 또한, 단순한 부형제 외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다. 경구 투여를 위한 액상 제제로는 현탁제, 내용액제, 유제 또는 시럽제 등이 해당되는데, 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다.
비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁용제, 유제, 주사제, 동결건조제제, 좌제 등이 포함된다. 비경구 투여를 위한 제제에서, 비수성용제, 현탁용제로는 프로필렌글리콜, 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세롤, 젤라틴 등이 사용될 수 있다.
본 발명에 따른 접합체는 약제학적으로 유효한 양으로 투여한다. 본 발명에 있어서, “약제학적으로 유효한 양”은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효용량 수준은 환자의 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
구체적으로, 본 발명에 따른 접합체의 유효량은 환자의 나이, 성별, 체중에 따라 달라질 수 있으며, 일반적으로는 체중 1 kg 당 0.01 mg 내지 150 mg, 보다 구체적으로 체중 1 kg 당 0.1 mg 내지 100 mg을 매일 또는 격일 투여하거나 1일 1 내지 3회로 나누어 투여할 수 있다. 그러나 투여 경로, 중증도, 성별, 체중, 연령 등에 따라서 증감될 수 있으므로 상기 투여량이 어떠한 방법으로도 본 발명의 범위를 한정하는 것은 아니다.
본 발명에 따른 항체-약물 접합체는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2) 발현 세포에 특이적으로 결합하여 세포 내로 내재화되는 항-CLDN18.2 항체를 포함함으로써, 약물을 효과적이면서도 특이적 및 선택적으로 전달할 수 있으며, 항체에 약물이 안정적으로 결합되어 생체내 안정성을 유지하면서 목적하는 세포독성을 나타낼 수 있도록 한다. 특히, 혈장 내에서 보다 안정하고 체내 순환시에도 안정적이며, 약물이 암세포 내에서 쉽게 방출되어 약효를 극대화할 수 있는 자가-희생기를 포함하는 링커 기술을 접목시킴으로써, 약물 및/또는 톡신이 표적 세포에 안정적으로 도달하여 약효를 효과적으로 발휘하면서도 독성을 크게 낮출 수 있는, 약물-링커-리간드 시스템을 제공하는 효과를 나타낸다.
도 1은 항체의 암세포 결합능을 확인하기 위해 수행한, 유세포 분석기를 이용한 세포결합 실험 결과를 도시한 것이다.
도 2 및 도 3은 ADC 시료의 In vivo 실험결과를 나타낸 도이다.
도 4 내지 7은 본 발명에 따른 ADC의 제조과정의 모식도이다.
본 발명은 항체가 중쇄 가변영역 및 경쇄 가변영역을 포함하는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)에 특이적으로 결합하는 항체 또는 항원 결합단편이고, 중쇄 가변영역은 서열번호 2로 표시되는 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 4로 표시되는 아미노산 서열로 이루어진 중쇄 CDR2, 서열번호 6으로 표시되는 아미노산 서열로 이루어진 중쇄 CDR3을 포함하고, 경쇄 가변영역은 서열번호 9로 표시되는 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 11로 표시되는 아미노산 서열로 이루어진 경쇄 CDR2, 서열번호 13으로 표시되는 아미노산 서열로 이루어진 경쇄 CDR3을 포함하는 접합체에 관한 것이다.
이하 본 발명을 실시예 및 실험예를 통해 보다 상세히 설명한다.
하기 실시예 및 실험예는 본 발명의 이해를 돕기 위한 것이고, 본 발명의 권리범위를 이로 한정하려는 의도를 갖는 것은 아니다.
<실시예 1> 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2) 특이적 항체 제조
CLDN18.2에 특이적으로 결합하는 항체는 국제 출원특허 제PCT/CN2020/118650호에 기재된 방법으로 제조하였다. 또한, 상기 CLDN18.2에 특이적으로 결합하는 항체의 아미노산 서열은 하기 [표 1]에 나타내었다.
PR002726-heavy chain 서열번호
FR1 EVQLLESGGGLVQPGGSLRLSCAAS 1
CDR1 GFTFSSFVMS 2
FR2 WVRQAPGKGLEWVS 3
CDR2 TISGSGRSTYYADSVKG 4
FR3 RFTISRDNSKNTLHLQMNSLRAEDTAVYYCAK 5
CDR3 DAAAAGTKFDY 6
FR4 WGQGTLVTVSS 7
VH EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFVMSWVRQAPGKGLEWVSTISGSGRSTYYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCAKDAAAAGTKFDYWGQGTLVTVSS 15
HC EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFVMSWVRQAPGKGLEWVSTISGSGRSTYYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCAKDAAAAGTKFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 17
PR002726-light chain 서열번호
FR1 EIVLTQSPATLSLSPGERATLSC 8
CDR1 RASQSVSSYLA 9
FR2 WYQQKPGQAPRLLIY 10
CDR2 DASNRAT 11
FR3 GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC 12
CDR3 QQRSNWPLT 13
FR4 FGGGTKVEIK 14
VL EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK 16
LC EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 18
ADC 합성을 위해 표 1의 항체(PR002726)의 경쇄 FR4 (서열번호 14) C-말단에 CaaX 펩타이드 모이어티 (GGGGGGGCVIM; 서열번호 19)를 융합한 형태의 항체 클론 PR301839를 제작하고, CHO cell 기반의 임시발현을 통해 항체를 생산하였다. 생산된 PR301839 항체를 다음 ADC 합성에 사용하였다.
클론 FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 VH/VL
PR301839-VH EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSFVMS WVRQAPGKGLEWVS TISGSGRSTYYADSVKG RFTISRDNSKNTLHLQMNSLRAEDTAVYYCAK DAAAAGTKFDY WGQGTLVTVSS EVQLLESGGGLVQPGGSLRLSCAASGFTFSSFVMSWVRQAPGKGLEWVSTISGSGRSTYYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCAKDAAAAGTKFDYWGQGTLVTVSS
서열번호 1 2 3 4 5 6 7 15
PR301839-VL EIVLTQSPATLSLSPGERATLSC RASQSVSSYLA WYQQKPGQAPRLLIY DASNRAT GIPARFSGSGSGTDFTLTISSLEPEDFAVYYC QQRSNWPLT FGGGTKVEIKGGGGGGGCVIM EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIKGGGGGGGCVIM
서열번호 8 9 10 11 12 13 20 21
<실시예 2> 화합물 1과 2의 제조
Figure PCTKR2022004552-appb-img-000124
Figure PCTKR2022004552-appb-img-000125
상기 화합물 1과 2는 대한민국 공개특허 10-2018-0110645호에 기재된 방법으로 제조하였다.
<실시예 3> 화합물 3의 제조
Figure PCTKR2022004552-appb-img-000126
상기 화합물 3은 국제 공개특허 제WO2017-089895호에 기재된 방법으로 제조하였다.
상기 화합물 3에서 MMAE의 구조는 다음과 같다.
Figure PCTKR2022004552-appb-img-000127
<실시예 4> 화합물 4와 화합물 5의 제조
Figure PCTKR2022004552-appb-img-000128
상기 화합물 4와 화합물 5는 특허 WO2017-089890에 기재된 방법으로 제조하였다.
상기 화합물 5에서 MMAF의 구조는 다음과 같다.
Figure PCTKR2022004552-appb-img-000129
<실시예 5> ADC의 제조
ADC의 제조는 다음의 두 단계를 거처 제조되었으며, 공통적으로 사용한 LCB14-0606과 LCB14-0512는 대한민국 공개특허 제10-2014-0035393호에 기재된 방법으로 제조하였다. LCB14-0606과 LCB14-0512의 구조식은 다음과 같다:
Figure PCTKR2022004552-appb-img-000130
1단계 : prenylated antibody의 제조
실시예 1에서 제조한 항체의 프레닐레이션 반응 혼합물을 제조하여 30℃에서 16시간 반응하였다. 반응혼합물은 24 μM 항체, 400 nM FTase (Calbiochem #344145)와 0.25 mM LCB14-0511 또는 LCB14-0606을 포함하는 완충용액 (50 mM Tris-HCl (pH 7.4), 5 mM MgCl2, 10 μM ZnCl2, 0.25 mM DTT)으로 구성하였다. 반응 종료 후 프레닐레이션된 항체는 PBS 완충용액으로 평형화된 G25 Sepharose 컬럼 (AKTA purifier, GE healthcare)으로 제염시켰다.
2단계 : 약물-접합 (drug-conjugation) 방법
<옥심 결합 반응 (conjugation by oxime bond formation)>
프레닐레이션된 항체와 링커-약물간의 옥심본드 생성반응 혼합물은 100 mM Na-아세테이트 완충용액 pH 5.2, 10% DMSO, 20 μM 항체와 200 μM 링커-약물(in house, 실시예 1, 2의 화합물 1, 2, 3, 4, 5, 7 및 8번)을 섞어 제조하였으며 30℃에서 약하게 교반하였다. 6시간 또는 24시간 반응 후에 FPLC(AKTA purifier, GE healthcare) 과정을 거쳐 사용된 과량의 저분자 화합물들을 제거하였으며 단백질 분획은 수집하여 농축하였다.
<Copper-free 클릭 결합 반응 (conjugation by Copper-free click reaction)>
프레닐레이션된 항체와 링커-약물간의 Copper-free click 결합반응을 이용한 ADC는 PBS 완충용액 (pH 7.4), 1% DMSO, 10 μM 프레닐레이션된 항체와 100 μM 링커-약물(in house, 실시예 1의 화합물 2번)을 섞어서 반응 혼합물을 제조하고 25℃에서 6 시간 반응 후에 FPLC(AKTA purifier, GE healthcare) 또는 G25 Sepharose 컬럼 과정을 거쳐 사용된 과량의 저분자 화합물들을 제거하였으며 단백질 분획은 수집하여 농축하였다.
ADC 제조목록
ADCs Antibody linker-toxin
ADC1 PR301839 화합물1
ADC2 화합물2
ADC3 화합물3
ADC4 화합물4
ADC5 화합물5
<실험예 1> 항체의 암세포 결합능 평가
Anti-CLDN18.2 항체(PR002726)와 경쇄 FR4 C-말단에 CaaX 펩타이드가 융합된 형태의 ADC 제조에 사용한 항체(PR301839)의 암세포 결합능을 유세포 분석기(FACS)를 이용한 세포 결합 실험으로 확인하였다.
암세포로는 CLDN18.2를 발현한다고 알려진 위암세포주인 SNU-601, SNU-620 및 췌장암 세포주인 PATU-8988s를 사용하였고 대조군 항체로 사람 IgG를 처리한 그룹과 2차 항체만 처리한 그룹을 사용하였다.
실험 결과 SNU-601에서 PR002726과 PR301839는 IgG 대조군 대비 각각 22.95배, 17.5배 강하게 결합하는 것을 확인하였다. SNU-620에서 PR002726과 PR301839는 대조군 대비 15.09배, 11.21배 강하게 결합하는 것을 확인하였다. PATU-8988s에서 PR301839는 대조군 대비 16.21배 강하게 결합하는 것을 확인하였다. 종합적으로 PR002726, PR301839 두 항체는 CLDN18.2가 발현하는 암세포에 결합 가능한 것을 확인하였다. (도 1 참조)
< 실험예 2 > In vitro 세포 독성 평가
하기 표 4에 기재된 약물 및 ADC의 암세포주에 대한 세포증식억제 활성을 측정하였다. 암세포주로 시판 중인 사람 위암 세포주 NUGC-4, SNU-601 SNU-602 및 췌장암 세포주 PATU-8988s를 사용하였고 정상세포주 HaCaT, Fa2N-4, HK-2, HS738.st/Int를 사용하였다. 약물로써, MMAE 및 SG2057을 ADC로써, 표 3의 ADC를 사용하였다. 96-웰 플레이트에 각 암세포주를 144시간 처리군은 웰당 2,500~10,000개씩 접종(seeding)하여 24시간 동안 배양한 뒤에 암 세포주에서는 약물과 ADC를 0.256 pM~100 nM (5배 연속 희석) 농도로 처리하였고 정상 세포주에서는 약물과 ADC를 2.56 pM ~ 1,000 nM (5배 연속 희석) 농도로 처리하였다. 144시간 뒤에 살아있는 세포수를 SRB (Sulforhodamine B)염료를 사용하여 정량하였고 Hs738.st/Int 세포주는 Cell titer glo를 사용하여 정량하였다.
Test samples IC50 (nM)
NUGC-4 SNU-601 SNU-620 PATU-8988s HaCaT Fa2N-4 HK-2 Hs738.st/Int
MMAE 0.29 0.51 0.71 0.145 0.14 3.0 21.9 N/D
SG2057 0.03 0.003 0.097 - - - - -
ADC1 17.11 0.028 20.2 - - - - -
ADC2 9.73 0.022 20.55 - - - - -
ADC3 6.72 0.81 18.14 2.073 32.7 365.7 >1,000 >1,000
ADC4 - 4.122 - 9.297 420.7 - - -
ADC5 - 2.278 - 27.26 562.5 - - -
NUGC-4 세포주에서는 동일 시간 반응한 세포독성 시험에서 오리스타틴 계열의 항체-약물 복합체 (ADC3)가 피롤로벤조디아제핀 계열의 항체-약물복합체 (ADC1, ADC2) 보다 동등 이상의 세포독성을 보이는 것을 확인하였다. 또한 CLDN18.2 항체의 결합 정도가 강하고, 가장 강한 세포 독성을 보인 SNU-601 세포주에서는 동일 시간 반응한 세포독성 시험에서 오리스타틴 계열의 항체-약물 복합체 (ADC3, ADC4, ADC5) 보다 피롤로벤조디아제핀 계열의 항체-약물복합체 (ADC1, ADC2)가 강한 세포독성을 보이는 것을 확인하였다. 항체가 강하게 결합하는 것으로 나타난 SNU-620 세포주에서는 두 계열의 항체-약물 복합체의 항암 효능에는 큰 차이가 없는 것을 확인하였다. 췌장암 세포주인 PATU-8988s에서 오리스타틴 계열의 항체-약물 복합체 3종의 세포독성을 비교한 결과 3종 ADC 모두 강한 세포독성을 보이는 것을 확인하였다. 정상 세포주 HaCaT, Fa2N-4, HK-2 및 Hs738.st/Int에서는 ADC1 내지 5 모두 유효용량 범위에서 세포독성을 나타내지 않았고, toxin 단독 투여시, 또는 암세포주에 투여시보다 세포독성이 현저히 줄어드는 것으로 나타났는바, 본 발명에 따른 ADC는 암세포 특이적으로 세포독성을 나타내는 것을 알 수 있었다.
<실험예 3> In vivo 효능 평가
위암 세포주 SNU-601을 세포배양 후 20,000개 세포가 담긴 PBS 100 μl에 Matrigel 100 μl를 섞은 후 Balb/c-nude 생쥐에 생착시켰다. 종양의 크기가 150 ~ 200 mm3가 되었을 때 아래의 표5, 6과 같이 항체-약물 복합체를 정맥 주사로 투여하였다.
ADC 시료의 In vivo 효능 비교 (1차)
Test sample 개체수 Dose (mg/kg) Dose interval
PBS 5 - qdx1
ADC1 5 0.2
5 0.4
ADC3 5 0.5
5 1
5 2
ADC 시료의 In vivo 효능 비교 (2차)
Test sample 개체수 Dose (mg/kg) Dose interval
PBS 5 - qdx1
ADC3 5 1
ADC4 5 2
5 4
ADC5 5 2
5 4
1차 실험결과 피롤로벤조디아제핀 계열의 항체-약물복합체 ADC1의 0.2, 0.4 mg/kg에서 모두 대조군 대비 종양 생장 억제 효능을 확인하였다. 오리스타틴 계열의 항체-약물 복합체 ADC3의 0.5, 1.0, 2.0 mg/kg에서 모두 대조군 대비 용량 의존적으로 종양 생장 억제 효능을 확인하였다. ADC 시료의 in vivo 효능 비교 실험결과(1차)는 도2에 나타낸 바와 같다.2차 실험결과에서 ADC3 1 mg/kg 그룹의 종양 생장 억제 효능은 1차실험 결과와 유사함을 확인하였다. ADC4, ADC5의 모든 용량에서 용량 의존적으로 종양 성장 억제 효능을 확인하였다. ADC 시료의 in vivo 효능 비교 실험결과(2차)는 도3에 나타낸 바와 같다.
참고문헌
Duncan, A. R., J. M. Woof, L. J. Partridge, D. R. Burton, and G. Winter.
1988. Localisation of the binding site for the human high-affinity Fc receptor
on IgG. Nature 332:563-564.
Lund, J., G. Winter, P. T. Jones, J. D. Pound, T. Tanaka, M. R. Walker, P. J. Artymiuk, Y. Arata, D. R. Burton, R. Jefferis, and J. M. Woof. 1991. Human
FcγRI and FcγRII interact with distinct but overlapping sites on human
IgG. J. Immunol. 147:2657-2662.
Sarmay, G., J. Lund, Z. Rozsnayay, J. Gergeley, and R. Jefferis. 1992. Mapping and comparison of the interaction sites on the Fc region of IgG responsible for triggering antibody dependent cellular cytotoxicity (ADCC) through different types of human Fcγ receptor. Mol. Immunol. 29:633-639.
본 발명은 클라우딘 18 아형 2를 타켓팅하는 신규한 항체-약물 접합체, 이의 활성 대사물, 이의 제조방법, 이의 용도, 및 이를 포함하는 약학 조성물을 통해, 의약분야에서 유용하게 사용될 수 있다.

