WO2022197961A1 - Methods of administering long-acting growth hormone polypeptides - Google Patents

Methods of administering long-acting growth hormone polypeptides Download PDF

Info

Publication number
WO2022197961A1
WO2022197961A1 PCT/US2022/020804 US2022020804W WO2022197961A1 WO 2022197961 A1 WO2022197961 A1 WO 2022197961A1 US 2022020804 W US2022020804 W US 2022020804W WO 2022197961 A1 WO2022197961 A1 WO 2022197961A1
Authority
WO
WIPO (PCT)
Prior art keywords
subject
long
rhgh
dose level
week
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/020804
Other languages
English (en)
French (fr)
Inventor
Jóse Francisco CARA
Aleksandra Pastrak
Srinivas Rao VALLURI
Michael Paul WAJNRAJCH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Opko Biologics Ltd
Pfizer Inc
Original Assignee
Opko Biologics Ltd
Pfizer Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Opko Biologics Ltd, Pfizer Inc filed Critical Opko Biologics Ltd
Priority to AU2022238386A priority Critical patent/AU2022238386A1/en
Priority to IL305661A priority patent/IL305661A/en
Priority to MX2023010997A priority patent/MX2023010997A/es
Priority to CN202280033510.1A priority patent/CN117425490A/zh
Priority to US18/282,844 priority patent/US20240166710A1/en
Priority to EP22772229.5A priority patent/EP4308151A4/en
Priority to BR112023018980A priority patent/BR112023018980A2/pt
Priority to CA3214273A priority patent/CA3214273A1/en
Priority to KR1020237035239A priority patent/KR20230171936A/ko
Publication of WO2022197961A1 publication Critical patent/WO2022197961A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/61Growth hormone [GH], i.e. somatotropin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/27Growth hormone [GH], i.e. somatotropin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00Drugs for disorders of the endocrine system
    • A61P5/06Drugs for disorders of the endocrine system of the anterior pituitary hormones, e.g. TSH, ACTH, FSH, LH, PRL, GH
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/575Hormones
    • G01N2333/65Insulin-like growth factors (Somatomedins), e.g. IGF-1, IGF-2
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • the present disclosure relates the use of a long-acting recombinant human growth hormone for treatment of growth hormone-related disorders such as, for example, growth hormone deficiency, and the growth failure seen in children bom small for gestational age, Turner syndrome and idiopathic short stature.
  • growth hormone-related disorders such as, for example, growth hormone deficiency, and the growth failure seen in children bom small for gestational age, Turner syndrome and idiopathic short stature.
  • Polypeptides are susceptible to denaturation or enzymatic degradation in the blood, liver, or kidney. Accordingly, polypeptides typically have short circulatory half-lives of several hours. Because of their low stability, peptide drugs are usually delivered in a sustained frequency so as to maintain an effective plasma concentration of the active peptide. Moreover, since peptide drugs are usually administered by infusion, frequent injection of peptide drugs causes considerable discomfort to a subject.
  • Serum half-life is an empirical characteristic of a molecule and must be determined experimentally for each new potential drug.
  • physiological clearance mechanisms such as renal filtration can make the maintenance of therapeutic levels of a drug unfeasible because of cost or frequency of the required dosing regimen.
  • a long serum half-life is undesirable where a drug or its metabolites have toxic side effects.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; and iii) administering the long-acting rhGH to the subject at a modified dose level wherein the modified dose level is about 15% lower than the initial dose level.
  • a subject with an SDS >+ 2 is a subject whose serum IGF-1 concentration exceeds the mean reference value for their age and sex by more than 2 SDS.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level of about 0.66 mg per kg body weight per week; ii) taking at least two measurements of an IGF-1 level in the subject at day 3 to day 4 after administering the long- acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; iii) administering the long- acting rhGH to the subject at a modified dose level, wherein the modified dose level is 15% lower than the initial dose level; iv) taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level has a SDS of >
  • SDS standard deviation score
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level; ii) taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of > +1.5 or ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level when the IGF-1 level is the subject has an SDS value of > +1.5, or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level when the IGF-1 level in the subject has an SDS of ⁇ -0.5.
  • rhGH human growth hormone
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking at least one measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5 or > +1.5; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5 or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in
  • rhGH human growth hormone
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level; ii) monitoring the subject for an adverse event; iii) administering the long-acting rhGH to the subject at a modified dose level wherein the modified dose level is 25% lower than the initial dose level if the adverse event is moderate, or wherein the modified dose level is 50% lower than the initial dose level if the adverse event is severe.
  • rhGH human growth hormone
  • the present teachings provide methods of treating growth hormone deficiency in a first subject in need thereof, the method comprising: selecting a first subject with growth hormone deficiency, wherein the first subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the first subject, so that efficacy of the long-acting rhGH in the first subject is comparable to efficacy of the long-acting rhGH in a second subject who has previously received only the long- acting rhGH and has not previously received the once daily rhGH therapy.
  • a once daily rhGH is somatropin, somatrem, a somatropin biosimilar, or a somatrem biosimilar.
  • a use of a long-acting recombinant human growth hormone (long-acting rhGH) for treating growth hormone deficiency in a first subject in need thereof comprising: selecting a first subject with growth hormone deficiency, wherein the first subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of the long-acting rhGH to the first subject, so that efficacy of the long-acting rhGH in the first subject is comparable to efficacy of the long-acting rhGH in a second subject who has previously received only the long-acting rhGH and has not previously received the once daily rhGH therapy.
  • long-acting rhGH human growth hormone
  • a long-acting recombinant human growth hormone for treating growth hormone deficiency in a subject in need thereof, the use comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly, wherein a bone maturation rate of the subject previously on the once daily recombinant human growth hormone is comparable to a bone maturation rate of the subject while on the once daily recombinant treatment.
  • a method of treating growth hormone deficiency in a subject in need thereof comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly, wherein a bone maturation rate of the subject previously on the once daily recombinant human growth hormone is comparable to a bone maturation rate of the subject while on the once daily recombinant treatment.
  • a method of treating growth hormone deficiency in a subject in need thereof comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly, wherein a bone matur
  • FIG. 1 depicts the study design for the open-label extension of a clinical trial study of once weekly somatrogon vs. daily Genotropin® in pediatric patients with growth hormone deficiency.
  • OLE open-label extension
  • PEN somatrogon delivery via prefilled pen device
  • R randomization.
  • FIG. 2 depicts a bar graph summarizing height SDS and cumulative delta height SDS for each year of the study (all cohorts combined).
  • X-axis Mean cumulative delta height SDS + SD and Mean Height SDS + SD. Dark bars below: Mean height SDS + SD. Lighter bars above: Mean cumulative delta height SDS + SD.
  • FIG. 3 depicts a bar graph summarizing data from the QoLISSY-CHILD survey: mean change from BL to 12 months, children aged > 7 years.
  • BL baseline;
  • QoL quality of life;
  • QoLISSY Quality of Life in Short Stature Teen.
  • FIG. 4 depicts a bar graph summarizing data from the QoLISSY-PARENT survey: mean change from BL to 12 months, children aged > 7 years.
  • BL baseline;
  • QoL quality of life;
  • QoLISSY Quality of Life in Short Stature Teen.
  • FIG. 5 depicts a bar graph summarizing data from the QoLISSY-CHILD survey: BL (B) and 12 month (M12) scores, children aged > 7 years.
  • QoL quality of life
  • QoLISSY Quality of Life in Short Stature Teen.
  • FIG. 6 depicts a bar graph summarizing data from the QoLISSY-PARENT survey: BL (B) and 12 month (M12) scores, children aged > 7 years.
  • QoL quality of life
  • QoLISSY Quality of Life in Short Stature Teen.
  • FIG. 7 depicts a schematic summarizing overall life interference total scores (DCOA 1). Box shows interquartile range (IQR); whiskers include observed values within 1.5x IQR from the box edges. a Number of participants with non-missing values.
  • FIG. 8 depicts a diagram summarizing data from the patient and caregiver assessment of treatment experience (DCOA 1).
  • FIG. 9 depicts a diagram summarizing data from the DCOA 2 questionnaire. * “Does not favor somatrogon” includes Genotropin® and No preference/No difference.
  • FIG. 10 depicts a box plot of height velocity over time (full analysis set). Baseline defined as the last non-missing measurement prior to the start of study drug. Somatrogon data is indicated by a circle. Genotropin® data is indicated by a square.
  • FIG. 11 depicts a box plot of IGF-1 SDS over time. Somatrogon data is indicated by a circle. Genotropin® data is indicated by a square.
  • FIG. 12 depicts graphs summarizing deconvoluted, zero-change mass spectral data of intact somatrogon from Process C-Rentschler Biotpharma (PRC-RB) and Process C-Grange Castle (PRC-GC) materials.
  • FIG. 13 depicts a Phase 3 study design (top panel) and subject disposition in a Phase 3 study (bottom panel).
  • FIG. 14 depicts subgroup analyses for the primary endpoint of height velocity at month 12.
  • Region 1 includes Western Europe, Israel, Greece, Australia, New Zealand, Canada, and USA.
  • Region 2 includes Central and Eastern Europe, Turkey, Latin America and Asia except for India and Vietnam.
  • Region 3 includes India and Vietnam. a Number of participants with non-missing values.
  • FIG. 15 depicts a summary of height velocity (cm/year) (top panel) and height SDS over time. Somatrogon data is indicated by a circle. Genotropin® data is indicated by a square. [032] FIG. 16 depicts IGF-1 SDS over time. Somatrogon data is indicated by a circle. Genotropin® data is indicated by a square.
  • the subject use, methods, and therapeutic regimens involve administration of a long-acting recombinant human growth hormone (rhGH).
  • rhGH human growth hormone
  • the subject use and therapeutic regimens can be used in the treatment of growth deficiency disorders.
  • a dosage of about 50 milligrams per kilogram refers to a range of 45 to 55 mg/kg.
  • active ingredient refers to a polypeptide sequence of interest, which is accountable for the biological effect.
  • an active ingredient is a long-acting rhGH.
  • an active ingredient is somatrogon, that is, a polypeptide comprising the amino acid sequence of SEQ ID NO:2.
  • an active ingredient is a once daily rhGH, e.g., Genotropin®.
  • the term “between” refers to a numerical range that is inclusive of the two endpoint values of the numerical range. For example, a range that is “between 12 to 18” is inclusive of the endpoint values 12 and 18.
  • the term “comparable” refers to two or more agents, entities, situations, sets of conditions, etc., that may not be identical to one another but that are sufficiently similar to permit comparison therebetween so that one skilled in the art will appreciate that conclusions may reasonably be drawn based on differences or similarities observed.
  • comparable sets of conditions, circumstances, individuals, or populations are characterized by a plurality of substantially identical features and one or a small number of varied features. Those of ordinary skill in the art will understand, in context, what degree of identity is required in any given circumstance for two or more such agents, entities, situations, sets of conditions, etc. to be considered comparable.
  • SDS standard derivation score
  • LS modified least squares
  • estimated SDS profiles over a dosing interval is calculated according to Fisher et al, Horm. Res. Paediatr. (2017) 87(5):324-332.
  • a dosing regimen refers to a total course of treatment administered to a patient, e.g., treatment with a long-acting rhGH.
  • a dosing regimen comprises administering a long-acting rhGH on a weekly basis.
  • a dosing regimen is every 3 days, every 4 days, every 5 days, every 6 days, every 7 days, or every 9 days.
  • a dosing regimen comprises administering a long-acting rhGH every 3 to 5 days, every 4 to 6 days, every 5 to 7 days, or every 6 to 8 days.
  • a dosing regimen includes a dose modification regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level with a standard deviation score (SDS) of > +2 or ⁇ -2 (which may be abbreviated as > +2 SDS or ⁇ -2 SDS).
  • SDS standard deviation score
  • a dosing regimen includes a dose reduction regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level > +2 standard deviation score (SDS).
  • a dosing regimen includes a dose reduction regimen for a long- acting rhGH, optionally in response to a serum IGF-1 level > +2 standard deviation score (SDS) wherein an initial dose level (e.g., about 0.66 mg/kg/week) is reduced by about 5% to about 50% (e.g., about 15%, about 30%) to a modified dose level or a further modified dose level.
  • a dose reduction regimen may also be referred to a dose modification regimen.
  • a dosing regimen includes a dose increase regimen for a long- acting rhGH, optionally in response to a serum IGF-1 level ⁇ -2 standard deviation score (SDS).
  • a dosing regimen includes a dose increase regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level ⁇ -2 standard deviation score (SDS), wherein an initial dose level (e.g., about 0.66 mg/kg/week) is increased by about 5% to about 50% (e.g., about 15%, about 30%) to a modified dose level or a further modified dose level.
  • a dose increase regimen may also be referred to a dose modification regimen.
  • a dosing regimen includes a dose modification regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level having a standard deviation score of > +1.5 or ⁇ -0.5. In some embodiments, a dosing regimen includes a dose modification regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level having a standard deviation score of > +2 or ⁇ -2.
  • a dosing regimen includes a dose reduction regimen for a long-acting rhGH, optionally in response to a serum IGF-1 level > +1.5 standard deviation score (SDS).
  • a dosing regimen includes a dose reduction regimen for a long- acting rhGH, optionally in response to a serum IGF-1 level > +1.5 standard deviation score (SDS) wherein an initial dose level (e.g., 1 - 5 mg/week) is reduced by about 0.1 mg/week to about 1.0 mg/week (e.g., about 0.5 mg/week, about 0.75 mg/week) to a modified dose level or a further modified dose level.
  • an initial dose level e.g., 1 - 5 mg/week
  • 1.0 mg/week e.g., about 0.5 mg/week, about 0.75 mg/week
  • a dosing regimen includes a dose increase regimen for a long- acting rhGH, optionally in response to a serum IGF-1 level ⁇ -0.5 standard deviation score (SDS).
  • a dosing regimen includes a dose increase regimen for a long- acting rhGH, optionally in response to a serum IGF-1 level ⁇ -0.5 standard deviation score (SDS), wherein an initial dose level (e.g., 1-5 mg/week) is increased by about 0.5 mg/week to about 2 mg/week (e.g., about 1 mg/week, about 1.5 mg/week) to a modified dose level or a further modified dose level.
  • an initial dose level e.g., 1-5 mg/week
  • an initial dose level is increased by about 0.5 mg/week to about 2 mg/week (e.g., about 1 mg/week, about 1.5 mg/week) to a modified dose level or a further modified dose level.
  • efficacy refers to the capacity of a drug or treatment to produce a pharmacological effect.
  • efficacy is assessed by measuring one or more of: mean height velocity, gain (delta) in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin-like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, and cholesterol values.
  • Height SDS is derived from the age and sex standards from the 2000 Centers for Disease Control Growth Charts (Centers for Disease Control. Growth Charts. 2010 (last update Sep. 9, 2010) at www[dot]cdc[dot]gov/growthcharts/).
  • efficacy is indicated by continued bone maturation.
  • efficacy is assessed by the Quality of Life in Short Stature
  • QoLISSY Quality of Life
  • efficacy is assessed by the Dyad Clinical Outcome Assessment (DCOA) questionnaire.
  • the DCOA questionnaire is completed as a Dyad pair (child and caregiver together), with some specific questions intended for the caregiver only.
  • the DCOA questionnaire is comprised of 2 parts (DCOA 1 and 2), with a comprehensive list of questions to determine the treatment burden. Patients and caregivers rate treatment experience as part of DCOA 1, and select their preference for either daily or weekly injections as part of DCOA 2.
  • an “effective dosage,” “effective amount,” “therapeutically effective amount” or “therapeutically effective dosage” of drug, compound, or pharmaceutical composition is an amount sufficient to affect any one or more beneficial or desired results.
  • beneficial or desired results include eliminating or reducing the risk, lessening the severity, or delaying the outset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
  • beneficial or desired results include clinical results, decreasing the dose of other medications required to treat the disease, enhancing the effect of another medication, and/or delaying the progression of the disease of patients.
  • an effective amount of a long-acting rhGH maintains a serum or plasma IGF-1 level in a subject within +/- 2 SDS.
  • an effective amount of a long-acting rhGH increases a serum or plasma IGF-1 level in a subject to within +/- 2 SDS.
  • an effective amount of a long-acting rhGH increases and maintains a serum or plasma IGF-1 level in a subject within +/- 2 SDS.
  • an effective amount of a long-acting rhGH maintains a serum or plasma IGF-1 level in a subject within +/- 1.5 SDS.
  • an effective amount of a long-acting rhGH increases a serum or plasma IGF-1 level in a subject to within +/- 1.5 SDS.
  • an effective amount of a long-acting rhGH increases and maintains a serum or plasma IGF-1 level in a subject within +/- 1.5 SDS.
  • an effective amount of a long-acting rhGH maintains a serum or plasma IGF-1 level in a subject between a standard deviation score of -0.5 and + 1.5.
  • an effective amount of a long-acting rhGH increases a serum or plasma IGF-1 level in a subject to between a standard deviation score of -0.5 and + 1.5.
  • an effective amount of a long-acting rhGH increases and maintains a serum or plasma IGF-1 level in a subject between a standard deviation score of -0.5 and + 1.5.
  • IGF-1 SDS is calculated using the modified least squares (LS) mean model (Bidlingmaier el al, J. Clin. Endocrinol. Metab. (2014) 99(5): 1712-1721).
  • estimated IGF-1 SDS profiles over the dosing interval is calculated according to Fisher et al., Horm. Res. Paediatr. (2017) 87(5):324-332.
  • an effective amount of a long-acting rhGH decreases trunk fat mass, increases lean body mass, decreases trunk fat mass as a percentage of total fat mass, normalizes IGF-1 levels or a combination thereof in a subject (e.g., an adult).
  • an effective dosage can be administered in one or more administrations.
  • an effective dosage of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
  • an effective dosage of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
  • an “effective dosage” may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
  • an effective amount of a long-acting rhGH is administered based on the weight of a subject, for instance mg per kg of body weight. In some embodiments, an effective amount of a long-acting rhGH is administered based on the weight of a subject and on a dose interval, for instance, mg per kg of body weight per week. In some embodiments, an effective amount of a long-acting rhGH is adjusted every 1 to 6 months (e.g., every 1, every 2, every 3, every 4, every 5, or every 6 months) based on a subject’s body weight.
  • an effective amount of a long-acting rhGH is about 0.66 mg/kg body weight/week. In some embodiments, an effective amount of a long-acting rhGH is about 0.56 mg/kg body weight/ week. In some embodiments, an effective amount of a long- acting rhGH is about 0.48 mg/kg body weight/week. In some embodiments, an effective amount of a long-acting rhGH is about 0.40 mg/kg body weight/week. In some embodiments, an effective amount of a long-acting rhGH is about 0.36 mg/kg body weight/week. In some embodiments, an effective amount of a long-acting rhGH, is about 0.25 mg/kg body weight/week.
  • an effective amount of a long-acting rhGH is about 0.16 mg/kg body weight/week. In some embodiments, an effective amount of a long-acting rhGH is about 0.16 mg/kg body weight/week to about 0.66 mg/kg body weight/week. In some embodiments, an effective amount of a once daily rhGH therapy is about 0.10 mg to about 1.0 mg per kg body weight per week.
  • an effective amount of a long-acting rhGH is administered as a fixed dose at a particular interval, for instance, mg per week (e.g., 6 to 8 days). In some embodiments, an effective amount of a long-acting rhGH is administered based on the gender, age and/or estrogen status of a subject. In some embodiments, an effective amount of a long- acting rhGH is adjusted based on a subject’s age and/or estrogen status.
  • an effective amount of a long-acting rhGH is about 0.66 mg/week, about 0.56 mg/week, about 0.48 mg/week, about 0.40 mg/week, about 0.36 mg/week, about 0.25 mg/week, or about 0.16 mg/week for a pediatric subject. In some embodiments, an effective amount of a long-acting rhGH is between 0.16 mg/week to 0.66 mg/week for a pediatric subject.
  • an effective amount of a long-acting rhGH is about 2.0 mg/week, about 2.5 mg/week, or about 3.5 mg/week for a male 50 years of age or less.
  • an effective amount of a long-acting rhGH is about 1.5 mg/week, about 2.0 mg/week, or about 3.5 mg/week for a male greater than 50 years of age.
  • an effective amount of a long-acting rhGH is about 2.5 mg/week, about 3.0 mg/week, or about 4.0 mg/week for a female not on oral estrogen who is 50 years of age or less.
  • an effective amount of a long-acting rhGH is about 2.0 mg/week, about 2.5 mg/week, or about 3.5 mg/week for a female not on oral estrogen who is greater than 50 years of age.
  • an effective amount of a long-acting rhGH is about 3.25 mg/week, about 4.0 mg/week, or about 5.5 mg/week for a female on oral estrogen who is 50 years of age or less.
  • an effective amount of a long-acting rhGH is about 2.75 mg/week, about or 3.5 mg/week, or about 5.0 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • an effective amount of a long-acting rhGH ranges from about 1 mg/week to about 11 mg/week for an adult with growth hormone deficiency. In some embodiments, an effective amount of a long-acting rhGH ranges from about 1 mg/week to about 5 mg/week for an adult with growth hormone deficiency.
  • GH refers to growth hormone from any species, including bovine, ovine, porcine, equine, and preferably human, in native-sequence or invariant form, and from any source, whether natural, synthetic, or recombinant.
  • the phrase “human growth hormone” (hGH) refers to a polypeptide, such as set forth in Genbank Accession No. P01241 (SEQ ID NO: 1). The hGH sequence shown in SEQ ID NO: 1 is further processed to remove the first 26 N-terminal amino acids corresponding to a signal peptide (underlined), resulting in the mature, 191 amino acid form exhibiting hGH activity (i.e. stimulation of growth).
  • GH also refers to homologues.
  • a GH amino acid sequence of the methods and compositions the present invention is at least 50% homologous to a GH sequence set forth herein as determined using BlastP software of the National Center of Biotechnology Information (NCBI) using default parameters.
  • NCBI National Center of Biotechnology Information
  • a percent homology is 60%.
  • a percent homology is 70%.
  • a percent homology is 80%.
  • a percent homology is 90%.
  • a percent homology is at least 95%.
  • a percent homology is greater than 95%.
  • the term “homology” encompasses deletions, insertions, or substitution variants, including an amino acid substitution thereof, and biologically active polypeptide fragments thereof.
  • IGF-l refers to insulin-like growth factor from any species, including bovine, ovine, porcine, equine, and preferably human, in native-sequence or in variant form, and from any source, whether natural, synthetic, or recombinant.
  • IGF-l is a secreted from the liver and other tissues in response to growth hormone.
  • IGF-l is a validated surrogate marker for hGH activity.
  • a serum or plasma level of IGF-l in a subject is increased following administration of a long-acting rhGH (e.g., somatrogon).
  • a serum or plasma level of IGF-l in a subject is maintained following administration of a long-acting rhGH (e.g., somatrogon).
  • a serum or plasma level of IGF-l in a subject is increased and maintained following administration of a long-acting rhGH (e.g., somatrogon).
  • a serum or plasma level of IGF-l in a subject is maintained within a defined range following administration of a long-acting rhGH (e.g., somatrogon).
  • a defined range of a serum or plasma IGF-1 level is comparable to a range of serum or plasma IGF-1 levels in individuals without growth hormone deficiency.
  • a defined range of a serum or plasma IGF-1 level is the range of serum or plasma IGF-1 levels in a control population.
  • a desired therapeutic range of IGF-1 in a subject treated with a long-acting rhGH is defined as a range between +2 standard deviations through -2 standard deviations from the average IGF-1 levels expected in an appropriate control population, where the control population is a reference population stratified by age group and gender.
  • a desired therapeutic range of IGF-1 in a subject treated with a long-acting rhGH is defined as a range between +1.5 standard deviations through -1.5 standard deviations from the average IGF-1 levels expected in a control population, stratified by age group and gender.
  • a desired therapeutic range of IGF-1 in a subject treated with a long-acting rhGH is defined as a range between +1.5 standard deviations through -0.5 standard deviations from the average IGF-1 levels expected in a control population, stratified by age group and gender.
  • IGF-1 standard deviation score is calculated using the modified least squares (LS) mean model (Bidlingmaier et al., J. Clin. Endocrinol. Metab. (2014) 99(5): 1712-1721).
  • estimated IGF-1 SDS profiles over the dosing interval is calculated according to Fisher et al., Horm. Res. Paediatr. (2017) 87(5):324-332.
  • the term “subject” refers to a mammal, more preferably, a human. Mammals also include, but are not limited to, sport animals, pets, primates, horses, dogs, cats, mice, rats, and farm animals including without limitation cows, pigs, goats, and sheep. In some embodiments, a subject is a human with growth hormone deficiency.
  • a subject with growth hormone deficiency has impaired height (SDS ⁇ -2) and impaired height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]), an IGF-1 level > 1 SD below the age- and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1) and/or has not received prior rhGH therapy.
  • a subject with growth hormone deficiency is a pediatric subject, for example a subject up to the age of 18 year.
  • a subject with growth hormone deficiency is a female of 3 to ⁇ 10 years of age.
  • a subject with growth hormone deficiency is a male of 3 to ⁇ 11 years of age.
  • a subject with growth hormone deficiency has: impaired height (standard deviation score (SDS) ⁇ -2), impaired height velocity below the 25 th percentile for chronological age, an IGF-1 level at least 1 SD below the age and sex-standardized mean IGF-1 level (SDS ⁇ -l), and/or has not received prior rhGH therapy.
  • SDS standard deviation score
  • a subject with an SDS ⁇ -2 is a subject whose serum IGF-1 concentration is below the mean reference value for their age and sex by more than 2 SDS.
  • IGF-1 SDS is calculated using the modified least squares (LS) mean model (Bidlingmaier et al., J. Clin. Endocrinol. Metab. (2014) 99(5): 1712-1721).
  • estimated IGF-1 SDS profiles over the dosing interval is calculated according to Fisher et al., Horm. Res. Paediatr. (2017) 87(5):324-332.
  • a subject does not have active malignancy, a prior history of a malignancy or received radiation therapy or chemotherapy.
  • a subject does not have an acute illness such as for example, complications following open heart or abdominal surgery, multiple accidental trauma, or acute respiratory failure.
  • a subject does not have a body mass index (BMI) ⁇ -2 SDS (age- and sex- standardized), anti-rhGH antibodies at screening, psychosocial dwarfism, a chromosomal abnormality (e.g., Turner syndrome, Laron syndrome, Noonan syndrome, Prader-Willi syndrome, Russell-Silver syndrome, SHOX mutations/deletions, or skeletal dysplasia), celiac disease, uncontrolled primary hypothyroidism, rickets or who was bom small for their gestational age (birth weight/length ⁇ -2 SDS).
  • BMI body mass index
  • a subject does not have type 1 or type 2 diabetes mellitus and is not receiving standard of care, is noncompliant with their prescribed treatment, or is in poor metabolic control.
  • a subject is not receiving anabolic/sex steroid (except for drugs for ADHD or hormone replacement therapies), glucocorticoid therapy or inhaled budesonide at dose greater than 400 pg/day or equivalent.
  • a subject does not have >1 closed epiphyses, is not HIV-positive or with advanced diseases such as AIDS or tuberculosis, is not hypersensitive to components of study medication.
  • a subject had received a once daily recombinant human growth hormone for at least three, four, five, six, seven, eight, nine, ten, eleven months or twelve months. In some embodiments, a subject had received a once daily recombinant human growth hormone for at least one year. In some embodiments, a subject had not received a once daily recombinant human growth hormone.
  • a subject is obese. In some embodiments, a subject is female. In some embodiments, the subject is 10 to 15 years old. In some embodiments, a subject is 3 to ⁇ 11 years old, and optionally a male. In some embodiments, a subject is 3 to ⁇ 10 years of age, and optionally a female.
  • a subject is a pediatric subject. In some embodiments, a pediatric subject is three years old or older.
  • a subject has one or more of the following: isolated growth hormone deficiency (GHD), GH insufficiency as part of multiple pituitary hormone deficiency, pediatric GHD, and Prader-Willi Syndrome. In some embodiments, a subject has adult .
  • GHD isolated growth hormone deficiency
  • GH insufficiency as part of multiple pituitary hormone deficiency
  • pediatric GHD pediatric GHD
  • Prader-Willi Syndrome a subject has adult .
  • the terms “treat,” or “treatment” is an approach for obtaining beneficial or desired clinical results.
  • the terms “treat” or “treatment” means to administer a therapy that partially or completely alleviates, ameliorates, relieves, inhibits, delays onset of, reduces severity of, and/or reduces incidence of one or more symptoms, features and causes of a particular disease, disorder and/or condition (e.g., growth hormone deficiency).
  • beneficial or desired clinical results include, but are not limited to, one or more of the following: improved height velocity, bone maturation, IGF-1 level related to growth hormone deficiency.
  • the term includes the administration of a compound or agent of the present invention to prevent or delay the onset of a symptom, complication, or biochemical indicia of a disease, alleviating a symptom or arresting or inhibiting further development of a disease, condition, or disorder.
  • Treatment may be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of a clinical or subclinical symptom thereof) or therapeutic suppression or alleviation of a symptom after the manifestation of the disease.
  • the disease, condition or disorder is growth hormone deficiency.
  • a "pharmaceutical composition” refers to a preparation of one or more active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients.
  • the purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
  • the present teachings provide long-acting recombinant human growth hormone (long-acting rhGH) and methods of producing and using the same.
  • the long- acting rhGH provided herein comprises recombinant human growth hormone (rhGH) and carboxy terminal peptides (CTPs) of human chorionic gonadotropin (hCG).
  • CTP acts as a protectant against degradation of proteins or peptides derived therefrom.
  • CTP extends circulatory half-lives of proteins or peptides derived therefrom.
  • CTP enhances the potency of proteins or peptides derived therefrom.
  • the long-acting rhGH is a CTP-modified growth hormone polypeptide as described in at least U.S. Patent No. 7,553,941, granted June 30, 2009; U.S. Patent No. 8,097,435, granted January 17, 2012; U.S. Patent No. 8,048,849, granted November 1, 2011; U.S. Patent No. 8,450,269, granted May 28, 2013; U.S. Patent No.
  • CTP peptide “carboxy terminal peptide,” “CTP sequence,” and “chorionic gonadotropin C-terminal peptide” are used interchangeably herein.
  • the carboxy terminal peptide is a full-length CTP.
  • the carboxy terminal peptide is a truncated CTP.
  • a CTP peptide comprises an amino acid sequence of SEQ ID NO:3 (SSSSKAPPPSLPSPSRLPGPSDTPILPQ).
  • a long-acting rhGH is a C-terminal peptide (CTP)-modified hGH.
  • CTP C-terminal peptide
  • a long-acting rhGH comprises the amino acid sequence of mature human growth hormone (hGH) with one copy of CTP from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C-terminus.
  • a long-acting rhGH comprises the amino acid sequence shown in SEQ ID NO: 2. In some embodiments, a long-acting rhGH is glycosylated. In some embodiments, a long- acting rhGH is 0-glycosylated on twelve to eighteen serines. In some embodiments, a long- acting rhGH is 0-glycosylated on twelve to twenty serines. In some embodiments, a long-acting rhGH is 0-glycosylated on ten to twenty serines.
  • the present teachings provide pharmaceutical formulations comprising a buffer, a tonicity agent, and a long-acting rhGH comprising a human growth hormone and one chorionic gonadotropin CTP attached to the amino terminus of the human growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of the human growth hormone.
  • the long-acting rhGH is somatrogon. Somatrogon is a long-acting rhGH comprising the amino acid sequence of human growth hormone and three copies of the carboxy -terminal peptide of human chorionic gonadotropin.
  • the long-acting rhGH comprises the amino acid sequence of SEQ ID NO: 2.