Claims (54)

  1. 하기 일반식 I로 표시되는 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 I]
    Ab-[LINKER-(B)l]m
    상기 식에서,
    Ab는 중쇄 가변영역 및 경쇄 가변영역을 포함하는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
    중쇄 가변영역은 서열번호 2로 표시되는 아미노산 서열로 이루어진 중쇄 CDR1, 서열번호 4로 표시되는 아미노산 서열로 이루어진 중쇄 CDR2, 서열번호 6으로 표시되는 아미노산 서열로 이루어진 중쇄 CDR3을 포함하고,
    경쇄 가변영역은 서열번호 9로 표시되는 아미노산 서열로 이루어진 경쇄 CDR1, 서열번호 11로 표시되는 아미노산 서열로 이루어진 경쇄 CDR2, 서열번호 13으로 표시되는 아미노산 서열로 이루어진 경쇄 CDR3을 포함하며,
    LINKER는 링커이고,
    B는 활성제 모이어티이며,
    l 및 m은 각각 독립적으로 1 내지 20 중에서 선택되는 정수이며,
    l이 2 이상의 정수인 경우, B는 각각 서로 동일하거나 상이할 수 있다.
  2. 제1항에 있어서,
    중쇄 가변영역은 인간 항체의 중쇄 FR을 포함하고, 상기 중쇄 FR을 암호화하는 유전자는 배선 V 유전자 IGHV3-23(germline V gene IGHV3-23)으로부터 유래된, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  3. 제2항에 있어서,
    중쇄 FR은 서열번호 1로 표시되는 아미노산 서열로 이루어진 중쇄 FR1, 서열번호 3으로 표시되는 아미노산 서열로 이루어진 중쇄 FR2, 서열번호 5로 표시되는 아미노산 서열로 이루어진 중쇄 FR3, 서열번호 7로 표시되는 아미노산 서열로 이루어진 중쇄 FR4를 포함하는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  4. 제1항에 있어서,
    경쇄 가변영역은 인간 항체의 경쇄 FR을 포함하고, 상기 경쇄 FR을 암호화하는 유전자는 배선 V 유전자 IGKV3-11 또는 IGKV3-15로부터 유래된, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  5. 제4항에 있어서,
    경쇄 FR은 서열번호 8로 표시되는 아미노산 서열로 이루어진 경쇄 FR1;
    서열번호 10으로 표시되는 아미노산 서열로 이루어진 경쇄 FR2;
    서열번호 12로 표시되는 아미노산 서열로 이루어진 경쇄 FR3;
    서열번호 14로 표시되는 아미노산 서열로 이루어진 경쇄 FR4, 또는 서열번호 20으로 표시되는 아미노산 서열로 이루어진 경쇄 FR4를 포함하는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  6. 제1항에 있어서,
    CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편은 서열번호 15 로 표시되는 아미노산 서열; 또는 이에 대해 80%의 상동성을 갖는 아미노산 서열로 이루어진 중쇄 가변영역; 및
    서열번호 16으로 표시되는 아미노산 서열; 또는 이에 대해 80%의 상동성을 갖는 아미노산 서열로 이루어진 경쇄 가변영역을 포함하는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  7. 제1항에 있어서,
    상기 항체 또는 이의 항원 결합 단편은 단일클론 항체(monoclonal antibody), 도메인 항체(domain antibody; dAb), 단일 사슬 항체(single chain antibody; scAb), Fab 단편, Fab'단편, F(ab')2 단편, scFab 단편, Fv 단편, dsFv 단편, 단일 사슬 가변 항체(single chain variable fragment; scFv), scFv-Fc 단편, 단일 도메인 중쇄 항체(single domain heavy chain antibody), 단일 도메인 경쇄 항체(single domain light chain antibody), 항체 변이체(variant antibody), 다중 결합 항체(multimeric antibody), 미니바디, 다이아바디, 이중 특이적 항체(bispecific antibody) 및 다중 특이적 항체로 이루어진 군으로부터 선택되는 어느 하나인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  8. 제1항에 있어서,
    상기 항체와 활성제 사이의 링커는 절단 가능한 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  9. 제1항에 있어서,
    상기 접합체는 하기 일반식 IIa의 구조를 갖는 것인, 항체 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 IIa]
    Figure PCTKR2022004552-appb-img-000131
    상기 식에서,
    Ab는 중쇄 가변영역 및 경쇄 가변영역을 포함하는 CLDN18.2에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
    B‘은 각각 독립적으로 동일하거나 상이한 활성제이며,
    G 및 G'은 각각 독립적으로 글루쿠론산 모이어티(glucuronic acid moiety) 또는
    Figure PCTKR2022004552-appb-img-000132
    이고;
    상기 R3은 수소 또는 카복실 보호기이며, 상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이고;
    R1 및 R2은 각각 독립적으로 수소, C1-8 알킬 또는 C3-8 사이클로알킬이며;
    W은 각각 독립적으로 -C(O)-, -C(O)NR'-, -C(O)O-, -SO2NR'-, -P(O)R''NR'-, -SONR'- 또는 -PO2NR'-이고, 상기 C, S 또는 P는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 NR'은 L에 결합하고, 상기 R' 및 R''는 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이-C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이며;.
    Z는 각각 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 나이트로이고;
    n은 0 내지 3의 정수이며, n이 2 이상의 정수인 경우 각각의 Z는 서로 동일하거나 상이할 수 있고;
    L은 각각 독립적으로, 하기 A) 또는 B) 중 어느 하나이고:
    A) C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이며, 하기 중 하나 이상을 만족한다:
    (i) L은 하나 이상의 불포화 결합을 포함하고;
    (ii) L 내의 2개의 원자가 치환체와 같은 2가 치환체로 치환되고; 이는 헤테로아릴렌(heteroarylene)을 완성시키며;
    (iii) L은 1 내지 50 원자 헤테로알킬렌이고;
    (iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 더 치환된다;
    B) 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 하기 일반식 Ⅲ의 이소프레닐 유도체 유닛을 하나 이상 포함한다:
    [일반식 Ⅲ]
    Figure PCTKR2022004552-appb-img-000133
    ;
    m은 1 내지 20 중에서 선택되는 정수이다.
  10. 하기 일반식 IIa로 표시되는 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 IIa]
    Figure PCTKR2022004552-appb-img-000134
    상기 식에서,
    Ab는 클라우딘 18 아형 2(claudin 18 isoform 2, CLDN18.2)에 특이적으로 결합하는 항체 또는 항원 결합단편이고,
    G는 각각 독립적으로 글루쿠론산 모이어티(glucuronic acid moiety) 또는
    Figure PCTKR2022004552-appb-img-000135
    이고;
    상기 R3은 수소 또는 카복실 보호기이며, 상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기이고;
    R1 및 R2은 각각 독립적으로 수소, C1-8 알킬 또는 C3-8 사이클로알킬이며;
    W은 각각 독립적으로 -C(O)-, -C(O)NR'-, -C(O)O-, -SO2NR'-, -P(O)R''NR'-, -SONR'- 또는 -PO2NR'-이고, 상기 C, S 또는 P는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 NR'은 L에 결합하고, 상기 R' 및 R''는 각각 독립적으로 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이-C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이며;.
    Z는 각각 독립적으로 수소, C1-8 알킬, 할로겐, 시아노 또는 나이트로이고;
    n은 0 내지 3의 정수이며;
    L은 각각 독립적으로, 하기 A) 또는 B) 중 어느 하나이고:
    A) C1-50 알킬렌 또는 1-50 원자 헤테로알킬렌이며, 하기 중 하나 이상을 만족한다:
    (i) L은 하나 이상의 불포화 결합을 포함하고;
    (ii) L 내의 2개의 원자가 치환체와 같은 2가 치환체로 치환되고; 이는 헤테로아릴렌(heteroarylene)을 완성시키며;
    (iii) L은 1 내지 50 원자 헤테로알킬렌이고;
    (iv) 상기 알킬렌은 하나 이상의 C1-20 알킬로 치환된다;
    B) 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 하기 일반식 Ⅲ의 이소프레닐 유도체 유닛을 하나 이상 포함한다:
    [일반식 Ⅲ]
    Figure PCTKR2022004552-appb-img-000136
    ;
    B’는 활성제이고,
    Ab는 물결표시된 부분에 결합되고;
    l 및 m은 각각 독립적으로 1 내지 20 중에서 선택되는 정수이고,
    l이 2 이상인 경우, 활성제는 각각 동일하거나 상이할 수 있다.
  11. 제9항 또는 제10항에 있어서,
    상기 G는 각각 독립적으로
    Figure PCTKR2022004552-appb-img-000137
    이고,
    R3은 수소 또는 카복실 보호기이며,
    상기 각각의 R4는 독립적으로 수소 또는 하이드록실 보호기인 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  12. 제9항 또는 제10항에 있어서,
    상기 R1 및 R2은 모두 수소이고;
    n은 0이며;
    상기 W는 각각 독립적으로 -C(O)NR'-이고, 상기 C는 직접적으로 페닐링(phenyl ring)에 결합하며, 상기 R'은 수소, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, 모노- 또는 다이- C1-8 알킬아미노, C3-20 헤테로아릴 또는 C6-20아릴이며, NR'은 L에 결합하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  13. 제9항 또는 제10항에 있어서,
    상기 L은 질소 함유 1-5 원자 헤테로 알킬렌이고,
    상기 링커는 친수성 아미노산의 2 이상의 원자를 포함하며,
    상기 질소는 친수성 아미노산의 카르보닐과 펩타이드 결합을 형성하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  14. 제9항 또는 제10항에 있어서,
    상기 L은 티오에테르 결합에 의해 항체와 공유결합하고,
    상기 티오에테르 결합은 항체의 시스테인의 황원자를 포함하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  15. 제14항에 있어서,
    상기 항체는 이소프레노이드 트랜스퍼라제에 의하여 인식될 수 있는 아미노산 모티프를 항체의 C-말단에 포함하고,
    상기 티오에테르 결합은 상기 아미노산 모티프의 시스테인의 황원자를 포함하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  16. 제15항에 있어서,
    상기 아미노산 모티프는 CYYX 서열이고, C가 시스테인이고, Y가 지방족 아미노산이며, X가 글루타민, 글루타메이트, 세린, 시스테인, 메티오닌, 알라닌 및 루신으로 이루어진 군으로부터 선택되는 어느 하나이며; 및
    상기 티오에테르 결합은 상기 아미노산 모티프의 시스테인의 황원자를 포함하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  17. 제15항에 있어서,
    상기 아미노산 모티프는 CYYX 서열이고, Y가 알라닌, 이소루이신, 류신, 메티오닌 및 발린으로 이루어진 군으로부터 선택되는 어느 하나이거나; 또는
    CVIM 또는 CVLL 서열인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  18. 제15항에 있어서,
    아미노산 모티프에 선행하는 1 내지 20 개의 아미노산 중 적어도 하나가 글리신인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  19. 제9항 또는 제10항에 있어서,
    상기 L은 C-말단에 아미노산 서열 GGGGGGGCVIM을 포함하는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  20. 제9항 또는 제10항에 있어서,
    상기 L은 옥심을 포함하는 3 내지 50 헤테로알킬렌이고,
    상기 옥심의 산소 원자는 W와 연결된 L의 측면에 있으며,
    옥심의 탄소 원자는 Ab에 연결된 L의 측면에 있거나; 또는
    상기 옥심의 탄소 원자는 W에 연결된 L의 측면에 있으며,
    옥심의 산소 원자는 Ab에 연결된 L의 측면에 있는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  21. 제9항 또는 제10항에 있어서,
    상기 L은 옥심을 포함하고, 하나 이상의 이소프레닐 유닛은 옥심을 Ab에 공유 결합시키는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  22. 제9항 또는 제10항에 있어서,
    상기 L은 일반식 VIII 또는 일반식 IX로 표시되는 제2 유닛을 더 포함하는 것인, 항체 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 VIII]
    -(CH2)r(V(CH2)p)q-
    [일반식 IX]
    -(CH2CH2X)w-
    상기 V는 단일결합, -O-, -S-, -NR21-, -C(O)NR22-, -NR23C(O)-, -NR24SO2- 또는 -SO2NR25-이고;
    X는 -O-, C1-8 알킬렌 또는 -NR21-이고;
    R21 내지 R25는 각각 독립적으로 수소, C1-6 알킬, C1-6 알킬 C6-20 아릴 또는 C1-6 알킬 C3-20 헤테로아릴이고;
    r은 0 내지 10의 정수이고;
    p는 0 내지 10의 정수이고;
    q는 1 내지 20의 정수이고; 및
    w는 1 내지 20의 정수이다.
  23. 제22항에 있어서,
    상기 q는 1 내지 10의 정수이고;
    r 및 p는 각각 1 또는 2이며;
    V는 -O-인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  24. 제22항에 있어서,
    상기 X는 -O-이고;
    w는 1 내지 10의 정수인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  25. 제21항에 있어서,
    상기 L은
    Figure PCTKR2022004552-appb-img-000138
    또는
    Figure PCTKR2022004552-appb-img-000139
    로 표시되는 적어도 하나의 폴리에틸렌 글리콜 유닛을 포함하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  26. 제21항에 있어서,
    상기 L은 옥심을 포함하고,
    적어도 하나의 폴리에틸렌 글리콜 유닛은 옥심을 활성제에 공유 결합시키는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  27. 제9항 또는 제10항에 있어서,
    상기 L은 알카인과 아지드와의 반응, 또는 알데히드 또는 케톤 그룹과 하이드라진 또는 하이드록실아민과의 반응으로 형성되는 제3 유닛을 더 포함하는 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  28. 제9항 또는 제10항에 있어서,
    상기 L은 하기 일반식 Ⅳa, Ⅳb, Ⅳc, Ⅳd, 또는 Ⅳe로 표시되는 L 또는 제3 유닛을 더 포함하는 것을 특징으로 하는, 항체 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 Ⅳa]
    Figure PCTKR2022004552-appb-img-000140
    [일반식 Ⅳb]
    Figure PCTKR2022004552-appb-img-000141
    [일반식 Ⅳc]
    Figure PCTKR2022004552-appb-img-000142
    [일반식 Ⅳd]
    Figure PCTKR2022004552-appb-img-000143
    [일반식 Ⅳe]
    Figure PCTKR2022004552-appb-img-000144
    상기 식에서,
    상기 L1 및 L2는 각각 독립적으로 단일결합 또는 C1-30의 알킬렌이고;
    R11은 수소 또는 C1-10의 알킬이다.
  29. 제28항에 있어서,
    상기 L1 및 L2는 각각 독립적으로 단일결합; 또는 C11의 알킬렌; 또는 C12의 알킬렌인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  30. 제9항 또는 제10항에 있어서,
    이소프레노이드 트랜스퍼라제는 파네실 단백질 트랜스퍼라아제(FTase) 또는 게라닐게라닐 트랜스퍼라제(GGTase)인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  31. 제9항 또는 제10항에 있어서,
    L은 Ab에 공유 결합된 하나 이상의 분지형 링커를 포함하고,
    i) 각각의 분지형 링커는 제1 링커(PL)에 의해 Ab에 공유 결합된 제5 유닛을 포함하고;
    ii) 각각의 분지형 링커는 제1 활성제가 제2 링커 (SL) 및 절단 그룹(CG)에 의해 제5 유닛에 공유결합된 제1 분지(B1)를 포함하며; 및
    iii) 각각의 분지형 링커는 a) 제2 활성제가 제2 링커 (SL) 및 절단 그룹(CG)에 의해 제5 유닛에 공유 결합된 제2 분지 (B2); 또는 b) 폴리에틸렌 글리콜 모이어티(moiety)가 제5 유닛에 공유 결합되어 있는 제2 분지를 포함하고,
    상기 각각의 절단 그룹은 접합체부터 활성제를 방출하기 위해 가수분해되는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  32. 제31항에 있어서,
    상기 제5 유닛은
    Figure PCTKR2022004552-appb-img-000145
    ,
    Figure PCTKR2022004552-appb-img-000146
    ,
    Figure PCTKR2022004552-appb-img-000147
    또는
    Figure PCTKR2022004552-appb-img-000148
    이고,
    상기 L2, L3, 및 L4는 각각 독립적으로 직접 결합 또는 -CnH2n-이며, 상기 n은 1 내지 30의 정수이고,
    상기 G1, G2, 및 G3은 각각 독립적으로 직접 결합,
    Figure PCTKR2022004552-appb-img-000149
    ,
    Figure PCTKR2022004552-appb-img-000150
    ,
    Figure PCTKR2022004552-appb-img-000151
    또는
    Figure PCTKR2022004552-appb-img-000152
    이며,
    상기 R30은 수소 또는 C1-30 알킬이고;
    상기 R40은 수소 또는 L5-COOR6이며;
    상기 L5는 직접 결합 또는 -Cn‘H2n’-이고, 여기에서 n‘은 1 내지 10의 정수이고, R6는 수소 또는 C1-30 알킬인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  33. 제31항에 있어서,
    상기 절단 그룹은 표적 세포 내에서 절단가능하거나; 또는 하나 이상의 활성제를 방출시킬 수 있는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  34. 제33항에 있어서,
    접합체는 Ab를 포함하고;
    Ab에 공유 결합 된 1, 2, 3 또는 4개 이상의 분지형 링커를 포함하며;
    각 분지형 링커가 1 또는 2개 이상의 활성제와 결합하고;
    여기에서 활성제는 각각 동일하거나, 상이한 것인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  35. 제32항에 있어서,
    각각의 분지형 링커는 제5 유닛을 포함하고, 각각의 활성제는 2차 링커를 통해 제5 유닛에 결합하고, 상기 제5 유닛은 1차 링커에 의해 항체에 결합되는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  36. 제35항에 있어서,
    상기 제5 유닛은 아미드이고, 1차 링커는 아미드의 카르보닐을 포함하는 것이거나; 또는
    리신 유닛인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  37. 제33항에 있어서,
    하기 구조식:
    Figure PCTKR2022004552-appb-img-000153
    을 포함하고,
    상기 B‘ 및 B'’는 동일하거나 상이할 수 있는 활성제를 나타내며;
    n1 내지 n3은 각각 독립적으로 0 내지 30의 정수를 나타내고;
    AA는 아미노산 그룹을 나타내는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  38. 하기 구조식으로 표현되는, [LINKER-B] 구조를 포함하는 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    Figure PCTKR2022004552-appb-img-000154
    ,
    Figure PCTKR2022004552-appb-img-000155
    , 또는
    Figure PCTKR2022004552-appb-img-000156
    이고,
    상기 B‘ 및 B'’는 동일하거나 상이할 수 있는 활성제를 나타내고;
    m 및 n은 각각 독립적으로 0 내지 30의 정수를 나타낸다.
  39. 제9항 또는 제10항에 있어서,
    상기 활성제는 화학요법제 또는 톡신인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  40. 제9항 또는 제10항에 있어서,
    상기 활성제는 면역 조절 화합물, 항암제, 항바이러스제, 항균제, 항진균제, 항기생충제 또는 이들의 조합인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  41. 제9항 또는 제10항에 있어서,