  • S S S SKAPPPSLPSP SRLPGP SDTPILPQFPTIPLSRLFDNAMLRAHRLHQLAFDTY QEFEEA YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVF ANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDAL LKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFSSSSKAPPPSLPSPSRLPGPSDTPIL PQSSSSKAPPPSLPSPSRLPGPSDTPILPQ (SEQ ID NO: 2).
  • a long- acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 further comprises O-glycans occupancy at between 9 to 20 and has at least 50% of the population of somatrogon molecules comprising between 12 to 18 O-glycans.
  • a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 further comprises O-glycans occupancy at between 9 to 20 and has at least 60% of the population of somatrogon molecules comprising between 12 to 18 O- glycans.
  • a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 further comprises O-glycans occupancy at between 9 to 20 and has at least 70% of the population of somatrogon molecules comprising between 12 to 18 O-glycans.
  • a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 further comprises O- glycans occupancy at between 9 to 20 and has at least 80% of the population of somatrogon molecules comprising between 12 to 18 O-glycans.
  • a long-acting rhGH is somatrogon.
  • Somatrogon is a glycoprotein comprised of the amino acid sequence of human growth hormone (hGH) with one copy of the C-terminal peptide (CTP) from the beta chain of human chorionic gonadotropin (hCG) at the N-terminus and two copies of CTP (in tandem) at the C-terminus.
  • CTP C-terminal peptide
  • Each CTP includes multiple O-linked glycosylation sites.
  • the glycosylation and CTP domains account for the half-life of somatrogon which allows for weekly dosing.
  • the O-glycan occupancy ranges from 9 to 20 moieties per intact somatrogon molecule.
  • the predominant somatrogon gly coforms include the molecule with 15 monosialylated, core-1 O-glycans or 16 monosialylated, core-1 O-glycans. Additionally, each CTP region contains hydroxyproline residues, which range from 0-5 hydroxy additions per intact somatrogon molecule.
  • the amino acid sequence of somatrogon is set forth in SEQ ID NO:2. Somatrogon comprises one disulfide bridge between cysteine residue 81 and cysteine residue 193 of SEQ ID NO:2 and a second disulfide bridge between cysteine residue 210 and cysteine residue 217 of SEQ ID NO:2.
  • the long-acting rhGH comprises a composition of somatrogon molecules wherein at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of a population of somatrogon molecules comprises between 12 to 18 O-glycans.
  • the long-acting rhGH comprises a composition of somatrogon molecules provided at a dose of 0.66 milligrams (mg) per kilogram (kg) of body weight per week wherein at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of a population of somatrogon molecules comprises between 10 to 18 O-glycans.
  • the long- acting rhGH comprises a composition of somatrogon molecules provided at a dose of 0.66 milligrams (mg) per kilogram (kg) of body weight per week wherein at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of a population of somatrogon molecules comprises between 12 to 18 O-glycans.
  • the long-acting rhGH comprises a composition of somatrogon molecules provided at a dose of 0.56 milligrams (mg) per kilogram (kg) of body weight per week wherein at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of a population of somatrogon molecules comprises between 10 to 18 O-glycans.
  • the long-acting rhGH comprises a composition of somatrogon molecules provided at a dose of 0.56 milligrams (mg) per kilogram (kg) of body weight per week wherein at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of a population of somatrogon molecules comprises between 12 to 18 O-glycans.
  • the long-acting rhGH polypeptide is glycosylated.
  • each CTP present in SEQ ID NO: 2 includes multiple O-linked glycosylation sites.
  • O-glycan occupancy can range from 9 to 20 moieties per intact long-acting rhGH molecule.
  • O-glycan occupancy can range from 12 to 18 moieties per intact long-acting rhGH molecule. In some embodiments, at least 50% of a population of long-acting rhGH polypeptide molecules has an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyproline residues, which can range from 0-5 hydroxy additions per intact long-acting rhGH molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyprobne residues, which can range from zero to five hydroxy additions per intact long-acting rhGH molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 10 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyprobne residues, which can range from zero to five hydroxy additions per intact long-acting rhGH molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.66 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyproline residues, which can range from 0-5 hydroxy additions per intact long-acting rhGH molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.56 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyproline residues, which can range from zero to five hydroxy additions per intact long-acting rhGH molecule.
  • the present application further provides for, and includes, a long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long- acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 50% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 60% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide having an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 70% of the rhGH molecules have an O- glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • the long-acting glycosylated rhGH polypeptide has an O-glycan occupancy range from 9 to 20 moieties per intact long-acting rhGH molecule and is provided at a dose level of 0.48 milligrams (mg) per kilogram (kg) of body weight per week, wherein at least 80% of the rhGH molecules have an O-glycan occupancy of between 12 to 18 moieties per intact long-acting rhGH polypeptide molecule.
  • each CTP region can contain hydroxyproline residues, which can range from zero to five hydroxy additions per intact long-acting rhGH molecule.
  • the predominant gly coforms can include the long-acting rhGH molecule with 15 monosialylated, core-1 O-glycans or 16 monosialylated, core-1 O-glycans. Additionally, each CTP region can contain hydroxyproline residues, which can range from 0-5 hydroxy additions per intact long-acting rhGH molecule.
  • the long-acting rhGH polypeptide comprises two disulfide bridges.
  • one disulfide bridge is between cysteine residue 81 and cysteine residue 193 of SEQ ID NO: 2
  • a second disulfide bridge is between cysteine residue 210 and cysteine residue 217 of SEQ ID NO: 2.
  • a configuration of CTP- growth hormone-CTP-CTP as described herein comprises a growth hormone or an active fragment thereof connected via a linker to at least one CTP unit.
  • a linker is a peptide bond.
  • a configuration of CTP- growth hormone-CTP-CTP as described herein comprises a growth hormone or an active fragment thereof connected via a peptide bond to at least one CTP unit.
  • a CTP- growth hormone -CTP-CTP as described herein comprises a growth hormone or an active fragment thereof connected via a peptide bond to at least one CTP unit which is connected to an additional CTP unit via a peptide bond.
  • a polypeptide as described herein comprising a growth hormone fragment thereof and CTP units and/or fragments thereof are interconnected via a peptide bond.
  • one nucleic acid molecule encodes a polypeptide as described herein comprising a growth hormone and/or fragments thereof and CTP units and/or fragments thereof.
  • a CTP is attached to the polypeptide sequence of interest via a linker.
  • at least one CTP is optionally attached to said polypeptide sequence of interest via a linker.
  • a linker which connects the CTP sequence to the polypeptide sequence of interest is a covalent bond.
  • a linker which connects a CTP sequence to a polypeptide sequence of interest is a peptide bond.
  • a linker which connects a CTP sequence to a polypeptide sequence of interest is a substituted peptide bond.
  • a CTP sequence at the amino terminal end of a polypeptide, a CTP sequence at the carboxy terminal end of a polypeptide, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus provide enhanced protection against degradation of a protein.
  • a CTP sequence at the amino terminal end of a polypeptide, a CTP sequence at the carboxy terminal end of the polypeptide, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus provide an extended half-life to the attached protein.
  • a CTP sequence at the amino terminal end of a polypeptide, a CTP sequence at the carboxy terminal end of a polypeptide, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus provide enhanced activity of the attached protein.
  • At least one CTP sequence at the amino terminal end of a growth hormone and two CTP units in the carboxy terminal end of a growth hormone provide enhanced protection against clearance. In other embodiments, at least one CTP sequence at the amino terminal end of a growth hormone and two CTP units in the carboxy terminal end of a growth hormone provide prolonged clearance time. In other embodiments, at least one CTP sequence at the amino terminal end of a growth hormone and two CTP units in the carboxy terminal end of a growth hormone enhance C max of a growth hormone. In other embodiments, at least one CTP sequence at the amino terminal end of a growth hormone and two CTP units in the carboxy terminal end of a growth hormone enhance T max of a growth hormone. In other embodiments, at least one CTP sequence at the amino terminal end of a growth hormone and two CTP units in the carboxy terminal end of a growth hormone enhanced T1 / 2.
  • CTP sequences at both the amino terminal end of a growth hormone and at the carboxy terminal end of a growth hormone extend the half-life of the modified growth hormone.
  • at least a single CTP sequence at the amino terminal end of a growth hormone and at least two CTP sequences at the carboxy terminal end of a growth hormone provide an extended half-life to the modified growth hormone.
  • a single CTP sequence at the amino terminal end of a growth hormone and two CTP sequences at the carboxy terminal end of a growth hormone provide extended half-life to the attached growth hormone.
  • a single CTP sequence at the amino terminal end of a growth hormone and two CTP sequences in tandem at the carboxy terminal end of the growth hormone provide extended half-life to the modified growth hormone.
  • a CTP sequence at the amino terminal end of a polypeptide, a CTP sequence at the carboxy terminal end of a growth hormone, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus provide enhanced protection against degradation to a growth hormone.
  • a CTP sequence at the amino terminal end of a growth hormone, a CTP sequence at the carboxy terminal end of the growth hormone, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus extend the half-life of the growth hormone.
  • a CTP sequence at the amino terminal end of a growth hormone, a CTP sequence at the carboxy terminal end of the growth hormone, and at least one additional CTP sequence attached in tandem to the CTP sequence at the carboxy terminus enhance the biological activity of the growth hormone.
  • human growth hormone hGH
  • attachment of a CTP sequence to both the amino and carboxy termini of the hGH protein results in increased potency.
  • attachment of a CTP sequence to both the amino and carboxy termini of the hGH protein results in prolonged in vivo activity.
  • a long-acting rhGH provided herein prolongs the half-live of protein drugs of molecular weight lower than 50,000 daltons, such as GH.
  • a long-acting rhGH provided herein enables interferons to exert their beneficial effects for a longer period of time.
  • immunogenicity of a long-acting rhGH provided herein is equal to an isolated GH. In other embodiments, immunogenicity of a long-acting rhGH provided herein is comparable to an isolated GH. In other embodiments, modifying a GH as described herein with CTP peptides reduces immunogenicity of the GH. In other embodiments, a long- acting rhGH provided herein is as active as an isolated GH protein. In other embodiments, a long-acting rhGH provided herein is more active than an isolated GH. In other embodiments, a long-acting rhGH provided herein maximizes the growth hormone's protective ability against degradation while minimizing reductions in bioactivity.
  • each long-acting rhGH molecule comprises the amino acid sequence of mature human growth hormone (hGH) with one copy of CTP from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C-terminus, and wherein the plurality comprises about 9 to 20 O-glycans per intact long-acting rhGH molecule.
  • the long-acting rhGH comprises the amino acid sequence shown in SEQ ID NO: 2.
  • the long-acting rhGH is O-glycosylated on twelve to twenty serines.
  • plurality comprises a predominant gly coform having a molecular mass of about 40314 Da.
  • the plurality comprises additional predominant O-gly coforms having molecular masses of about 39657 and 40970 Da.
  • the plurality comprises about 10- 19 O-glycans per intact long-acting rhGH molecule.
  • a plurality comprises about 15 or 16 O-glycans per intact long-acting rhGH molecule.
  • the plurality comprises asialylated and di-sialylated core-1 O-glycans.
  • each CTP region comprises 0-5 hydroxy additions per intact somatrogon molecule.
  • the present teachings provide long-acting rhGH (e.g., somatrogon) for a once a week administration to a subject having a growth hormone deficiency.
  • a subject is a child.
  • a subject is a growth hormone deficient child.
  • the child is between 3 and 12 years of age.
  • the child is between 10 and 17 years of age.
  • the child is pre-pubertal and between 3 and 10 or 3 and 11 years of age depending upon whether the child is female or male respectively.
  • a subject is an adult.
  • a subject is a growth hormone deficient adult.
  • the present teachings provide a method of treating a subject in need of GH therapy, comprising administering to said subject a therapeutically effective amount of a long-acting rhGH, thereby reducing the dosing frequency of a growth hormone in a subject.
  • a subject is a human subject.
  • a human subject is growth hormone deficient.
  • a subject is growth hormone deficient.
  • a subject in need of GH therapy has been diagnosed with, and/or suffers from, a growth deficiency disorder such as, for example without limitation, isolated growth hormone deficiency (GHD), GH insufficiency or growth deficiency as part of multiple pituitary hormone deficiency, pediatric GHD, Prader-Willi Syndrome, Small for Gestational Age, Turner Syndrome, Idiopathic Short Stature, or Adult GHD.
  • a growth deficiency disorder such as, for example without limitation, isolated growth hormone deficiency (GHD), GH insufficiency or growth deficiency as part of multiple pituitary hormone deficiency, pediatric GHD, Prader-Willi Syndrome, Small for Gestational Age, Turner Syndrome, Idiopathic Short Stature, or Adult GHD.
  • a subject is a growth hormone deficient child. In other embodiments, a subject is a pre-pubertal growth hormone deficient adult. In other embodiments, a subject is a pet. In other embodiments, a subject is a mammal. In other embodiments, a subject is a farm animal. In other embodiments, a subject is a dog. In other embodiments, a subject is a cat. In other embodiments, a subject is a monkey. In other embodiments, a subject is a horse. In other embodiments, a subject is a cow. In other embodiments, a subject is a mouse. In other embodiments, a subject is a rat. In some embodiments, a subject is male. In other embodiments, a subject is female.
  • the present teachings provide a method of increasing insulin like growth factor (IGF-1) levels in a subject, comprising administering to said subject a therapeutically effective amount of a long-acting rhGH, thereby increasing insulin-like growth factor (IGF-1) levels in a subject.
  • IGF-1 insulin like growth factor
  • the present teachings provide a method of maintaining insulin-like growth factor (IGF-1) levels in a subject, comprising administering to said subject a long-acting rhGH, thereby maintaining insulin-like growth factor (IGF-1) levels in a subject.
  • IGF-1 levels are kept in a defined range, as further provided herein.
  • the present teachings provide a method of increasing and maintaining insulin-like growth factor (IGF-1) levels within a defined range in a subject, comprising administering to said subject a long-acting rhGH, thereby increasing and maintaining insulin-like growth factor (IGF-1) levels within a defined range in a subject.
  • IGF-1 insulin-like growth factor
  • provided herein is a method of achieving normal growth recovery of a pre-pubertal growth hormone deficient child, the method comprising administering a pharmaceutical composition comprising a CTP -modified growth hormone provided herein. In other embodiments, provided herein is a method of achieving growth recovery of a pre-pubertal growth hormone deficient child, the method comprising administering a pharmaceutical composition comprising a long-acting rhGH provided herein.
  • the present teachings provide a method of treating a subject in need of GH therapy, the method comprising administering a long-acting growth hormone (e.g., comprising the amino acid sequence of SEQ ID NO:2) wherein the subject is small for gestational age, has Turner syndrome or has idiopathic short stature and optionally, wherein the long-acting growth hormone is administered at a dose of about 0.5 mg/kg body weight/week to about 1.5 mg/kg body weight/week, optionally at a dose of about 1.0 mg/kg body weight/week.
  • a long-acting growth hormone e.g., comprising the amino acid sequence of SEQ ID NO:2
  • the subject is small for gestational age, has Turner syndrome or has idiopathic short stature
  • the long-acting growth hormone is administered at a dose of about 0.5 mg/kg body weight/week to about 1.5 mg/kg body weight/week, optionally at a dose of about 1.0 mg/kg body weight/week.
  • the present teachings provide a method of inducing growth or weight gain in a subject, comprising administering to the subject a therapeutically effective amount of a long-acting rhGH comprising human growth hormone, one chorionic gonadotropin CTP attached to an amino terminus of said growth hormone, and two chorionic gonadotropin CTPs attached to a carboxy terminus of the growth hormone, thereby inducing growth or weight gain in a subject.
  • a method comprises administering a long-acting rhGH to a subject previously administered a once daily rhGH therapy.
  • the subject had previously received a once daily rhGH therapy for one or more weeks.
  • a subject had previously received a once daily rhGH therapy for one or more months.
  • the subject had previously received a once daily rhGH therapy for one or more years.