    상기 활성제는 하기로부터 선택되는 어느 하나인, 항체 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    (a) 엘로티닙(erlotinib), 보르테조밉(bortezomib), 풀베스트란트(fulvestrant), 수텐트(sutent), 레트로졸(letrozole), 이마티닙 메실레이트(imatinib mesylate), PTK787/ZK 222584, 옥살리플라틴(oxaliplatin), 5-플루오로우라실(5-fluorouracil), 루코보린(leucovorin), 라파마이신(rapamycin), 라파티닙(lapatinib), 로나파르닙(lonafarnib), 소라페닙(sorafenib), 제피티닙(gefitinib), AG1478, AG1571, 티오테파(thiotepa), 사이클로포스파마이드(cyclophosphamide), 부술판(busulfan), 임프로술판(improsulfan), 피포술판(piposulfan), 벤조도파(benzodopa), 카르보콘(carboquone), 메츄도파(meturedopa), 유레도파(uredopa), 에틸렌이민(ethylenimine), 알트레타민(altretamine), 트리에틸렌멜라민(triethylenemelamine), 트리에틸렌포스포라미드(trietylenephosphoramide), 트리에틸렌티오포스포라미드(triethiylenethiophosphoramide), 트리메틸롤로멜라민(trimethylolomelamine), 불라타신(bullatacin), 불라타시논(bullatacinone), 캄토테신(camptothecin), 토포테칸(topotecan), 브리오스타틴(bryostatin), 칼리스타틴(callystatin), CC-1065, 아도젤레신(adozelesin), 카르젤레신(carzelesin), 비젤레신(bizelesin), 크립토피신 1(cryptophycin 1), 크립토피신 8(cryptophycin 8), 돌라스타틴(dolastatin), 듀오카마이신(duocarmycin), KW-2189, CB1-TM1, 엘루테로빈(eleutherobin), 판크라티스타틴(pancratistatin), 사르코딕티인(sarcodictyin), 스폰지스타틴(spongistatin), 클로람부실(chlorambucil), 클로르나파진(chlornaphazine), 클로로포스파미드(cholophosphamide), 에스트라무스틴(estramustine), 이포스파미드(ifosfamide), 메클로르에타민(mechlorethamine), 멜팔란(melphalan), 노벰비킨(novembichin), 페네스테린(phenesterine), 프레드니무스틴(prednimustine), 트로포스파미드(trofosfamide), 우라실 머스타드(uracil mustard), 카르무스틴(carmustine), 클로로코토신(chlorozotocin), 포테쿠스틴(fotemustine), 로무스틴(lomustine), 니무스틴(nimustine), 라니무스틴(ranimnustine), 칼리키아미신(calicheamicin), 칼리키아미신 감마 1(calicheamicin gamma 1), 칼리키아미신 오메가 1(calicheamicin omega 1), 디네미신(dynemicin), 디네미신 A(dynemicin A), 클로드로네이트(clodronate), 에스페르아미신(esperamicin), 네오카르지노스타틴크로모포어(neocarzinostatin chromophore), 아클라시노마이신(aclacinomysins), 악티노마이신(actinomycin), 안트르마이신(antrmycin), 아자세린(azaserine), 블레오마이신(bleomycins), 칵티노마이신(cactinomycin), 카라비신(carabicin), 카르니노마이신(carninomycin), 카르지노필린(carzinophilin), 크로모마이신(chromomycins), 닥티노마이신(dactinomycin), 다우노루비신(daunorubicin), 데토루부신(detorubucin), 6-디아조-5-옥소-L-노르루신(6-diazo-5-oxo-L-norleucine), 독소루비신(doxorubicin), 모르폴리노-독소루비신(morpholino-doxorubicin), 시아노모르폴리노-독소루비신(cyanomorpholino-doxorubicin), 2-피롤리노-독소루비신(2-pyrrolino-doxorubucin), 리포소말 독소루비신(liposomal doxorubicin), 데옥시독소루비신(deoxydoxorubicin), 에피루비신(epirubicin), 에소루비신(esorubicin), 마르셀로마이신(marcellomycin), 미토마이신 C(mitomycin C), 미코페놀산(mycophenolic acid), 노갈라마이신(nogalamycin), 올리보마이신(olivomycins), 페플로마이신(peplomycin), 포트피로마이신(potfiromycin), 퓨로마이신(puromycin), 쿠엘라마이신(quelamycin), 로도루비신(rodorubicin), 스트렙토미그린(streptomigrin), 스트렙토조신(streptozocin), 투베르시딘(tubercidin), 우베니멕스(ubenimex), 지노스타틴(zinostatin), 조루비신(zorubicin), 5-플루오로우라신(5-fluorouracil), 데노프테린(denopterin), 메토트렉세이트(methotrexate), 프테로프테린(pteropterin), 트리메트렉세이트(trimetrexate), 플루다라빈(fludarabine), 6-머캅토퓨린(6-mercaptopurine), 티아미프린(thiamiprine), 티구아닌(thiguanine), 안시타빈(ancitabine), 아자시티딘(azacitidine), 6-아자유리딘(6-azauridine), 카르모푸르(carmofur), 시타라빈(cytarabine), 디데옥시유리딘(dideoxyuridine), 독시플루리딘(doxifluridine), 에노시타빈(enocitabine), 플록수리딘(floxuridine), 칼루스테론(calusterone), 드로모스타놀론(dromostanolone),프로피오네이트(propionate), 에피티오스타놀(epitiostanol), 메피티오스테인(mepitiostane), 테스토락톤(testolactone), 아미노글루테티미드(aminoglutethimide), 미토테인(mitotane), 트릴로스테인(trilostane), 폴린산(folinic acid), 아세글라톤(aceglatone), 알도포스파미드 글리코사이드(aldophosphamide glycoside), 아미노레불린산(aminolevulinic acid), 에닐우라실(eniluracil), 암사크린(amsacrine), 베스트라부실(bestrabucil), 비산트렌(bisantrene), 에다트락세이트(edatraxate), 데포파민(defofamine), 데메콜신(demecolcine), 디아지콘(diaziquone), 엘포르니틴(elfornithine), 엘립티니움 아세테이트(elliptinium acetate), 에토글루시드(etoglucid), 갈리움 나이트레이트(gallium nitrate), 하이드록시우레아(hydroxyurea), 렌티난(lentinan), 로니다이닌(lonidainine), 메이탄신(maytansine), 안사미토신(ansamitocins), 미토구아존(mitoguazone), 미토잔트론(mitoxantrone), 모피단몰(mopidanmol), 니트라에린(nitraerine), 펜토스타틴(pentostatin), 페나메트(phenamet), 피라루비신(pirarubicin), 로소잔트론(losoxantrone), 2-에틸하이드라지드(2-ethylhydrazide), 프로카르바진(procarbazine), 폴리사카라이드-k(polysaccharidek), 라족세인(razoxane), 리조신(rhizoxin), 시조피란(sizofiran), 스피로게르마늄(spirogermanium), 테누아존산(tenuazonic acid), 트리아지콘(triaziquone),2,2',2''-트리클로로트리에틸아민(2,2',2''-trichlorotriethylamine), T-2 톡신, 베라큐린 A(verracurin A), 로리딘 A(roridin A), 안구이딘(anguidine), 우레탄(urethane), 빈데신(vindesine), 다카르바진(dacarbazine), 만노무스틴(mannomustine), 미토브로니톨(mitobronitol), 미토락톨(mitolactol), 피포브로만(pipobroman), 가시토신(gacytosine), 아라비노사이드(arabinoside), 사이클로포스파미드(cyclophosphamide), 티오테파(thiotepa), 파클리탁셀(paclitaxel), 파클리탁셀, 파클리탁셀의 알부민-엔지니어드 나노파티클(albumin-engineered nanoparticle formulation of paclitaxel), 도세탁셀, 클로람부실, 젬시타빈, 6-티오구아닌, 머캅토퓨린, 시스플라틴, 카보플라틴(carboplatin), 빈블라스틴(vinblastine), 플래티늄(platinum), 에토포사이드(etoposide), 이포스파미드(ifosfamide), 미톡산트론(mitoxantrone), 빈크리스틴, 비노렐빈(vinorelbine), 노반트론(novantrone), 테니포사이드(teniposide), 에다트렉세이트(edatrexate), 다우노마이신(daunomycin), 아미노프테린(aminopterin), 젤로다(xeloda), 이반드로네이트(ibandronate), CPT-11, 토포이소머라아제 저해제 RFS 2000, 디플루오로메틸오르니틴(difluoromethylornithine), 레티노산(retinoic acid), 카페시타빈(capecitabine), 또는 이의 약학적으로 허용되는 염, 용매화물 또는 산;
    (b) 모노카인(monokine), 림포카인(lympokine), 폴리펩타이드 호르몬(traditional polypeptide hormone), 부갑상선 호르몬(parathyroid hormone), 티록신(thyroxine), 릴렉신(relaxin), 프로릴렉신(prorelaxin), 당단백 호르몬(glycoprotein hormone), 여포자극호르몬(follicle stimulating hormone), 갑상샘자극호르몬(thyroid stimulating hormone), 황체형성호르몬(luteinizing hormone), 간 성장인자 섬유모세포성장인자(hepatic growth factor fibroblast growth factor), 프롤락틴(prolactin), 태반성 락토젠(placental lactogen), 종양괴사인자 (tumor necrosis factor), 종양괴사인자-α, 종양괴사인자-β, 뮐러관 억제물질(mullerian inhibiting substance), 마우스 고나도트로핀-연관 펩타이드(mouse gonadotropin associated peptide), 인히빈(inhibin), 액티빈(activin), 혈관내피증식인자(vascular endothelial growth factor), 트롬보포이에틴(thrombopoietin), 에리스로포이에틴(erythropoietin), 골유도 인자(osteoinductive factor), 인터페론, 인터페론-α, 인터페론-β, 인터페론-γ, 콜로니자극인자(colony stimulating factor, CSF), 마크로파지-CSF, 과립구-마크로파지-CSF(granulocyte-macrophage-CSF), 과립구-CSF, 인터루킨(IL), IL-1, IL-1α, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, 폴리펩타이드 인자, LIF, 키트 리간드(kit ligand), 또는 이들의 배합물;
    (c) 디프테리아 톡신, 보툴리눔 톡신, 테타누스 톡신, 디센터리 톡신, 콜레라 톡신, 아마니틴, α-아마니틴, 피롤로벤조디아제핀, 피롤로벤조디아제핀 유도체, 인돌리노벤조디아제핀, 피리디노벤조디아제핀, 테트로도톡신, 브레베톡신(brevetoxin), 시구아톡신(ciguatoxin), 리신(ricin), AM 톡신, 오리스타틴(auristatin), 투불리신(tubulysin), 겔다나마이신(geldanamycin), 메이탄시노이드(maytansinoid), 칼리케아마이신(calicheamycin), 다우노마이신(daunomycin), 독소루비신(doxorubicin), 메토트렉세이트(methotrexate), 빈데신(vindesine), SG2285, 돌라스타틴(dolastatin), 돌라스타틴유사체(dolastatin analog), 크립토피신(cryptophycin), 캄토테신(camptothecin), 리족신(rhizoxin), 리족신 유도체(rhizoxin derivatives), CC-1065, CC-1065 유사체 또는 유도체, 듀오카마이신(duocarmycin), 에네다인 항생제(enediyne antibiotic), 에스페라마이신(esperamicin), 에포틸론(epothilone), 톡소이드(toxoid), 또는 이들의 배합물;
    (d) 친화성 리간드(affinity ligand), 여기에서 친화성 리간드는 기질, 저해제, 활성화제, 신경전달물질, 방사성 동위원소, 또는 이들의 배합물;
    (e) 방사능표지(radioactive label), 32P, 35S, 형광다이, 전자밀도 반응제(electron dense reagent), 효소, 비오틴, 스트렙타비딘(streptavidin), 디옥시제닌(dioxigenin), 햅텐(hapten), 면역성 단백질(immunogenic protein), 타겟에 컴플러멘터리한 서열을 갖는 핵산 분자(nucleic acid molecule with a sequence complementary to a target) 또는 이들의 배합물;
    (f) 면역조절 화합물(immunomodulatory compound), 항-암제(anti-cancer agent), 항-바이러스제(anti-viral agent), 항-박테리아제(anti-bacterial agent), 항-곰팡이제(anti-fungal agent), 및 항-기생충제(anti-parasitic agent), 또는 이들의 배합물;
    (g) 타목시펜(tamoxifen), 랄록시펜(raloxifene), 드롤록시펜(droloxifene), 4-하이드록시타목시펜(4-hydroxytamoxifen), 트리옥시펜(trioxifene), 케옥시펜(keoxifene), LY117018, 오나프리스톤(onapristone) 또는 토레미펜(toremifene);
    (h) 4(5)-이미다졸, 아미노글루테티미드(aminoglutethimide), 메제스톨 아세테이트(megestrol acetate), 엑스메스탄(exemestane), 레트로졸(letrozole), 또는 아나스트로졸(anastrozole)
    (i) 플루타미드(flutamide), 닐루타미드(nilutamide), 비칼루타미드(bicalutamide), 리우프롤라이드(leuprolide), 고세렐린(goserelin), 또는 트록사시타빈(troxacitabine);
    (j) 아로마타아제 저해제;
    (k) 단백질 키나아제 저해제;
    (l) 리피드 키나아제 저해제;
    (m) 안티센스 올리고뉴클레오티드;
    (n) 리보자임;
    (o) 백신; 및
    (p) 항-맥관형성제(anti-angiogenic agent).
  42. 제1항에 있어서,
    상기 활성제는 피롤로벤조디아제핀 다이머이고;
    상기 피롤로벤조디아제핀 다이머는 N10 위치에서 X 또는 N'10 위치에서 X '로 치환되고, 여기서 X 또는 X'는 피롤로벤조디아제핀 다이머를 링커에 연결하며;
    X 및 X'는 각각 독립적으로 -C(O)O-*, -또는 -C(O)-*이고;
    *는 피롤로벤조디아제핀 다이머와 링커 사이의 결합 지점인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  43. 제42항에 있어서,
    상기 피롤로벤조디아제핀 다이머는 하기 일반식 X 또는 일반식 XI로 표현되는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물:
    [일반식 X]
    Figure PCTKR2022004552-appb-img-000157
    상기 식에서,
    상기 점선은 C1과 C2 사이, C2와 C3 사이, C'1과 C'2 사이, 또는 C'2과 C'3 사이의 이중 결합의 선택적 존재를 나타내며;
    RX1 및 RX1'는 각각 독립적으로 H, OH, =O, =CH2, CN, Rm, ORm, =CH-Rm, =C(Rm')2, OSO2-Rm, CO2Rm, CORm, 할로 또는 디할로로부터 선택되고;
    RX2, RX2' RX3, 및 RX3'는 각각 독립적으로 H, Rm, OH, ORm, NRm 2, NO2, 및 할로로부터 선택되며;
    RX4 및 RX4'는 각각 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, 할로, 및 C1-6 알킬로부터 선택되고;
    RX5 및 RX5'는 각각 독립적으로 H, Rm, OH, ORm, SH, SRm, NH2, NHRm, NRm 2, -NRmRm', NO2, -NRmC(O)Rm‘, -NRmC(O)ORm‘, -NRmC(O)NRmRm‘, -S(O)Rm, -S(O)2Rm, -S(O)NRmRm', -S(O)2NRmRm', -NRmS(O)Rm', -NRmS(O)2Rm', -P(O)Rm, -P(O)2Rm, -P(O)NRmRm', -P(O)2NRmRm', -NRmP(O)Rm', -NRmP(O)2Rm', 및 할로로부터 선택되며;
    Y 및 Y'는 각각 독립적으로 O, S, 또는 N(H)이고;
    RX6는 독립적으로 C3-12 알킬렌, C3-12 알케닐렌, 또는 C3-12 헤테로알킬렌이며; RX6은 -NH2, -NHRm, -NHC(O)Rm, -NHC(O)CH2-[OCH2CH2]n-RXX, 또는 -[CH2CH2O]n-RXX로 치환되거나 비치환되고;
    상기 RXX는 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 시클로알킬, C1-8 알콕시, C1-8 알킬 티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디-C1-8 알킬아미노이고, 여기에서 n은 1 내지 6의 정수이며;
    RX7 및 RX7'는 각각 독립적으로 H, C1-6 알킬, C2-6 알케닐, C2-6 알키닐, -C(O)Rr, -C(O)ORs 또는 -C(O)NRrRr'이고;
    Rr, Rr', 및 Rs는 각각 독립적으로 H, C1-7 알킬, C2-7 알케닐, C2-7 알키닐, C3-13 사이클로알킬, 3 내지 7-원 헤테로사이클로알킬, C5-10 아릴 또는 5 내지 7-원 헤테로아릴로이며;
    각 Rm'는 독립적으로 Rm, CO2Rm, CORm, CHO, CO2H, 및 할로로부터 선택되며,
    각 Rm은 독립적으로 H, OH, C1-12 알킬, C1-12 알콕시, C2-12 알케닐, C2-12 알키닐, C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴로 이루어진 군으로부터 선택되고, 여기에서 C5-20 아릴, C5-20 헤테로아릴, C3-6 사이클로알킬, 3 내지 7-원 헤테로사이클릴, 3 내지 7-원 헤테로사이클로알킬, 및 5 내지 7-원 헤테로아릴의 하나 이상의 수소원자는 OH, =O, C1-12 알킬, 또는 C1-12 알콕시로 치환될 수 있다.
  44. 제43항에 있어서,
    상기 RX1 및 RX1'는 각각 독립적으로 =CH2; C1-6 알킬; C1-6 알콕시; C2-6 알케닐; C5-7 아릴; C3-6 헤테로아릴; 또는 C1-6 알킬, 또는 C1-6 알콕시로 치환된 C5-7 아릴로부터 선택되는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  45. 제43항에 있어서,
    상기 RX2, RX2', RX3, 및 RX3'은 각각 독립적으로 H 또는 OH로부터 선택되는, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  46. 제43항에 있어서,
    RX5, 및 RX5'은 각각 독립적으로 H, OH, -S(O)Rm, S(O)2Rm, -P(O)Rm, 및 -P(O)2Rm로 이루어진 군에서 선택되고, 여기에서 Rm은 H, OH, C1-12 알킬, C1-12 알콕시, C2-12 알케닐, 또는 C2-12 알키닐인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  47. 제43항에 있어서,
    상기 RX4 및 RX4'는 각각 독립적으로 C1-6 알콕시인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  48. 제43항에 있어서,
    상기 Y 및 Y'는 O인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  49. 제43항에 있어서,
    RX6는 C3-12 알킬렌, C3-12 알케닐렌 또는 C3-12 헤테로알킬렌이고, 상기 RX6은 -NH2, -NHRm, -NHC(O)Rm, -NHC(O)CH2-[OCH2CH2]n-RXX, 또는 -[CH2CH2O]n-RXX로 치환되며;
    상기 RXX는 H, OH, N3, CN, NO2, SH, NH2, ONH2, NHNH2, 할로, C1-8 알킬, C3-8 사이클로알킬, C1-8 알콕시, C1-8 알킬티오, C3-20 헤테로아릴, C5-20 아릴 또는 모노- 또는 디-C1-8 알킬 아미노이고; 및
    n은 1 내지 6의 정수인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  50. 제1항 또는 제10항에 있어서,
    상기 [Linker-(B)l]는, 다음 구조식:
    Figure PCTKR2022004552-appb-img-000158
    ,
    Figure PCTKR2022004552-appb-img-000159
    ,
    Figure PCTKR2022004552-appb-img-000160
    ,
    Figure PCTKR2022004552-appb-img-000161
    ,
    Figure PCTKR2022004552-appb-img-000162
    ,
    Figure PCTKR2022004552-appb-img-000163
    ,
    Figure PCTKR2022004552-appb-img-000164
    ,
    Figure PCTKR2022004552-appb-img-000165
    ,
    Figure PCTKR2022004552-appb-img-000166
    ,
    Figure PCTKR2022004552-appb-img-000167
    ,
    Figure PCTKR2022004552-appb-img-000168
    ,
    Figure PCTKR2022004552-appb-img-000169
    ,
    Figure PCTKR2022004552-appb-img-000170
    ,
    Figure PCTKR2022004552-appb-img-000171
    ,
    Figure PCTKR2022004552-appb-img-000172
    ,
    Figure PCTKR2022004552-appb-img-000173
    ,
    Figure PCTKR2022004552-appb-img-000174
    ,
    Figure PCTKR2022004552-appb-img-000175
    ,
    Figure PCTKR2022004552-appb-img-000176
    ,
    Figure PCTKR2022004552-appb-img-000177
    ,
    Figure PCTKR2022004552-appb-img-000178
    ,
    Figure PCTKR2022004552-appb-img-000179
    ,
    Figure PCTKR2022004552-appb-img-000180
    ,
    Figure PCTKR2022004552-appb-img-000181
    ,
    Figure PCTKR2022004552-appb-img-000182
    ,
    Figure PCTKR2022004552-appb-img-000183
    ,
    Figure PCTKR2022004552-appb-img-000184
    ,
    Figure PCTKR2022004552-appb-img-000185
    , 및
    Figure PCTKR2022004552-appb-img-000186
    로 이루어진 군에서 선택되고,
    여기에서, MMAE는 모노메틸 오리스타틴 E(monomethyl auristatin E)이며,
    MMAF는 모노메틸 오리스타틴 F(monomethyl auristatin F)인, 접합체 또는 이의 약학적으로 허용되는 염 또는 이의 용매화물.
  51. 제1항 또는 제10항의 접합체를 포함하는 과증식, 암 또는 혈관신생질환의 예방 또는 치료용 약학적 조성물.
  52. 제51항에 있어서,
    추가적으로 약학적으로 유효한 양의 화학 치료제(chemotherapeutic agent)를 포함하는, 약학적 조성물.
  53. 제51항에 있어서,
    상기 암은 폐암, 소세포성 폐암, 위장관암, 대장암, 장암, 유방암, 난소암, 전립선암, 고환암, 간암, 신장암, 방광암, 췌장암, 뇌암, 육종, 골육종, 카포시 육종 및 흑색종으로 이루어진 군으로부터 선택되는 어느 하나인, 약학적 조성물.
  54. 제1항 또는 제10항의 접합체, 및 약제학적으로 허용되는 담체를 포함하는, 주사제, 정제, 환제, 산제, 과립제, 캡슐제, 트로키제, 현탁제, 내용액제, 유제, 시럽제, 유제, 동결건조제제, 및 좌제로 이루어진 군으로부터 선택되는, 약학 제제.
PCT/KR2022/004552 2021-03-30 2022-03-30 인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도 WO2022211508A1 (ko)