  • the once daily rhGH can be, for example without limitation, somatropin, including without limitation Genotropin®, Nutropin®, Humatrope®, Norditropin®, and Saizen®, a somatropin biosimilar such as for example Omnitrope®, Valtropin®, Zomacton®, and Eutropin®, somatrem, including Protropin, or a somatrem biosimilar.
  • the daily rGH is Genotropin®, Nutropin®, Humatrope®, Norditropin®, or Saizen®.
  • the daily rGH is Omnitrope®, Valtropin®, Zomacton®, Eutropin®, or other somatropin biosimilar.
  • the methods comprise administering a long-acting rhGH to a subject who has not been previously administered a once daily rhGH therapy.
  • a method of treating growth hormone deficiency in a first subject in need thereof comprises selecting a first subject with growth hormone deficiency, wherein the first subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the first subject, so that efficacy of the long-acting rhGH in the first subject is comparable to efficacy of the long-acting rhGH in a second subject who previously received only the long-acting rhGH and has not previously received the once daily rhGH therapy.
  • a subject with a growth hormone deficiency is a female of three (3) to ⁇ 10 years of age having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]).
  • HV impaired height and height velocity
  • a subject with a growth hormone deficiency is a female of 3 to ⁇ 10 years of age having an IGF-1 level > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • a subject with a growth hormone deficiency is a female of 3 to ⁇ 10 years of age having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]) and an IGF-1 level > 1 SD below the age and sex- standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV impaired height and height velocity
  • IGF-1 level > 1 SD below the age and sex- standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • the subject with a growth hormone deficiency has not received prior rhGH therapy.
  • a subject with a growth hormone deficiency is a male of three (3) to ⁇ 11 years of age having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]).
  • HV impaired height and height velocity
  • a subject with a growth hormone deficiency is a male of 3 to ⁇ 11 years of age having an IGF-1 level > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • a subject with a growth hormone deficiency is a male of 3 to ⁇ 11 years of age having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]) and an IGF-1 level > 1 SD below the age and sex- standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV impaired height and height velocity
  • IGF-1 level > 1 SD below the age and sex- standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • the subject with a growth hormone deficiency has not received prior rhGH therapy.
  • a subject with a growth hormone deficiency is an adult having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]).
  • HV impaired height and height velocity
  • a subject with a growth hormone deficiency is an adult having an IGF-1 level > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • a subject with a growth hormone deficiency is an adult having impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV ⁇ -0.7 SDS]) and an IGF-1 level > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV impaired height and height velocity
  • IGF-1 level > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • the subject with a growth hormone deficiency has not received prior rhGH therapy.
  • a subject does not have active malignancy, a prior history of a malignancy or received radiation therapy or chemotherapy.
  • a subject does not have an acute illness such as for example, complications following open heart or abdominal surgery, multiple accidental trauma, or acute respiratory failure.
  • a subject does not have a body mass index (BMI) with an SDS of ⁇ -2 (age- and sex-standardized), anti- rhGH antibodies at screening, psychosocial dwarfism, a chromosomal abnormality (e.g., Turner syndrome, Laron syndrome, Noonan syndrome, Prader-Willi syndrome, Russell-Silver syndrome, SHOX mutations/deletions, or skeletal dysplasia), celiac disease, uncontrolled primary hypothyroidism, rickets or who was bom small for their gestational age (birth weight/length SDS of ⁇ -2).
  • BMI body mass index
  • a subject does not have type 1 or type 2 diabetes mellitus and is not receiving standard of care, is noncompliant with their prescribed treatment, or is in poor metabolic control.
  • a subject is not receiving anabolic/sex steroid (except for drugs for ADHD or hormone replacement therapies), glucocorticoid therapy or inhaled budesonide at dose greater than 400 pg/day or equivalent.
  • a subject does not have >1 closed epiphyses, is not HIV-positive or with advanced diseases such as AIDS or tuberculosis, is not hypersensitive to components of study medication.
  • a once daily rhGH is somatropin, somatrem, a somatropin biosimilar, or a somatrem biosimilar.
  • a subject is administered a once daily rhGH therapy at a dosage of about 0.16 mg to about 0.24 mg per kg body weight per week.
  • a subject received a once daily recombinant human growth hormone for at least three months.
  • a subject received a once daily recombinant human growth hormone for at least six months.
  • a method or use further comprises monitoring glucose levels in the subject.
  • a method or use demonstrates similar efficacy in a clinical study including participants divided into a test population and into a control population, wherein the test population receives (a) a once daily rhGH therapy for 12 months and then (b) a long- acting rhGH once weekly for 12 months, and the control population receives the long-acting rhGH once weekly for two years.
  • an effective amount or dose of a long-acting rhGH is about 0.66 mg per kg body weight per week. In some embodiments, an effective amount or dose of a long-acting rhGH is about 0.56 mg per kg body weight per week. In some embodiments, an effective amount or dose of a long-acting rhGH is about 0.48 mg per kg body weight per week. In some embodiments, an effective amount or dose of a long-acting rhGH is about 0.36 mg per kg body weight per week. In some embodiments, an effective amount or dose of a long-acting rhGH is about 0.25 mg per kg body weight per week.
  • an effective amount or dose of a long-acting rhGH is about 0.16 mg per kg body weight per week. In some embodiments, an effective amount or dose of a long-acting rhGH is about 0.1 mg per kg body weight per week to about 1 mg per kg body weight per week.
  • the long-acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.66 mg per kg body weight once weekly at any time of day. In some embodiments, the long-acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.56 mg per kg body weight once weekly at any time of day. In some embodiments, the long-acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.48 mg per kg body weight once weekly at any time of day. In some embodiments, the long- acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.36 mg per kg body weight once weekly at any time of day.
  • the long-acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.25 mg per kg body weight once weekly at any time of day. In some embodiments, the long-acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of about 0.16 mg per kg body weight once weekly at any time of day. In some embodiments, the long-acting rhGH is administered on the same day each week. In some embodiments, the time between two doses is at least three days. In some embodiments, the once daily rhGH therapy is administered at a dosage of about 0.16 to about 0.24 mg per kg body weight per week. In some embodiments, the long-acting rhGH is administered subcutaneously in the abdomen, thighs, buttocks, or upper arm.
  • a long-acting rhGH is administered by subcutaneous injection. In some embodiments, a long-acting rhGH is administered once weekly at any time of day. In some embodiments, a long-acting rhGH is administered on the same day each week. In some embodiments, a long-acting rhGH comprises the amino acid sequence of mature human growth hormone (hGH) (e.g., SEQ ID NO: 1) with one copy of CTP from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C- terminus (e.g., somatrogon). In some embodiments, along-acting rhGH comprises the amino acid sequence of SEQ ID NO: 2. In some embodiments, a CTP from the beta chain of human chorionic gonadotropin comprises the amino acid sequence of SEQ ID NO:3.
  • hGH mature human growth hormone
  • a CTP from the beta chain of human chorionic gonadotropin comprises
  • efficacy of a long-acting rhGH in a first subject who previously received a once daily rhGH therapy is comparable to efficacy of the long-acting rhGH in a second subject, who previously received only the long-acting rhGH and did not previously receive the once daily rhGH therapy, when there is no significant difference in clinical measurements between the first subject and the second subject.
  • comparable efficacy includes a comparable safety profile.
  • a first subject may refer to a group of subjects similarly treated.
  • a second subject may refer to a group of subjects similarly treated.
  • efficacy of a once daily rhGH or a long-acting rhGH is assessed by one or more clinical measurements: mean height velocity, annual height velocity, gain in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin-like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, and cholesterol values.
  • SDS gain in height standard deviation score
  • IGF-1 insulin growth factor-1
  • IGFBP-3 SDS insulin-like growth factor binding protein 3
  • pubertal status changed from Tanner 1 mean glucose, HbAlc, thyroid function, and cholesterol values.
  • annual height velocity, change in height standard deviation score (SDS), and bone maturation which are assessed every 12 months.
  • biochemical endpoints including IGF-1 levels, IGF-1 SDS, IGFBP-3 levels, and IGFBP-3 SDS are assessed on Day 4 after long-acting rhGH administration. In some embodiments, biochemical endpoints including IGF-1 levels, IGF-1 SDS, IGFBP-3 levels, and IGFBP-3 SDS, are assessed on day 4 following administration of a long-acting rhGH, including up to 24 hours before day 4 (i.e., from day 3 to day 4).
  • efficacy is determined by monitoring glucose levels in a subject. In some embodiments, efficacy of a once daily rhGH or a long-acting rhGH is indicated by continued bone maturation.
  • efficacy is determined by measuring or monitoring trunk fat mass, lean body mass, trunk fat mass as a percentage of total fat mass, IGF-1 levels, or a combination thereof, in a subject (e.g., an adult).
  • a method of treating growth hormone deficiency in a population of participants in need thereof demonstrates similar efficacy in a clinical study including participants divided into a test population and into a control population, wherein the test population receives (a) the once daily rhGH therapy for 12 months and then (b) the long- acting rhGH once weekly for 12 months, and the control population receives the long-acting rhGH once weekly for two years.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) to the subject at an initial dose level; ii) taking a measurement of an IGF-1 level in the subject; and iii) administering the long-acting rhGH to the subject at a modified dose level based on the IGF-1 level in the subject.
  • a long-acting rhGH comprises the amino acid sequence of SEQ ID NO:2.
  • a long-acting rhGH is administered once a week to a female of three (3) to ⁇ 10 years of age at an initial dose level or at a modified dose level of about 0.66 mg/kg, about 0.56 mg/kg, about 0.48 mg/kg, about 0.36 mg/kg, about 0.25 mg/kg, or about 0.16 mg/kg.
  • a subject with a growth hormone deficiency has impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV has a SDS of ⁇ -0.7]) and an IGF-1 level SDS > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV height and height velocity
  • IGF-1 level SDS > 1 SD below the age and sex-standardized mean IGF-1 level
  • a long-acting rhGH is administered once a week to a male of three (3) to ⁇ 11 years of age at an initial dose level or at a modified dose level of about 0.66 mg/kg, about 0.56 mg/kg, about 0.48 mg/kg, about 0.36 mg/kg, about 0.25 mg/kg, or about 0.16 mg/kg.
  • a subject with a growth hormone deficiency has impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV has a SDS of ⁇ -0.7]) and an IGF-1 level SDS > 1 SD below the age and sex-standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV height and height velocity
  • IGF-1 level SDS > 1 SD below the age and sex-standardized mean IGF-1 level
  • a long-acting rhGH is administered once a week to an adult at an initial dose level or at a modified dose level of about 1 mg/week, about 1.2 mg/week, about 1.45 mg/week, about 1.82 mg/week, about 2 mg/week, about 2.18 mg/week, about 2.5 mg/week, about 2.54 mg/week, about 2.75 mg/week, about 2.9 mg/week, about 3 mg/week, about 3.25 mg/week, about 3.5 mg/week, about 4 mg/week, about 4.5 mg/week, about 5 mg/week, or about 5.5 mg/week.
  • a subject with a growth hormone deficiency has impaired height and height velocity (HV) (e.g., annualized HV below the 25 th percentile for chronological age [HV has a SDS of ⁇ -0.7]) and an IGF-1 level SDS > 1 SD below the age and sex- standardized mean IGF-1 level (e.g., SDS ⁇ -1).
  • HV height and height velocity
  • IGF-1 level SDS > 1 SD below the age and sex- standardized mean IGF-1 level
  • an initial dose of a long-acting rhGH is about 0.66 mg/kg body weight/week. In some embodiments, an initial dose of a long-acting rhGH for a pediatric patient or subject is about 0.66 mg/kg body weight/week.
  • a method of treating growth hormone deficiency in a subject with a long acting rhGH includes decreasing an initial dose of long-acting rhGH based on two repeated day 4 (-1) levels (i.e., from day 3 to day 4) of IGF-1 >+2.0 SDS.
  • day 4 (-1) is understood to refer to days after administration of a long-acting rhGH. In some embodiments, day 4 (-1) is understood to refer to optimally about 96 hours after administration of a long-acting rhGH.
  • an IGF-1 level is measured in serum or plasma. In some embodiments, an IGF-1 level is measured on day 4 following administration of an initial dose of a long-acting rhGH, including up to 24 hours before day 4 (i.e., from day 3 to day 4). In some embodiments, an IGF-1 level in a subject has an SDS of > +2 after administration of a long- acting rhGH at an initial dose level. In some embodiments, an IGF-1 level is measured from day 3 to day 4 after administration of a long-acting rhGH at an initial dose level and the IGF-1 level in a subject has an SDS of > +2.
  • a method of treating growth hormone deficiency in a subject with a long-acting rhGH includes decreasing an initial dose of long-acting rhGH based on two repeated day 4 (-1) levels (i.e., from day 3 to day 4) of IGF-1 >+2.0 SDS.
  • Day 4 (-1) is understood to refer to days after administration of a long-acting rhGH.
  • day 4 (-1) is understood to refer to optimally about 96 hours after administration of a long-acting rhGH.
  • an IGF-1 level in a subject who is receiving weekly administration of a long-acting rhGH at an initial dose level has an SDS > +2 on two consecutive measurements taken 4 to 6 weeks apart. Two consecutive measurements of IGF-1 taken 4 to 6 weeks apart is understood to include taking a second measurement of IGF-1 within 4 to 6 weeks after the first measurement of IGF-1.
  • a modified dose level is 15% lower than an initial dose level. In some embodiments, a modified dose level is about 0.56 mg per kg body weight per week.
  • a method further comprises taking a measurement of an IGF-1 level in a subject at least 4 weeks after administration of a long acting rhGH at a modified dose level.
  • an IGF-1 level in a subject has an SDS > +2 after administration of a long-acting rhGH at a modified dose level.
  • a method further comprises administering a long-acting rhGH to a subject at a further modified dose level when an IGF-1 level in the subject has a SDS > +2 after administering the long-acting rhGH at a modified dose level (e.g., 15% lower than an initial dose level).
  • a further modified dose level of long-acting rhGH is 30% lower than an initial dose level of the long-acting rhGH.
  • a further modified dose level of long-acting rhGH is 15% lower than a modified dose level of long-acting rhGH.
  • a further modified dose level of a long-acting rhGH is administered once per week.
  • a further modified dose level of long-acting rhGH is about 0.48 mg per kg body weight per week.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.66 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.56 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.48 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.36 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.25 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.16 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.66 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.56 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.48 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.36 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.25 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of
  • rhGH human growth hormone
  • IGF-1 insulin growth factor-1
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 0.16 mg per kg of body weight per week; ii) taking at least two measurements of an insulin growth factor-1 (IGF-1) level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; iii) administering the long-acting rhGH to the subject at a modified dose level wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the at least one measurement of an IGF-1 level in the subject has an SDS of > +2; and v)
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.66 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.56 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.48 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.36 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.25 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in a subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.16 mg per kg body weight per week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart is > +2 SDS; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 15% lower, or is between 10% to 20% lower, than the initial dose level; iv) taking a measurement of the IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level is > +2 SDS; v
  • a long-acting rhGH is administered to a subject at a further modified dose level, wherein the further modified dose level is 30% lower than the initial dose level of long-acting rhGH.
  • the subject is a pediatric subject.
  • the pediatric subject is a female of 3 to ⁇ 10 years of age or a male of 3 to ⁇ 11 years of age.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age; ii) taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of > +1.5; and iii) administering the long-acting rhGH to
  • the method further comprises taking an additional at least one measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level, and administering the long-acting rhGH to the subject at a further modified dose level.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age; ii) taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of > +1.5; and iii) administering the long-acting rhGH to
  • the method further comprises taking an additional at least one measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level, and administering the long-acting rhGH to the subject at a further modified dose level.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age; ii) taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of ⁇ -0.5; and iii) administering the long-acting rh
  • SDS standard deviation score
  • the method further comprises taking an additional at least one measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level, and administering the long-acting rhGH to the subject at a further modified dose level.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age; ii) taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of ⁇ -0.5; and iii) administering the long-acting rh
  • SDS standard deviation score
  • the method further comprises taking an additional at least one measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level, and administering the long-acting rhGH to the subject at a further modified dose level.
  • a long-acting rhGH is administered once a week at an initial dose level, at a modified dose level or at a further modified dose level.
  • a subject is an adult or a child.
  • an IGF-1 level is measured in serum or plasma.
  • a modified dose level is about 0.56 mg per kg body weight per week.
  • a further modified dose level is about 0.48 mg per kg body weight per week.
  • a long-acting rhGH is administered to a subject in a dose ranging from about 2 mg to about 24 mg. In other embodiments, a long-acting rhGH is administered to a subject in a dose ranging from about 1 mg to about 11 mg. In other embodiments, a long-acting rhGH is administered to a subject in a dose ranging from about 2 mg to about 12 mg. In other embodiments, a long-acting rhGH is administered to a subject in a dose ranging from about 0.5 mg to about 60 mg. In other embodiments, a long-acting rhGH is administered to a subject in a dose ranging from about 0.5 mg to about 30 mg. In other embodiments, a long-acting rhGH is administered to subject in a dose ranging from about 0.5 mg to about 110 mg.
  • a long-acting rhGH is administered to a subject in a dose of about 0.13 mg, about 0.25 mg, about 0.36 mg, about 0.48 mg, about 0.56 or about 0.66 mg per kg body weight per week. In some embodiments, a long-acting rhGH is administered to a subject in a dose of about 0.66 mg per kg body weight. In some embodiments, a long-acting rhGH is administered to a subject in a dosage of about 0.66 mg per kg body weight per week. [0174] In some embodiments, a dosage regimen comprises administering a long-acting rhGH (e.g., somatrogon) in a dose of about 0.66 mg per kg body weight per week.
  • a long-acting rhGH e.g., somatrogon
  • a recommended dose of a long-acting rhGH is about 0.66 mg/kg body weight administered once weekly by subcutaneous (SC) injection.
  • SC subcutaneous
  • weekly therapy with a long-acting rhGH may be initiated at a dose of about 0.66 mg/kg/wk on the day following the patient’s last daily injection.
  • regular monitoring of IGF-1 concentrations is recommended during treatment with a long-acting rhGH (e.g., somatrogon).
  • dosage of a long-acting rhGH may be adjusted as necessary, based on growth velocity, body weight, and serum insulin-like growth factor 1 (IGF-1) concentrations.
  • IGF-1 serum insulin-like growth factor 1
  • samples should be drawn 4 days after the prior dose of a long-acting rhGH (e.g., somatrogon)
  • optionally target IGF-1 standard deviation score (SDS) should be the upper normal range not exceeding 2 SDS.
  • a dose of a long-acting rhGH should be reduced by 15%.
  • a patient may require more than one dose reduction.
  • growth rates during the first year of treatment with a long-acting rhGH should be monitored.
  • a long-acting rhGH is administered to an adult male subject 50 years old or younger at a dosage of about 2.5 mg/week or 1.82 mg/wk. In some embodiments, a long-acting rhGH is administered to an adult male subject older than 50 years old at a dosage of about 2 mg/week or 1.45 mg/week. In some embodiments, a long-acting rhGH is administered to an adult female subject 50 years old or younger at a dosage of about 3 mg/week or 2.18 mg/wk. In some embodiments, a long-acting rhGH is administered to an adult female subject older than 50 years old at a dosage of about 2.5 mg/week or 1.2 mg/week.
  • an adult female subject is not on oral estrogen. In some embodiments, an adult female subject is on oral estrogen. In other embodiments, a long-acting rhGH is administered to an adult female subject 50 years old or younger at a dosage of about 4 mg/week or 2.9 mg/week. In other embodiments, a long-acting rhGH is administered to an adult female subject 50 years old or younger who is on oral estrogen at a dosage of about 4 mg/week or about 2.9 mg/week. In other embodiments, a long-acting rhGH is administered to an adult female subject older than 50 years old at a dosage of about 3.5 mg/week or 2.54 mg/week. In other embodiments, a long- acting rhGH is administered to an adult female subject older than 50 years old who is on oral estrogen at a dosage of about 3.5 mg/week or about 2.54 mg/week
  • a dosage regimen comprises administering a long-acting rhGH (e.g., somatrogon) to an adult at an initial dose level, wherein the initial dose level ranges from about 1 mg/week to about 5 mg/week (e.g., about 1 mg/week, about 1.2 mg/week, about 1.45 mg/week, about 1.82 mg/week, about 2 mg/week, about 2.18 mg/week, about 2.5 mg/week, about 2.54 mg/week, about 2.9 mg/week, about 3 mg/week, about 3.25 mg/week, about 3.5 mg/week, about 4 mg/week, about 4.5 mg/week, or about 5 mg/week).
  • rhGH e.g., somatrogon
  • a method of treating growth hormone deficiency comprises administering a long-acting recombinant human growth hormone (e.g., comprising the amino acid sequence of SEQ ID NO:2) to a subject (e.g., an adult) at an initial dose level, monitoring the subject for an adverse event (AE), and administering the long-acting rhGH to the subject at a modified dose level that is 25% lower than the initial dose level if the adverse event is moderate.
  • a long-acting recombinant human growth hormone e.g., comprising the amino acid sequence of SEQ ID NO:2
  • AE adverse event
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency comprises administering a long-acting recombinant human growth hormone (e.g., comprising the amino acid sequence of SEQ ID NO:2) to a subject (e.g., an adult) at an initial dose level, monitoring the subject for an adverse event (AE), and administering the long-acting rhGH to the subject at a modified dose level that is 25% lower than the initial dose level if the adverse event is moderate.
  • an adverse event is at least one of the following: edema, hypertension, carpal tunnel and glucose intolerance.
  • a method of treating growth hormone deficiency comprises administering a long-acting recombinant human growth hormone (e.g., comprising the amino acid sequence of SEQ ID NO:2) to a subject (e.g., an adult) at an initial dose level, monitoring the subject for an adverse event (AE), and administering the long-acting rhGH to the subject at a modified dose level that is 50% lower than the initial dose level if the adverse event is severe.
  • a modified dose level is a skipped dose if the adverse event is severe.
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency comprises administering a long-acting recombinant human growth hormone (e.g., comprising the amino acid sequence of SEQ ID NO:2) to a subject (e.g., an adult) at an initial dose level, monitoring the subject for an adverse event (AE), and administering the long-acting rhGH to the subject at a modified dose level that is 50% lower than the initial dose level if the adverse event is severe.
  • a modified dose level is a skipped dose if the adverse event is severe.
  • an adverse event is at least one of the following: edema, hypertension, carpal tunnel and glucose intolerance.
  • an AE is characterized as mild when the AE results in transient or mild discomfort; there is no limitation in activity; and no medical intervention and/or therapy is required.
  • an AE is characterized as moderate when the AE results in a mild to moderate limitation in activity, some assistance may be needed; and no or minimal medical intervention and/or therapy is required.
  • an AE is characterized as severe when the AE results in a marked limitation in activity, some assistance is usually required; medical intervention and/or therapy is required; and hospitalization is possible.
  • a dose level (e.g., an initial dose level, a modified dose level, a further modified dose level, etc) may be reduced by 25% such that the new dose ranges from about 1.5 mg/week to about 3 mg/week based on age, gender and/or estrogen status.
  • the dose level (e.g., an initial dose level, a modified dose level, a further modified dose level, etc) that is reduced by 25% is about 2 mg/week, about 2.18 mg/week, about 2.5 mg/week, about 2.54 mg/week, about 2.9 mg/week, about 3 mg/week, about 3.25 mg/week, or about 3.5 mg/week.
  • a dose level (e.g., an initial dose level, a modified dose level, a further modified dose level, etc) may be reduce by 50% such that the new dose ranges from about 1 mg/week to about 2 mg/week based on age, gender and/or estrogen status.
  • the dose level (e.g., an initial dose level, a modified dose level, a further modified dose level, etc) that is reduced by 50% is about 2 mg/week, about 2.18 mg/week, about 2.5 mg/week, about 2.54 mg/week, about 2.9 mg/week, about 3 mg/week, about 3.25 mg/week, about 3.5 mg/week, or about 4 mg/week.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises i) administering a long-acting recombinant human growth hormone (rhGH) to the subject at an initial dose level; ii) taking a measurement an IGF-1 level in the subject; and iii) administering the long-acting rhGH to the subject at a modified dose level based on the IGF-1 level in the subject.
  • a long-acting rhGH comprises the amino acid sequence of SEQ ID NO:2.
  • a long-acting rhGH is administered once a week at an initial dose level or at a modified dose level.
  • a subject with growth hormone deficiency has not received prior rhGH therapy.
  • an initial dose of long- acting rhGH ranges from about 1 mg/week to about 5 mg/week for an adult with growth hormone deficiency.
  • an initial dose of long-acting rhGH is: about 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • an IGF-1 level is measured in serum or plasma. In some embodiments, an IGF-1 level is measured at day 3 to day 4 after administration of a long-acting rhGH at an initial dose level. In some embodiments, an IGF-1 level in a subject has a SDS of > +1.5 after administration of a long-acting rhGH at an initial dose level. In some embodiments, an IGF-1 level in a subject measured at day 3 to day 4 after administration of a long-acting rhGH at an initial dose level has an SDS of > +1.5.
  • a modified dose level is about 0.5 mg/week lower than an initial dose level. In some embodiments, a modified dose level is about 0.75 mg/week lower than an initial dose level.
  • an IGF-1 level in an adult male 50 years of age or less who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.5 mg per week has an SDS of > +1.5
  • the adult male is subsequently administered the long-acting rhGH at a modified dose level of about 2.0 mg per week.
  • an IGF-1 level in an adult male greater than 50 years of age who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.0 mg per week has an SDS of > +1.5
  • the adult male is subsequently administered the long-acting rhGH at a modified dose level of about 1.5 mg per week.
  • an IGF-1 level in an adult female 50 years of age or less who is not on oral estrogen but who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 3.0 mg per week has an SDS of > +1.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 2.5 mg per week.
  • an IGF-1 level in an adult female greater than 50 years of age who is not on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.5 mg per week has an SDS of > +1.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 2.0 mg per week.
  • an IGF-1 level in an adult female 50 years of age or less who is on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 4.0 mg per week has an SDS of > +1.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 3.25 mg per week.
  • an IGF-1 level in an adult female greater than 50 years of age who is on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 3.5 mg per week has an SDS of > +1.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 2.75 mg per week.
  • a method further comprises administering a long-acting rhGH to a subject (e.g., adult male, adult female on oral estrogen, adult female not on oral estrogen) at a further modified dose level when an IGF-1 level in the subject has an SDS of > +1.5 when measured 3 to 4 days after administration of the long-acting rhGH at a modified dose level.
  • a further modified dose level is about 0.5 mg/week lower than a modified dose if the subject is a male or if the subject is a female who is not being treated with estrogen.
  • a further modified dose level is about 1.0 mg/week lower than an initial dose level if the subject is a male or if the subject is a female who it not being treated with estrogen. In some embodiments, a further modified dose level is about 0.75 mg/week lower than a modified dose if the subject is a female who is being treated with estrogen. In some embodiments, a further modified dose level is about 1.5 mg/week lower than an initial dose level if the subject is a female who is being treated with estrogen.
  • an IGF-1 level in a subject has an SDS of ⁇ -0.5 after administration of a long-acting rhGH at an initial dose level.
  • an IGF-1 level in an adult subject measured at day 3 to day 4 after administration of a long-acting rhGH at an initial dose level has an SDS of ⁇ -0.5.
  • a modified dose level is about 1.0 mg/week higher than an initial dose level. In some embodiments, a modified dose level is about 1.5 mg/week higher than an initial dose level.
  • an IGF-1 level in an adult male 50 years of age or less who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.5 mg per week has a SDS of ⁇ -0.5
  • the adult male is subsequently administered the long-acting rhGH at a modified dose level of about 3.5 mg per week.
  • an IGF-1 level in an adult male greater than 50 years of age who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.0 mg per week has an SDS of ⁇ -0.5
  • the adult male is subsequently administered the long-acting rhGH at a modified dose level of about 3.0 mg per week.
  • an IGF-1 level in an adult female 50 years of age or less who is not on oral estrogen but who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 3.0 mg per week has an SDS of ⁇ -0.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 4.0 mg per week.
  • an IGF-1 level in an adult female greater than 50 years of age who is not on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 2.5 mg per week has an SDS of ⁇ -0.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 3.5 mg per week.
  • an IGF-1 level in an adult female 50 years of age or less who is on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 4.0 mg per week has an SDS of ⁇ -0.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 5.5 mg per week.
  • an IGF-1 level in an adult female greater than 50 years of age who is on oral estrogen and who is receiving weekly administration of a long-acting rhGH at an initial dose level of about 3.5 mg per week has an SDS of ⁇ -0.5
  • the adult female is subsequently administered the long-acting rhGH at a modified dose level of about 5.0 mg per week.
  • a method further comprises administering a long-acting rhGH to a subject (e.g., adult male, adult female on oral estrogen, adult female not on oral estrogen) at a further modified dose level when an IGF-1 level in the subject has an SDS of ⁇ -0.5 when measured 3 to 4 days after administering the long-acting rhGH at a modified dose level.
  • a further modified dose level is about 1.0 mg/week higher than a modified dose if the subject is a male or if the subject is a female who is not being treated with estrogen.
  • a further modified dose level is about 2.0 mg/week higher than an initial dose level if the subject is a male or if the subject is a female who it not being treated with estrogen.
  • a further modified dose level is about 1.5 mg/week higher than a modified dose if the subject is a female who is being treated with estrogen. In some embodiments, a further modified dose level is about 3.0 mg/week higher than an initial dose level if the subject is a female who is being treated with estrogen.
  • a method may further comprise administering the long-acting rhGH one, two, three, four, five, six, seven, eight, nine, ten or more times, taking a measurement of an IGF-1 level in a subject at day 3 to day 4 after each administration and reducing the dose level of long-acting rhGH by about 0.5 mg/week or about 0.75 mg/week if the IGF-1 level has an SDS of > +1.5 or increasing the dose level of long-acting rhGH by about 1.0 mg/week or about 1.5 mg/week if the IGF-1 level has an SDS of ⁇ -0.5.
  • a subject e.g., an adult
  • a long acting recombinant growth hormone has a decreased trunk fat mass, has an increased lean body mass, has a decreased trunk fat mass as a percentage of total fat mass, has normalized IGF-1 levels, or a combination thereof.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5.
  • the long-acting rhGH is administered once a week at an initial dose level or a modified dose level.
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5.
  • rhGH human growth hormone
  • the long-acting rhGH is administered once a week at an initial dose level or a modified dose level.
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.0 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5.
  • the long-acting rhGH is administered once a week at an initial dose level or a modified dose level.
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5.
  • the long-acting rhGH is administered once a week at an initial dose level or a modified dose level.
  • the initial dose is 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level has an SDS
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level has an S
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level has an S
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of > +1.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level has an S
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5; and iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS of ⁇ -0.5; taking an additional at least one measurement of the IGF-1 level in the subject after administering the modified dose level, wherein the IGF-1 level after administering the modified dose level
  • a method of treating growth hormone deficiency in an adult subject in need thereof comprises: i) administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; ii) taking a measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5 or > +1.5 ; iii) administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS level of > +1.5 or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the
  • a defined range is a therapeutic dose range achieved by administering a long-acting rhGH provided herein.
  • a defined range is one in which the C max and C trough of the sinusoidal behavior of IGF-1 are maintained following consecutive administrations of a long-acting rhGH provided herein.
  • a defined range is a therapeutic dose range for consecutively administering a long-acting rhGH provided herein with excellent responsiveness in a subject and with minimal need for dose modification.
  • a defined range is comparable to the range of IGF-1 levels in individuals that are considered to be normal.
  • a defined range is the normal range of IGF-1 levels/values in normal individuals.
  • the defined range is within the normal range when IGF-1 SDS values are within ⁇ 2 SDS.
  • a long-acting rhGH described herein is used in the same manner as unmodified growth hormones.