Priority Applications (8)

Application Number Priority Date Filing Date Title
AU2022250810A AU2022250810A1 (en) 2021-03-30 2022-03-30 Antibody-drug conjugate including antibody against human cldn18.2, and use thereof
EP22781627.9A EP4321180A1 (en) 2021-03-30 2022-03-30 Antibody-drug conjugate including antibody against human cldn18.2, and use thereof
CA3213985A CA3213985A1 (en) 2021-03-30 2022-03-30 Antibody-drug conjugate including antibody against human cldn18.2, and use thereof
BR112023020093A BR112023020093A2 (pt) 2021-03-30 2022-03-30 Conjugado anticorpo-fármaco, incluindo anticorpo contra cldn18.2 humano, e uso do mesmo
IL307301A IL307301A (en) 2021-03-30 2022-03-30 An antibody-drug conjugate including an antibody against human CLDN18.2 and its use
CN202280026360.1A CN117279663A (zh) 2021-03-30 2022-03-30 一种包括针对人cldn18.2的抗体的抗体药物偶联物及其用途
US18/285,194 US20240131178A1 (en) 2021-03-30 2022-03-30 Antibody-drug conjugate including antibody against human cldn18.2, and use thereof
JP2023555736A JP2024515934A (ja) 2021-03-30 2022-03-30 ヒトｃｌｄｎ１８．２に対する抗体を含む抗体－薬物コンジュゲートおよびその使用