  • a long-acting rhGH described herein has an increased circulating half-life and plasma residence time, decreased clearance, and increased clinical activity in vivo.
  • these conjugates are administered less frequently than unmodified growth hormones.
  • a long-acting rhGH as described herein is administered once a week to once every two weeks.
  • a long-acting rhGH as described herein is administered once every two weeks to once every three weeks.
  • decreased frequency of administration will result in improved patient compliance leading to improved treatment outcomes, as well as improved patient quality of life.
  • growth hormone CTP conjugates having the molecular weight and linker structure of the conjugates of this invention have an improved potency, improved stability, elevated AUC levels, enhanced circulating half-life.
  • growth hormones having the molecular weight and linker structure of the conjugates of this invention have an improved potency, improved stability, elevated AUC levels, enhanced circulating half-life.
  • a therapeutically effective amount of a conjugated growth hormone is the amount of conjugate necessary for the in vivo measurable expected biological activity.
  • a growth hormone utilized according to the teachings disclosed herein exhibits increased potency.
  • attachment of CTP sequence to both the amino and carboxy termini of a growth hormone results in prolonged in-vivo activity.
  • a therapeutically effective amount of a long-acting rhGH described herein is determined according to factors as the exact type of condition being treated, the condition of the patient being treated, as well as the other ingredients in the composition.
  • a therapeutically effective amount of a conjugated growth hormone is about 0.1 mg to about 1 mg per kg body weight administered once a week.
  • a therapeutically effective amount of a conjugated growth hormone is about 0.5 mg to about 0.8 mg per kg body weight, administered once a week. In other embodiments, a therapeutically effective amount of a conjugated growth hormone is about 0.6 mg to about 0.7 mg per kg body weight, administered once a week. In other embodiments, a therapeutically effective amount of a conjugated growth hormone is about 0.66 mg per kg body weight, administered once a week. In other embodiments, a therapeutically effective amount of a conjugated growth hormone is 0.66 mg per kg body weight, administered subcutaneously once a week. In other embodiments, a pharmaceutical composition comprising a conjugated growth hormone is formulated at strength effective for administration by various means to a human patient.
  • the methods of the invention include increasing the compliance in the use of GH therapy, comprising providing to a subject in need thereof, a long- acting rhGH described herein, thereby increasing compliance in the use of growth hormone therapy.
  • methods provided herein include increasing the compliance of subjects afflicted with chronic illnesses that are in need of a GH therapy.
  • methods of the invention enable reduction in the dosing frequency of a GH by modifying the GH with CTPs as described hereinabove.
  • the term compliance comprises adherence.
  • methods of the invention include increasing the compliance of patients in need of a GH therapy by reducing the frequency of administration of the GH.
  • reduction in the frequency of administration of the GH is achieved due to the CTP modifications which render the CTP -modified GH more stable.
  • reduction in frequency of administration of the GH is achieved as a result of increasing half-life of the growth hormone.
  • reduction in frequency of administration of a GH is achieved as a result of increasing clearance time of the GH.
  • reduction in the frequency of administration of a growth hormone is achieved as a result of increasing the AUC measure of the growth hormone.
  • the present teachings provide a method of decreasing body fat in anon-human subject, comprising administering to said subject a therapeutically effective amount of an expression vector comprising a polynucleotide, said polynucleotide consisting of a non-human growth hormone, one chorionic gonadotropin carboxy terminal peptide (CTP) attached to the amino terminus of said non-human growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of said non-human growth hormone, and wherein said polypeptide optionally consists of a signal peptide attached to the amino terminus of said one CTP, thereby inducing growth or weight gain in a non-human subject.
  • an expression vector comprising a polynucleotide, said polynucleotide consisting of a non-human growth hormone, one chorionic gonadotropin carboxy terminal peptide (CTP) attached to the amino terminus of said non-human growth hormone, and two chorionic gonadotropin
  • the present teachings provide a method of increasing insulin- like growth factor (IGF-1) levels in a human subject, comprising administering to said subject a therapeutically effective amount of a polypeptide comprising a growth hormone, one chorionic gonadotropin carboxy terminal peptide (CTP) attached to the amino terminus of said growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of said growth hormone, thereby increasing IGF-1 levels in said subject.
  • IGF-1 insulin- like growth factor
  • the present teachings provide a method of increasing insulin- like growth factor (IGF-1) levels in anon-human subject, comprising administering to said subject a therapeutically effective amount of an expression vector comprising a polynucleotide, said polynucleotide consisting of a non-human growth hormone, one chorionic gonadotropin carboxy terminal peptide (CTP) attached to the amino terminus of said non-human growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of said non human growth hormone, and wherein said polypeptide optionally consists of a signal peptide attached to the amino terminus of said one CTP, thereby inducing growth or weight gain in a non-human subject.
  • IGF-1 insulin- like growth factor
  • the present teachings provide a method of improving the area under the curve (AUC) of a growth hormone in a subject, comprising administering to said subject a therapeutically effective amount of a long-acting rhGH, thereby reducing the dosing frequency of a growth hormone in a subject.
  • AUC area under the curve
  • the methods provide a long-acting rhGH for stimulating muscle growth.
  • increasing IGF-1 levels in a human subject may be effective in treating, preventing or suppressing type 1 diabetes, type 2 diabetes, amyotrophic lateral sclerosis (ALS aka “Lou Gehrig's Disease”), severe bum injury and myotonic muscular dystrophy (MMD).
  • ALS amyotrophic lateral sclerosis
  • MMD myotonic muscular dystrophy
  • the methods utilize any of the long-acting rhGH described herein for stimulating bone growth.
  • the bone growth of the treated patient correlates with the chronological age of said patient.
  • the present invention is directed to a method of treatment that provides efficacious bone maturation rates.
  • the methods provide a nucleic acid sequence encoding a long- acting rhGH described herein, for stimulating bone growth.
  • the methods provide a nucleic acid sequence encoding long- acting rhGH as described herein.
  • the methods provide a nucleic acid sequence encoding a long-acting rhGH for stimulating muscle growth, increasing cardiac function, stimulating bone growth, maintaining muscle integrity, balancing muscle metabolism, inducing muscle buildup, inducing de-novo muscle build-up, enhancing bone load, treating symptoms associated with osteoporosis, treating a wasting disease, increasing lipolysis, improving fluid balance, treating osteoporosis, improving lung function, improving immunity, regrowing a vital organ, increasing sense of well-being, restoring REM sleep, or any combination thereof.
  • a nucleic acid molecule encoding a growth hormone as described herein encodes any amino acid sequence of a growth hormone known to one of skill in the art.
  • the methods provide a long-acting rhGH for the treatment of wasting disease, AIDS, cachexia, or hGH deficiency.
  • the methods provided herein are employed in veterinary medicine.
  • the present teachings provide treatment of domesticated mammals which are maintained as human companions (e.g., dogs, cats, horses), which have significant commercial value (e.g., dairy cows beef cattle, sporting animals), which have significant scientific value (e.g., captive or free specimens of endangered species), or which otherwise have value.
  • the present teachings provide a method of inducing growth or weight gain in a human subject, comprising the step of administering to said human subject a therapeutically effective amount of an expression vector comprising a polynucleotide consisting of a nucleic acid encoding a long-acting rhGH comprising human growth hormone, one chorionic gonadotropin CTP attached to the amino terminus of said non-human growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of the human growth hormone, thereby inducing growth or weight gain in the human subject.
  • the present teachings provide a method of inducing weight loss or decreasing body fat in a subject, comprising administering to said subject a long-acting rhGH provided herein, thereby inducing weight loss or decreasing body fat in said subject.
  • the present teachings provide a method of decreasing trunk fat mass, increasing lean body mass, decreasing trunk fat mass as a percentage of total fat mass, normalizing IGF-1 levels, or a combination thereof, in a subject (e.g., an adult).
  • said subject is obese.
  • said subject is overweight.
  • the present teachings provide a method of decreasing body fat in a non-human subject, comprising administering to said subject a long-acting rhGH provided herein, thereby inducing growth or weight gain in a non-human subject.
  • the present teachings provide a method of decreasing fat deposits in a subject. In other embodiments, the present teachings provide a method of increasing muscle mass in a subject. In other embodiments, the present teachings provide a method of promoting muscle growth in a subject. In other embodiments, the present teachings provide a method of increasing muscle to fat ratio. In other embodiments, the present teachings provide a method of decreasing body mass index (BMI) or Quetelet index.
  • BMI body mass index
  • Quetelet index quetelet index
  • growth is measured by weight gain. In other embodiments, growth is measured by height gain. In other embodiments, growth is measured by weight gain. In other embodiments, growth is measured by muscle mass gain. In other embodiments, growth is measured by weight gain. In other embodiments, growth is measured by bone mass gain. In other embodiments, growth is measured by weight gain. In other embodiments, growth is measured by muscle mass gain. In other embodiments, the weight gain is due to bone and/or muscle mass gain. In other embodiments, growth is measured by any known measure known to one of skill in the art.
  • human growth hormone polypeptides can be used to treat a subject, with conditions related to growth and weight, such as a growth deficiency disorder,
  • AIDS wasting, aging, impaired immune function of HIV-infected subjects a catabolic illness, surgical recovery, a congestive cardiomyopathy, liver transplantation, liver regeneration after hepatectomy, chronic renal failure, renal osteodystrophy, osteoporosis, achondroplasia/hypochondroplasia, skeletal dysplasia, a chronic inflammatory or nutritional disorder such as Crohn's disease, short bowel syndrome, juvenile chronic arthritis, cystic fibrosis, male infertility, X-linked hypophosphatemic rickets, Down's syndrome, Spina bifida, Noonan Syndrome, obesity, impaired muscle strength and fibromyalgia.
  • interferon polypeptides are used to treat a subject, with a variety of conditions such as hairy cell leukemia (HCL), Kaposi's sarcoma (KS), chronic myelogenous leukemia (CML), chronic Hepatitis C (CHC), condylomata acuminata (CA), chronic Hepatitis B, malignant melanoma, follicular non-Hodgkin's lymphoma, multiple sclerosis, chronic granulomatous disease, Mycobacterium avium complex (MAC), pulmonary fibrosis and osteoporosis.
  • HCL hairy cell leukemia
  • KS Kaposi's sarcoma
  • CML chronic myelogenous leukemia
  • CHC chronic Hepatitis C
  • CA condylomata acuminata
  • CA condylomata acuminata
  • follicular non-Hodgkin's lymphoma multiple sclerosis
  • the polypeptides can be provided to the individual per se. In some embodiments, the polypeptides can be provided to the individual as part of a pharmaceutical composition where it is mixed with a pharmaceutically acceptable carrier.
  • the present teachings provide a process for making a long- acting rhGH pharmaceutical composition for a once a week administration to a subject having a growth hormone deficiency, the process comprising the steps of: a. modifying a growth hormone by attaching one chorionic gonadotropin carboxy terminal peptide (CTP) attached to the amino terminus of said growth hormone, and two chorionic gonadotropin CTPs attached to the carboxy terminus of said growth hormone; b. mixing the modified growth hormone in step a. with a buffer and a tonicity agent; and, c. pre-filling a pen or syringe with the mixture produced in step b.
  • CTP carboxy terminal peptide
  • the present teachings provide a process for filling a pen or syringe with a formulation provided herein comprising the steps of: a. formulating a once a week dosage form of said long-acting rhGH having a pre determined amount of long-acting rhGH; and, b. filling the pen or syringe with the formulation.
  • the present teachings provide pharmaceutical formulations comprising a long-acting rhGH comprising: a growth hormone, a single chorionic gonadotropin carboxy terminal peptide attached to the amino terminus of the growth hormone, and two chorionic gonadotropin carboxy terminal peptides attached to the carboxy terminus of the growth hormone.
  • the present teachings provide a pharmaceutical formulation comprising a long-acting rhGH comprising a growth hormone, a single chorionic gonadotropin carboxy terminal peptide attached to the amino terminus of the growth hormone, two chorionic gonadotropin carboxy terminal peptides attached to the carboxy terminus of the growth hormone, and a signal peptide attached to the amino terminus of one chorionic gonadotropin carboxy terminal peptide.
  • a pharmaceutical formulation further comprises a buffer and a tonicity agent.
  • a buffer is 10 mM citrate and the tonicity agent is 147 mM NaCl.
  • a formulation is at about a pH of 66 In other embodiments, a formulation is at about a pH of 6 5 In other embodiments, a formulation is at about a pH of 64 In some embodiments, a buffer is 10 mM citrate, a tonicity agent is 147 mM NaCl, and the pH is about 6.6. In other embodiments, a formulation is at about a pH range of 6.0-6.8.
  • a formulation is a liquid formulation.
  • the present teachings provide a formulation comprising a long-acting rhGH, wherein said formulation has increased stability.
  • a formulation is stable for at least one year. In other embodiments, a formulation is stable for at least two years.
  • provided herein are a once weekly dosage forms comprising pharmaceutical compositions and pharmaceutical formulations provided herein.
  • any of the compositions provided herein may comprise at least two CTP sequences bound to a protein of interest, in any form.
  • the present teachings provide combined preparations.
  • "a combined preparation” defines especially a "kit of parts" in the sense that the combination partners as defined above can be dosed independently or by use of different fixed combinations with distinguished amounts of the combination partners i.e., simultaneously, concurrently, separately or sequentially.
  • the parts of the kit of parts can then, e.g., be administered simultaneously or chronologically staggered, that is at different time points and with equal or different time intervals for any part of the kit of parts.
  • the ratio of the total amounts of the combination partners in some embodiments, can be administered in the combined preparation.
  • the combined preparation can be varied, e.g., in order to cope with the needs of a patient subpopulation to be treated or the needs of the single patient which different needs can be due to a particular disease, severity of a disease, age, sex, or body weight as can be readily made by a person skilled in the art.
  • excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
  • excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols.
  • the long-acting rhGH provided herein is subcutaneously administered to a subject.
  • the preparation is administered in a local rather than systemic manner, for example, via injection of the preparation directly into a specific region of a patient's body.
  • the long-acting rhGH is injected below the skin (subcutaneous injection).
  • the long-acting rhGH is injected below the skin.
  • the long-acting rhGH is injected into the muscle.
  • the long-acting rhGH is injected into the muscle (intramuscular injection).
  • suitable routes of administration include oral, rectal, transmucosal, transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, or intraocular injections.
  • the pharmaceutical composition or the pharmaceutical composition is administered via injection to a subject, it is done so using a prefilled syringe or a pen.
  • compositions provided herein can be subcutaneously administered to a subject using one or more of several modes of administration, including, but not limited to, syringes, pens, pumps, or any combination thereof.
  • syringes single-use syringes be used to administer discrete bolus injections of the compositions.
  • Syringes useful for administrations of the compositions provided herein include, for example without limitation, syringes which can be designed to hold about 1 ml, about 1 1 ml, about 1.2 ml, about 1.3 ml, about 1.4 ml, about 1.5 ml, about 1.6 ml, about 1.7 ml, about 1.8 ml, about 1.9 ml, or about 2 ml, and have markings in units for ease of administration.
  • the pharmaceutical compositions are administered by intravenous, intra-arterial, or intramuscular injection of a liquid preparation.
  • liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the pharmaceutical compositions are administered intravenously, and are thus formulated in a form suitable for intravenous administration.
  • the pharmaceutical compositions are administered intra-arterially, and are thus formulated in a form suitable for intra-arterial administration.
  • the pharmaceutical compositions are administered intramuscularly, and are thus formulated in a form suitable for intramuscular administration.
  • the pharmaceutical compositions are administered topically to body surfaces, and are thus formulated in a form suitable for topical administration.
  • Suitable topical formulations include gels, ointments, creams, lotions, drops and the like.
  • the compounds of the present invention are combined with an additional appropriate therapeutic agent or agents, prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
  • compositions for use in accordance with the present invention is formulated in conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into preparations which, can be used pharmaceutically.
  • formulation is dependent upon the route of administration chosen.
  • injectables, of the invention are formulated in aqueous solutions.
  • injectables, of the invention are formulated in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
  • physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological salt buffer.
  • penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art.
  • compositions also comprise, in some embodiments, preservatives, such as benzalkonium chloride and thimerosal and the like; chelating agents, such as edetate sodium and others; buffers such as phosphate, citrate and acetate; tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and others; antioxidants such as ascorbic acid, acetylcystine, sodium metabisulfote and others; aromatic agents; viscosity adjustors, such as polymers, including cellulose and derivatives thereof; and polyvinyl alcohol and acid and bases to adjust the pH of these aqueous compositions as needed.
  • preservatives such as benzalkonium chloride and thimerosal and the like
  • chelating agents such as edetate sodium and others
  • buffers such as phosphate, citrate and acetate
  • tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and
  • compositions also comprise, in some embodiments, local anesthetics or other actives.
  • the compositions can be used as sprays, mists, drops, and the like.
  • the preparation of the present invention is formulated in liquid formulations for subcutaneous injection via a prefilled syringe or pen.
  • pharmaceutical compositions suitable for use in context of the present invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose.
  • a therapeutically effective amount means an amount of active ingredients effective to prevent, alleviate or ameliorate symptoms of disease or prolong the survival of the subject being treated.
  • dosing can be of a single or a plurality of administrations, with course of treatment lasting from several weeks to several years or until cure is effected or diminution of the disease state is achieved.
  • the amount of a composition or formulation to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc.
  • compositions including the preparation of the present invention formulated in a compatible pharmaceutical carrier are also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition.
  • the pharmaceutical composition comprising a long-acting rhGH as described herein is further formulated to comprise complex carriers such as human serum albumin, polyols, sugars, and anionic surface active stabilizing agents. See, for example, WO 89/10756 (Hara et al.- containing polyol and p-hydroxybenzoate).
  • the pharmaceutical composition comprises a growth hormone as described herein and is further formulated to comprise lactobionic acid and an acetate/glycine buffer.
  • the pharmaceutical composition comprising a long-acting rhGH as described herein is further formulated to comprise amino acids, such as arginine or glutamate that increase the solubility of interferon compositions in water.
  • the pharmaceutical composition comprises a long-acting rhGH as described herein and is further formulated to comprise glycine or human serum albumin (HSA), a buffer (e g. acetate) and an isotonic agent (e.g., NaCl).
  • the pharmaceutical composition comprises a long-acting rhGH as described herein and is further formulated to comprise a phosphate buffer, glycine and HSA.
  • the pharmaceutical composition comprising a long-acting rhGH provided herein is formulated in a liquid composition comprising a stabilizing agent at between about 0.3% and 5% by weight which is an amino acid.
  • the pharmaceutical composition comprising a long-acting rhGH provided herein provides dosing accuracy and product safety.
  • the pharmaceutical composition comprising a long-acting rhGH provided herein provides a biologically active, stable liquid formulation for use in injectable applications.
  • the pharmaceutical composition comprises a non-lyophilized long-acting rhGH provided herein.
  • the pharmaceutical composition comprising a long-acting rhGH as described herein provides a liquid formulation permitting storage for a long period of time in a liquid state facilitating storage and shipping prior to administration.
  • the pharmaceutical composition comprising a long-acting rhGH as described herein comprises solid lipids as matrix material.
  • the injectable pharmaceutical composition comprising a long-acting rhGH as described herein comprises solid lipids as matrix material.
  • the production of lipid microparticles by spray congealing was described by Lucasr (Speiser and al., Pharm. Res. 8 (1991) 47-54) followed by lipid nanopellets for peroral administration (Speiser EP 0167825 (1990)).
  • lipids, which are used, are well tolerated by the body (e. g.
  • the pharmaceutical composition comprising a long-acting rhGH as described herein is in the form of liposomes (J. E. Diederichs and al., Pharm./nd. 56 (1994) 267- 275).
  • the long-acting rhGH can be provided to the individual with additional active agents to achieve an improved therapeutic effect as compared to treatment with each agent by itself.
  • measures e.g., dosing and selection of the complementary agent
  • Embodiment 1 A method of treating growth hormone deficiency in a subject in need thereof, the method comprising: administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level; taking at least two measurements of an IGF-1 level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; and administering the long-acting rhGH to the subject at a modified dose level wherein the modified dose level is about 15% lower than the initial dose level.
  • rhGH human growth hormone
  • Embodiment 2 The method of embodiment 1, wherein the long-acting rhGH is administered once a week at the initial dose level or at the modified dose level.
  • Embodiment 3 The method of embodiment 1 or 2, wherein the subject is a pediatric subject.
  • Embodiment 4 The method of any one of embodiments 1 to 3, wherein the initial dose level is about 0.66 mg per kg of body weight per week..
  • Embodiment 5 The method of any one of embodiments 1 to 4, wherein the at least two IGF-1 level measurements are taken at day 3 to day 4 (e.g., about 96 hours) after administering the long-acting rhGH at an initial dose level.
  • Embodiment 6 The method of any one of embodiments 1 to 5, wherein the modified dose level is about 0.56 mg per kg body weight per week.
  • Embodiment 7 The method of any one of embodiments 1 to 6, further comprising taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level.
  • Embodiment 8 The method of embodiment 7, wherein the at least one measurement of an IGF-1 level in the subject has an SDS of > +2.
  • Embodiment 9 The method of embodiment 8, further comprising administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 10 The method of embodiment 9, wherein the long-acting rhGH is administered once a week at the further modified dose level.
  • Embodiment 11 The method of embodiment 9 or 10, wherein the further modified dose level is 15% lower than the modified dose level.
  • Embodiment 12 The method of any one of embodiments 9 to 11, wherein the further modified dose level is about 0.48 mg per kg body weight per week.
  • Embodiment 13 A method of treating growth hormone deficiency in a subject in need thereof, the method comprising: administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 0.66 mg per kg body weight per week; taking at least two measurements of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is 15% lower than the initial dose level; taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks after administering the modified dose level has a SDS of > +2; and administering the long-acting rhGH
  • Embodiment 14 The method of embodiment 13, wherein the long-acting rhGH is administered once a week at an initial dose level, at a modified dose level or at a further modified dose level.
  • Embodiment 15 The method of embodiment 13 or 14, wherein the subject is a pediatric subject.
  • Embodiment 16 The method of any one of embodiments 13 to 15, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 17 The method of any one of embodiments 13 to 16, wherein the modified dose level is about 0.56 mg per kg body weight per week.
  • Embodiment 18 The method of any one of embodiments 13 to 17, wherein the further modified dose level is about 0.48 mg per kg body weight per week.
  • Embodiment 19 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising administering the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level; taking at least two measurements of an IGF-1 level in the subject, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; and administering the long-acting rhGH to the subject at a modified dose level wherein the modified dose level is about 15% lower than the initial dose level.
  • SDS standard deviation score
  • Embodiment 20 The use of embodiment 19, wherein the long-acting rhGH is administered once a week at the initial dose level or at the modified dose level.
  • Embodiment 21 The use of embodiment 19 or 20, wherein the subject is a pediatric subject.
  • Embodiment 22 The use of any one of embodiments 19 to 21, wherein the initial dose level is about 0.66 mg per kg of body weight per week..
  • Embodiment 23 The use of any one of embodiments 19 to 22, wherein the at least two IGF-1 level measurements are taken at day 3 to day 4 (e.g., about 96 hours) after administering the long-acting rhGH at an initial dose level.
  • Embodiment 24 The use of any one of embodiments 19 to 23, wherein the modified dose level is about 0.56 mg per kg body weight per week.
  • Embodiment 25 The use of any one of embodiments 19 to 24, wherein the treatment further comprises taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level.
  • Embodiment 26 The use of embodiment 25, wherein the at least one measurement of an IGF-1 level in the subject has an SDS of > +2.
  • Embodiment 27 The use of embodiment 26, wherein the treatment further comprises administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 28 The use of embodiment 27, wherein the long-acting rhGH is administered once a week at the further modified dose level.
  • Embodiment 29 The use of embodiment 27 or 28, wherein the further modified dose level is 15% lower than the modified dose level.
  • Embodiment 30 The use of any one of embodiments 27 to 29, wherein the further modified dose level is about 0.48 mg per kg body weight per week.
  • Embodiment 31 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level of about 0.66 mg per kg body weight per week; taking at least two measurements of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject on two consecutive measurements taken 4 to 6 weeks apart each has a standard deviation score (SDS) of > +2; administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is 15% lower than the initial dose level; taking at least one measurement of an IGF-1 level in the subject at least 4 weeks after administering the modified dose level, wherein the IGF-1 level at least 4 weeks
  • Embodiment 33 The use of embodiment 31 or 32, wherein the subject is a pediatric subject.
  • Embodiment 34 The use of any one of embodiments 31 to 33, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 35 The use of any one of embodiments 31 to 34, wherein the modified dose level is about 0.56 mg per kg body weight per week.
  • Embodiment 36 The use of any one of embodiments 31 to 35, wherein the further modified dose level is about 0.48 mg per kg body weight per week.
  • Embodiment 37 A method of treating growth hormone deficiency in an adult subject in need thereof, the method comprising: administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level; taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of > +1.5 or ⁇ -0.5; and administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level when the IGF-1 level is the subject has an SDS value of > +1.5, or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level when the IGF-1 level in the subject has an SDS of ⁇ -0.5.
  • rhGH human growth hormone
  • Embodiment 38 The method of embodiment 37, wherein the long-acting rhGH is administered once a week at the initial dose level or at the modified dose level.
  • Embodiment 39 The method of embodiment 37 or 38, wherein the initial dose level ranges from about 1 mg/week to about 5 mg/week.
  • Embodiment 40 The method of any one of embodiments 37 to 39, wherein the subject is a male, a female not on oral estrogen or a female on oral estrogen.
  • Embodiment 41 The method of embodiment 40, wherein the initial dose is: about 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • Embodiment 42 The method of any one of embodiments 37 to 41, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 43 The method of any one of embodiments 37 to 42, wherein the IGF-1 level is measured at day 3 to day 4 after administering the long-acting rhGH at an initial dose level.
  • Embodiment 44 The method of any one of embodiments 40 to 43, wherein the modified dose level is about 0.5 mg/week lower than the initial dose level when the IGF-1 level in a male or a female not on oral estrogen has an SDS of > +1.5.
  • Embodiment 45 The method of any one of embodiments 40 to 43, wherein the modified dose level is about 0.75 mg/week lower than the initial dose level when the IGF-1 level in a female on oral estrogen has an SDS of > +1.5.
  • Embodiment 46 The method of any one of embodiments 40 to 45, wherein the modified dose level is: about 2.0 mg/week for a male 50 years of age or less, about 1.5 mg/week for a male greater than 50 years of age, about 2.5 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.0 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 3.25 mg/week for a female on oral estrogen who is 50 years of age or less or about 2.75 mg/week for a female on oral estrogen who is greater than 50 years of age when the IGF-1 level in the male or female has an SDS of > +1.5.
  • Embodiment 47 The method of any one of embodiments 40 to 43, wherein the modified dose level is about 1.0 mg/week higher than the initial dose level when the IGF-1 level in a male or a female not on oral estrogen has an SDS of ⁇ -0.5.
  • Embodiment 48 The method of any one of embodiments 40 to 43, wherein the modified dose level is about 1.5 mg/week higher than the initial dose level when the IGF-1 level in a female on oral estrogen has an SDS of ⁇ -0.5.
  • Embodiment 49 The method of any one of embodiments 40 to 43, 47, and 48, wherein the modified dose is: about 3.5 mg/week for a male 50 years of age or less, about 3.0 mg/week for a male greater than 50 years of age, about 4.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 3.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 5.5 mg/week for a female on oral estrogen who is 50 years of age or less or about 5.0 mg/week for a female on oral estrogen who is greater than 50 years of age when the IGF-1 level in the male or female has an SDS of ⁇ -0.5.
  • Embodiment 50 The method of any one of embodiments 19 to 49, further comprising taking a measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level.
  • Embodiment 51 The method of embodiment 50, wherein the IGF-1 level in the subject has an SDS of > +1.5.
  • Embodiment 52 The method of embodiment 51, further comprising administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 53 The method of embodiment 52, wherein the further modified dose level is about 0.5 mg/week lower than the modified dose level if the subject is a male or if the subject is a female who is not on estrogen.
  • Embodiment 54 The method of embodiment 52, wherein the further modified dose level is about 0.75 mg/week lower than the modified dose level if the subject is a female on estrogen.
  • Embodiment 55 The method of embodiment 50, wherein the IGF-1 level is the subject has an SDS of ⁇ -0.5.
  • Embodiment 56 The method of embodiment 55, further comprising administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 57 The method of embodiment 56, wherein the further modified dose level is about 1.0 mg/week higher than the modified dose level if the subject is a male or a female not on estrogen.
  • Embodiment 58 The method of embodiment 56, wherein the further modified dose level is about 1.5 mg/week higher than the modified dose level if the subject is a female on estrogen.
  • Embodiment 59 The method of any one of embodiments 52 to 58, further comprising administering the long-acting rhGH one, two, three, four, five, six, seven, eight, nine, ten or more times, taking a measurement of the IGF-1 level in the subject at day 3 to day 4 after each administration and reducing the dose level of long-acting rhGH by about 0.5 mg/week or about 0.75 mg/week based on age, gender and estrogen status if the IGF-1 level has an SDS value of > +1.5 or increasing the dose level of long-acting rhGH by about 1.0 mg/week or about 1.5 mg/week based on age, gender and estrogen status if the IGF-1 level has an SDS of ⁇ -0.5.
  • Embodiment 59 The method of any one of embodiments 37 to 58, wherein the subject’s trunk fat mass is decreased, lean body mass is increased, trunk fat mass as a percentage of total fat mass is decreased, IGF-1 levels are normalized, or a combination thereof.
  • Embodiment 60 A method of treating growth hormone deficiency (GHD) in an adult subject in need thereof, the method comprising: administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; taking at least one measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5 or > +1.5; administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5 or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level if the IGF-1 level in the subject has an SDS
  • Embodiment 61 The method of embodiment 60, wherein the long-acting rhGH is administered once a week at an initial dose level, at a modified dose level or at a further modified dose level.
  • Embodiment 62 The method of embodiment 60 or 61, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 63 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level; taking at least one measurement of an IGF-1 level in the subject wherein the IGF-1 level in the subject has a standard deviation score (SDS) of > +1.5 or ⁇ -0.5; and administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level when the IGF-1 level is the subject has an SDS value of > +1.5, or wherein the modified dose level is about 1.0 mg/week or about 1.5 mg/week higher than the initial dose level when the IGF-1 level in the subject has an SDS of
  • Embodiment 64 The use of embodiment 63, wherein the long-acting rhGH is administered once a week at the initial dose level or at the modified dose level.
  • Embodiment 65 The use of embodiment 63 or 64, wherein the initial dose level ranges from about 1 mg/week to about 5 mg/week.
  • Embodiment 66 The use of any one of embodiments 63 to 65, wherein the subject is a male, a female not on oral estrogen or a female on oral estrogen.
  • Embodiment 67 The use of embodiment 66, wherein the initial dose is: about 2.5 mg/week for a male 50 years of age or less, about 2.0 mg/week for a male greater than 50 years of age, about 3.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 4.0 mg/week for a female on oral estrogen who is 50 years of age or less or about 3.5 mg/week for a female on oral estrogen who is greater than 50 years of age.
  • Embodiment 68 The use of any one of embodiments 63 to 67, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 69 The use of any one of embodiments 63 to 68, wherein the IGF-1 level is measured at day 3 to day 4 after administering the long-acting rhGH at an initial dose level.
  • Embodiment 70 The use of any one of embodiments 66 to 69, wherein the modified dose level is about 0.5 mg/week lower than the initial dose level when the IGF-1 level in a male or a female not on oral estrogen has an SDS of > +1.5.
  • Embodiment 71 The use of any one of embodiments 66 to 69, wherein the modified dose level is about 0.75 mg/week lower than the initial dose level when the IGF-1 level in a female on oral estrogen has an SDS of > +1.5.