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2021-0041447 2021-03-30
KR20210041447 2021-03-30

Publications (1)

Publication Number Publication Date
WO2022211508A1 true WO2022211508A1 (ko) 2022-10-06

Family

ID=83459705

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/004552 WO2022211508A1 (ko) 2021-03-30 2022-03-30 인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도

Country Status (10)

Country Link
US (1) US20240131178A1 (ko)
EP (1) EP4321180A1 (ko)
JP (1) JP2024515934A (ko)
KR (1) KR20220136267A (ko)
CN (1) CN117279663A (ko)
AU (1) AU2022250810A1 (ko)
BR (1) BR112023020093A2 (ko)
CA (1) CA3213985A1 (ko)
IL (1) IL307301A (ko)
WO (1) WO2022211508A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023194800A1 (en) * 2022-04-06 2023-10-12 Legochem Biosciences, Inc. Antibody-drug conjugate comprising antibody against human trop2 and use thereof

Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880935A (en) 1986-07-11 1989-11-14 Icrf (Patents) Limited Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates
US5122368A (en) 1988-02-11 1992-06-16 Bristol-Myers Squibb Company Anthracycline conjugates having a novel linker and methods for their production
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
US5824805A (en) 1995-12-22 1998-10-20 King; Dalton Branched hydrazone linkers
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
KR20140035393A (ko) 2011-05-08 2014-03-21 주식회사 레고켐 바이오사이언스 단백질-활성제 접합체 및 이의 제조 방법
KR101628872B1 (ko) 2014-05-28 2016-06-09 주식회사 레고켐 바이오사이언스 자가-희생 기를 포함하는 화합물
WO2017089895A1 (en) 2015-11-25 2017-06-01 Legochem Biosciences, Inc. Antibody-drug conjugates comprising branched linkers and methods related thereto
WO2017089890A1 (en) 2015-11-25 2017-06-01 Legochem Biosciences, Inc. Conjugates comprising self-immolative groups and methods related thereto
KR20180110645A (ko) 2017-03-29 2018-10-10 주식회사 레고켐 바이오사이언스 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물
WO2019242505A1 (zh) * 2018-06-17 2019-12-26 上海健信生物医药科技有限公司 靶向cldn18.2的抗体、双特异性抗体、adc和car及其应用

Patent Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4880935A (en) 1986-07-11 1989-11-14 Icrf (Patents) Limited Heterobifunctional linking agents derived from N-succinimido-dithio-alpha methyl-methylene-benzoates
US5122368A (en) 1988-02-11 1992-06-16 Bristol-Myers Squibb Company Anthracycline conjugates having a novel linker and methods for their production
US5622929A (en) 1992-01-23 1997-04-22 Bristol-Myers Squibb Company Thioether conjugates
US6214345B1 (en) 1993-05-14 2001-04-10 Bristol-Myers Squibb Co. Lysosomal enzyme-cleavable antitumor drug conjugates
US5824805A (en) 1995-12-22 1998-10-20 King; Dalton Branched hydrazone linkers
KR20140035393A (ko) 2011-05-08 2014-03-21 주식회사 레고켐 바이오사이언스 단백질-활성제 접합체 및 이의 제조 방법
KR101628872B1 (ko) 2014-05-28 2016-06-09 주식회사 레고켐 바이오사이언스 자가-희생 기를 포함하는 화합물
WO2017089895A1 (en) 2015-11-25 2017-06-01 Legochem Biosciences, Inc. Antibody-drug conjugates comprising branched linkers and methods related thereto
WO2017089890A1 (en) 2015-11-25 2017-06-01 Legochem Biosciences, Inc. Conjugates comprising self-immolative groups and methods related thereto
KR20180079452A (ko) * 2015-11-25 2018-07-10 주식회사 레고켐 바이오사이언스 자기-희생기를 포함하는 접합체 및 이의 제조방법
KR20180110645A (ko) 2017-03-29 2018-10-10 주식회사 레고켐 바이오사이언스 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물
KR20180110649A (ko) * 2017-03-29 2018-10-10 주식회사 레고켐 바이오사이언스 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물
WO2019242505A1 (zh) * 2018-06-17 2019-12-26 上海健信生物医药科技有限公司 靶向cldn18.2的抗体、双特异性抗体、adc和car及其应用

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
DISCOVERY MEDICINE, vol. 10, no. 53, 2010, pages 329 - 39
DUBOWCHIKWALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123
DUNCAN, A. R.J. M. WOOFL. J. PARTRIDGED. R. BURTONG. WINTER: "Localisation of the binding site for the human high-affinity Fc receptoron IgG", NATURE, vol. 332, 1988, pages 563 - 564
GUOYUN ZHU, FOLETTI DAVIDE, LIU XIAOHUI, DING SHENG, MELTON WITT JODY, HASA-MORENO ADELA, RICKERT MATHIAS, HOLZ CHARLES, ASCHENBRE: "Targeting CLDN18.2 by CD3 Bispecific and ADC Modalities for the Treatments of Gastric and Pancreatic Cancer", SCIENTIFIC REPORTS, vol. 9, no. 1, 1 January 2019 (2019-01-01), pages 1 - 11, XP055630964, DOI: 10.1038/s41598-019-44874-0 *
JEFFERY ET AL., BIOCONJUG CHEM., vol. 17, no. 3, 2006, pages 832 - 40
JOHNSON ET AL., ANTICANCER RES, vol. 15, 1995, pages 1387 - 93
JOONG-JAE LEE, HYO-JUNG CHOI, MISUN YUN, YINGJIN KANG, JI-EUN JUNG, YISEUL RYU, TAE YOON KIM, YOUNG-JE CHA, HYUN-SOO CHO, JUNG-JOO: "Enzymatic Prenylation and Oxime Ligation for the Synthesis of Stable and Homogeneous Protein-Drug Conjugates for Targeted Therapy", ANGEWANDTE CHEMIE INTERNATIONAL EDITION, VERLAG CHEMIE, vol. 54, no. 41, 5 October 2015 (2015-10-05), pages 12020 - 12024, XP055385290, ISSN: 1433-7851, DOI: 10.1002/anie.201505964 *
KOLODYCH ET AL., EUR J MED CHEM., vol. 142, 15 December 2017 (2017-12-15), pages 376 - 382
LAU ET AL., BIOORG-MED-CHEM., vol. 3, no. 10, 1995, pages 1305 - 1304
LUND, J.G. WINTERP. T. JONESJ. D. POUNDT. TANAKAM. R. WALKERP. J. ARTYMIUKY. ARATAD. R. BURTONR. JEFFERIS: "Human FcγRl and FcγRll interact with distinct but overlapping sites on human IgG", J. IMMUNOL., vol. 147, 1991, pages 2657 - 2662
NEVILLE ET AL., BIOL. CHEM., vol. 264, 1989, pages 14653 - 14661
SARMAY, G.J. LUNDZ. ROZSNAYAYJ. GERGELEYR. JEFFERIS: "Mapping and comparison of the interaction sites on the Fc region of IgG responsible for triggering antibody dependent cellular cytotoxicity (ADCC) through different types of human Fc receptor", MOL. IMMUNOL., vol. 29, 1992, pages 633 - 639, XP023683016, DOI: 10.1016/0161-5890(92)90200-H
THORPE ET AL., CANCER RES, vol. 47, 1987, pages 5924 - 5931

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023194800A1 (en) * 2022-04-06 2023-10-12 Legochem Biosciences, Inc. Antibody-drug conjugate comprising antibody against human trop2 and use thereof

Also Published As

Publication number Publication date
US20240131178A1 (en) 2024-04-25
IL307301A (en) 2023-11-01
CN117279663A (zh) 2023-12-22
AU2022250810A1 (en) 2023-11-09
JP2024515934A (ja) 2024-04-11
CA3213985A1 (en) 2022-10-06
KR20220136267A (ko) 2022-10-07
EP4321180A1 (en) 2024-02-14
BR112023020093A2 (pt) 2023-11-14

Similar Documents

Publication Publication Date Title
WO2015182984A1 (ko) 자가-희생 기를 포함하는 화합물
WO2020180121A1 (ko) 인간 dlk1에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도
WO2018182341A1 (ko) 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물
EP3423104B1 (en) Amanitin conjugates
JP6021963B2 (ja) クロスリンカーおよびそれらの使用
CN104822656B (zh) 自稳定接头偶联物
US6214345B1 (en) Lysosomal enzyme-cleavable antitumor drug conjugates
WO2013125891A1 (ko) 시스테인 잔기를 포함하는 모티프가 결합된 변형항체, 상기 변형항체를 포함하는 변형항체-약물 접합체 및 그 제조방법
WO2010126178A1 (ko) 신규한 클로린 e6-엽산 결합 화합물, 이의 제조방법 및 이를 함유하는 암 치료용 약학적 조성물
WO2020184944A1 (ko) 위치특이적 항체 콘쥬게이션 및 이의 구체예로서의 항체-약물 콘쥬게이트
WO2022211508A1 (ko) 인간 cldn18.2에 대한 항체를 포함하는 항체 약물 접합체 및 이의 용도
WO2018174544A2 (ko) Muc1에 특이적으로 결합하는 항체 및 그의 용도
WO2021137646A1 (ko) 피롤로벤조디아제핀 유도체 및 이의 리간드-링커 접합체
WO2020153774A1 (ko) 항체-페이로드 컨쥬게이트 제조용 화합물, 이의 용도
WO2018124758A2 (ko) 베타-갈락토사이드가 도입된 자가-희생 기를 포함하는 화합물
WO2020141923A9 (ko) 안전성이 향상된 피롤로벤조디아제핀 이량체 화합물 및 이의 용도
WO2020222573A1 (ko) 트리스 구조를 가지는 링커를 포함하는 리간드-약물 접합체
WO2021201654A1 (ko) Glp-2 유도체 또는 이의 지속형 결합체를 포함하는 방사선요법, 화학요법, 또는 이들의 조합으로 유발된 점막염의 예방 또는 치료용 약학적 조성물
WO2021194298A1 (ko) 약물 이합체를 포함하는 나노입자 및 이의 용도
WO2022031150A1 (ko) 데옥시사이티딘계 항암제 및 실릴 에테르 함유 링커를 포함하는 접합체 및 이의 용도
WO2022245186A1 (ko) Ror1 및 b7-h3에 결합하는 항체-약물 접합체 및 그 용도
WO2010126179A1 (ko) 클로린 e6-엽산 결합 화합물 및 키토산을 함유하는 암 치료용 약학적 조성물
WO2022149837A1 (ko) 항-fgfr3 항체 및 이의 용도
WO2021101349A1 (ko) Ror1 및 b7-h3에 결합하는 항체, 이를 포함하는 항체-약물 접합체 및 그 용도
WO2023163536A1 (ko) 신규 항체 약물 접합체

Legal Events

Date Code Title Description
DPE2 Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101)
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22781627

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2023555736

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 307301

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 3213985

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 202280026360.1

Country of ref document: CN

Ref document number: MX/A/2023/011507

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 18285194

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023020093

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 804952

Country of ref document: NZ

Ref document number: AU2022250810

Country of ref document: AU

Ref document number: 2022250810

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2023127619

Country of ref document: RU

Ref document number: 2022781627

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022250810

Country of ref document: AU

Date of ref document: 20220330

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022781627

Country of ref document: EP

Effective date: 20231030

ENP Entry into the national phase

Ref document number: 112023020093

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231002