  • Embodiment 72 The use of any one of embodiments 66 to 69, wherein the modified dose level is about 0.75 mg/week lower than the initial dose level when the IGF-1 level in a female on oral estrogen has an SDS of > +1.5.
  • any one of embodiments 66 to 71, wherein the modified dose level is: about 2.0 mg/week for a male 50 years of age or less, about 1.5 mg/week for a male greater than 50 years of age, about 2.5 mg/week for a female not on oral estrogen who is 50 years of age or less, about 2.0 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 3.25 mg/week for a female on oral estrogen who is 50 years of age or less or about 2.75 mg/week for a female on oral estrogen who is greater than 50 years of age when the IGF-1 level in the male or female has an SDS of > +1.5.
  • Embodiment 73 The use of any one of embodiments 66 to 69, wherein the modified dose level is about 1.0 mg/week higher than the initial dose level when the IGF-1 level in a male or a female not on oral estrogen has an SDS of ⁇ -0.5.
  • Embodiment 74 The use of any one of embodiments 66 to 69, wherein the modified dose level is about 1.5 mg/week higher than the initial dose level when the IGF-1 level in a female on oral estrogen has an SDS of ⁇ -0.5.
  • Embodiment 75 The use of any one of embodiments 66 to 69, 73, and 74, wherein the modified dose is: about 3.5 mg/week for a male 50 years of age or less, about 3.0 mg/week for a male greater than 50 years of age, about 4.0 mg/week for a female not on oral estrogen who is 50 years of age or less, about 3.5 mg/week for a female not on oral estrogen who is greater than 50 years of age, about 5.5 mg/week for a female on oral estrogen who is 50 years of age or less or about 5.0 mg/week for a female on oral estrogen who is greater than 50 years of age when the IGF-1 level in the male or female has an SDS of ⁇ -0.5.
  • Embodiment 76 The use of any one of embodiments 63 to 75, wherein the treatmemy further comprises taking a measurement of an IGF-1 level in a subject after administering the long-acting rhGH at the modified dose level.
  • Embodiment 77 The use of embodiment 76, wherein the IGF-1 level in the subject has an SDS of > +1.5.
  • Embodiment 78 The use of embodiment 77, wherein the treatment further comprises administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 79 The use of embodiment 78, wherein the further modified dose level is about 0.5 mg/week lower than the modified dose level if the subject is a male or if the subject is a female who is not on estrogen.
  • Embodiment 80 The use of embodiment 78, wherein the further modified dose level is about 0.75 mg/week lower than the modified dose level if the subject is a female on estrogen.
  • Embodiment 81 The use of embodiment 76, wherein the IGF-1 level is the subject has an SDS of ⁇ -0.5.
  • Embodiment 82 The use of embodiment 81, wherein the treatment further comprises administering the long-acting rhGH to the subject at a further modified dose level.
  • Embodiment 83 The use of embodiment 82, wherein the further modified dose level is about 1.0 mg/week higher than the modified dose level if the subject is a male or a female not on estrogen.
  • Embodiment 84 The use of embodiment 82, wherein the further modified dose level is about 1.5 mg/week higher than the modified dose level if the subject is a female on estrogen.
  • Embodiment 85 The use of any one of embodiments 78 to 84, wherein the treatment further comprises administering the long-acting rhGH one, two, three, four, five, six, seven, eight, nine, ten or more times, taking a measurement of the IGF-1 level in the subject at day 3 to day 4 after each administration and reducing the dose level of long-acting rhGH by about 0.5 mg/week or about 0.75 mg/week based on age, gender and estrogen status if the IGF-1 level has an SDS value of > +1.5 or increasing the dose level of long-acting rhGH by about 1.0 mg/week or about 1.5 mg/week based on age, gender and estrogen status if the IGF-1 level has an SDS of ⁇ -0.5.
  • Embodiment 86 The use of any one of embodiments 63 to 85, wherein the subject’s trunk fat mass is decreased, lean body mass is increased, trunk fat mass as a percentage of total fat mass is decreased, IGF-1 levels are normalized, or a combination thereof.
  • Embodiment 87 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level of about 1 mg/week to about 5 mg/week; taking at least one measurement of an IGF-1 level in the subject at day 3 to day 4 after administering the long-acting rhGH, wherein the IGF-1 level in the subject has an SDS of ⁇ -0.5 or > +1.5; administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is about 0.5 mg/week or about 0.75 mg/week lower than the initial dose level if the IGF-1 level in the subject has an SDS of > +1.5 or wherein the modified dose level is about 1.0 mg/week or about 1.5
  • Embodiment 89 The use of embodiment 87 or 88, wherein the IGF-1 level is measured in serum or plasma.
  • Embodiment 90 A method of treating growth hormone deficiency in an adult subject in need thereof, the method comprising: administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO:2 to the subject at an initial dose level; monitoring the subject for an adverse event; and administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is 25% lower than the initial dose level if the adverse event is moderate, or wherein the modified dose level is 50% lower than the initial dose level if the adverse event is severe.
  • rhGH human growth hormone
  • Embodiment 91 The method of embodiment 90, wherein the adverse event is edema, hypertension, carpal tunnel, glucose, or a combination thereof.
  • Embodiment 92 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising administering a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of SEQ ID NO: 2 to the subject at an initial dose level; monitoring the subject for an adverse event; and administering the long-acting rhGH to the subject at a modified dose level, wherein the modified dose level is 25% lower than the initial dose level if the adverse event is moderate, or wherein the modified dose level is 50% lower than the initial dose level if the adverse event is severe.
  • rhGH growth hormone deficiency
  • Embodiment 93 The use of embodiment 92, wherein the adverse event is edema, hypertension, carpal tunnel, glucose, or a combination thereof.
  • Embodiment 94 A method of treating growth hormone deficiency in a first subject in need thereof, the method comprising: selecting a first subject with growth hormone deficiency, wherein the first subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the first subject, so that efficacy of the long-acting rhGH in the first subject is comparable to efficacy of the long-acting rhGH in a second subject who has previously received only the long-acting rhGH and has not previously received the once daily rhGH therapy.
  • a once daily recombinant human growth hormone once daily rhGH
  • long-acting rhGH long-acting recombinant human growth hormone
  • Embodiment 95 The method of embodiment 94, wherein the long-acting rhGH is a C- terminal peptide (CTP)-modified hGH.
  • CTP C- terminal peptide
  • Embodiment 96 The method of embodiment 94 or 95, wherein the long-acting rhGH comprises the amino acid sequence of mature human growth hormone (hGH) with one copy of CTP from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C-terminus.
  • hGH mature human growth hormone
  • Embodiment 97 The method of any one of embodiments 94 to 96, wherein the long- acting rhGH comprises the amino acid sequence shown in SEQ ID NO: 2.
  • Embodiment 98 The method of any one of embodiments 94 to 97, wherein the long- acting rhGH is glycosylated.
  • Embodiment 99 The method of any one of embodiments 94 to 98, wherein the long- acting rhGH is 0-glycosylated on twelve to twenty serines.
  • Embodiment 100 The method of any one of embodiments 94 to 99, wherein the once daily rhGH is somatropin, somatrem, a somatropin biosimilar, or a somatrem biosimilar.
  • Embodiment 101 The method of any one of embodiments 94 to 100, wherein efficacy is assessed by measuring one or more of: mean height velocity, gain in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin- like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, and cholesterol values.
  • SDS gain in height standard deviation score
  • IGF-1 insulin growth factor-1
  • IGFBP-3 SDS insulin-like growth factor binding protein 3
  • pubertal status changed from Tanner 1 mean glucose, HbAlc, thyroid function, and cholesterol values.
  • Embodiment 102 The method of embodiment 101, wherein efficacy is indicated by continued bone maturation.
  • Embodiment 103 The method of any one of embodiments 94 to 100, wherein the long- acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of 0.66 mg per kg body weight once weekly at any time of day.
  • Embodiment 104 The method of embodiment 103, wherein the long-acting rhGH is administered on the same day each week.
  • Embodiment 105 The method of embodiment 103, wherein the time between two doses is at least three days.
  • Embodiment 106 The method of any one of embodiments 94 to 105, wherein the once daily rhGH therapy is administered at a dosage of 0.16 to 0.24 mg per kg body weight per week.
  • Embodiment 107 The method of any one of embodiments 94 to 106, wherein the subject does not have active malignancy.
  • Embodiment 108 The method of any one of embodiments 94 to 107, wherein the subject does not have active malignancy, does not have an acute illness (complications following open heart or abdominal surgery, multiple accidental trauma, or acute respiratory failure).
  • Embodiment 109 The method of any one of embodiments 94 to 108, wherein the subject had received a once daily recombinant human growth hormone for at least three months.
  • Embodiment 110 The method of any one of embodiments 94 to 109, wherein the subject had received a once daily recombinant human growth hormone for at least six months.
  • Embodiment 111 The method of any one of embodiments 94 to 110, wherein the subj ect is obese.
  • Embodiment 112. The method of any one of embodiments 94 to 111, wherein the subject is a female.
  • Embodiment 113 The method of any one of embodiments 94 to 112, wherein the subject is 10 to 15 years old.
  • Embodiment 114 The method of any one of embodiments 94 to 113, wherein the subject has one or more of the following: isolated growth hormone deficiency (GHD), GH insufficiency as part of multiple pituitary hormone deficiency, pediatric GHD, and Prader-Willi Syndrome.
  • Embodiment 115 The method of any one of embodiments 94 to 114, wherein the subject has adult GHD.
  • Embodiment 116 The method of any one of embodiments 95 to 115, wherein the method further comprises monitoring glucose levels in the subject.
  • Embodiment 117 The method of any one of embodiments 95 to 116, wherein the long- acting rhGH is administered subcutaneously in the abdomen, thighs, buttocks, or upper arm.
  • Embodiment 118 The method of any one of embodiments 95 to 117, wherein the method demonstrates similar efficacy in a clinical study including participants divided into a test population and into a control population, wherein the test population receives (a) the once daily rhGH therapy for 12 months and then (b) the long-acting rhGH once weekly for 12 months, and the control population receives the long-acting rhGH once weekly for two years.
  • Embodiment 119 Use of a long-acting recombinant human growth hormone (long- acting rhGH) for the manufacture of a medicament for the treatment of growth hormone deficiency in a first subject in need thereof, wherein the use comprises administering an effective amount of the long-acting rhGH to a first subject with a growth hormone deficiency, wherein the first subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy, and wherein efficacy of the long-acting rhGH in the first subject is comparable to efficacy of the long-acting rhGH in a second subject who has previously received only the long-acting rhGH and has not previously received the once daily rhGH therapy.
  • long-acting rhGH long-acting recombinant human growth hormone
  • Embodiment 120 The use of embodiment 119, wherein the long-acting rhGH is a C- terminal peptide (CTP)-modified hGH.
  • CTP C- terminal peptide
  • Embodiment 121 The use of embodiment 119 or 120, wherein the long-acting rhGH comprises the amino acid sequence of mature human growth hormone (hGH) with one copy of CTP from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C-terminus.
  • Embodiment 122 The use of any one of embodiments 119 to 121, wherein the long- acting rhGH comprises the amino acid sequence shown in SEQ ID NO: 2.
  • Embodiment 123 The use of any one of embodiments 119 to 122, wherein the long- acting rhGH is glycosylated.
  • Embodiment 124 The use of any one of embodiments 119 to 123, wherein the long- acting rhGH is 0-glycosylated on twelve to twenty serines.
  • Embodiment 125 The use of any one of embodiments 119 to 124, wherein the once daily rhGH is somatropin, somatrem, a somatropin biosimilar, or a somatrem biosimilar.
  • Embodiment 126 The use of any one of embodiments 119 to 125, wherein efficacy is assessed by measuring one or more of: mean height velocity, gain in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, and cholesterol values.
  • SDS gain in height standard deviation score
  • IGF-1 insulin growth factor-1
  • IGFBP-3 SDS insulin like growth factor binding protein 3
  • pubertal status changed from Tanner 1 mean glucose, HbAlc, thyroid function, and cholesterol values.
  • Embodiment 127 The use of embodiment 126, wherein efficacy is indicated by continued bone maturation.
  • Embodiment 128 The use of any one of embodiments 119 to 127, wherein the long- acting rhGH is administered according to a dosage regimen comprising subcutaneous administration of 0.66 mg per kg body weight once weekly at any time of day.
  • Embodiment 129 The use of embodiment 128, wherein the long-acting rhGH is administered on the same day each week.
  • Embodiment 130 The use of embodiment 128, wherein the time between two doses is at least three days.
  • Embodiment 131 The use of any one of embodiments 119 to 130, wherein the once daily rhGH therapy is administered at a dosage of 0.16 to 0.24 mg per kg body weight per week.
  • Embodiment 132 The use of any one of embodiments 119 to 131, wherein the subject does not have active malignancy.
  • Embodiment 133 The use of any one of embodiments 119 to 132, wherein the subject does not have an acute illness selected from the group consisting of: complications following open heart or abdominal surgery, multiple accidental trauma, or acute respiratory failure.
  • Embodiment 134 The use of any one of embodiments 119 to 133, wherein the subject has one or more of the following: isolated growth hormone deficiency (GHD), GH insufficiency as part of multiple pituitary hormone deficiency, pediatric GHD, and Prader-Willi Syndrome.
  • Embodiment 135. The use of any one of embodiments 119 to 133, wherein the subject has adult GHD.
  • Embodiment 136 The use of any one of embodiments 119 to 135, wherein the use further comprises monitoring glucose levels in the subject.
  • Embodiment 137 The use of any one of embodiments 119 to 136, wherein the long- acting rhGH is administered subcutaneously in the abdomen, thighs, buttocks, or upper arm.
  • Embodiment 138 The use of any one of embodiments 119 to 137, wherein the use demonstrates similar efficacy in a clinical study including participants divided into a test population and into a control population, wherein the test population receives (a) the once daily rhGH therapy for 12 months and then (b) the long-acting rhGH once weekly for 12 months, and the control population receives the long-acting rhGH once weekly for two years.
  • Embodiment 139 A method of treating growth hormone deficiency in a subject in need thereof, the method comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly wherein the bone maturation rate of the subject previously on the once daily recombinant human growth hormone is comparable to the bone maturation rate of the subject while on the once daily recombinant treatment.
  • a method of treating growth hormone deficiency in a subject in need thereof comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly wherein
  • Embodiment 140 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly wherein the bone maturation rate of the subject previously on the once daily recombinant human growth hormone is comparable to the bone maturation rate of the subject while on the once daily recombinant treatment.
  • rhGH human growth hormone
  • Embodiment 141 A method of treating growth hormone deficiency in a subject in need thereof, the method comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subject once weekly wherein one or more clinical measurements of efficacy of the subject previously on the once daily recombinant human growth hormone is comparable to one or more clinical measurements of efficacy of the subject while on the once daily recombinant treatment.
  • a method of treating growth hormone deficiency in a subject in need thereof comprising: selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH
  • Embodiment 142 The method of embodiment 141, wherein one or more clinical measurements of efficacy is selected from the group consisting of mean height velocity, annual height velocity, gain in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin-like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, cholesterol values and a combination thereof.
  • SDS standard deviation score
  • IGF-1 SDS insulin growth factor-1
  • IGFBP-3 SDS insulin-like growth factor binding protein 3
  • Embodiment 143 Use of a long-acting recombinant human growth hormone (rhGH) for the treatment of a growth hormone deficiency (GHD) in a subject in need thereof, the treatment comprising selecting a subject with growth hormone deficiency, wherein the subject has previously received a once daily recombinant human growth hormone (once daily rhGH) therapy; and administering an effective amount of a long-acting recombinant human growth hormone (long-acting rhGH) to the subj ect once weekly wherein one or more clinical measurements of efficacy of the subject previously on the once daily recombinant human growth hormone is comparable to one or more clinical measurements of efficacy of the subject while on the once daily recombinant treatment.
  • rhGH growth hormone deficiency
  • Embodiment 144 The use of embodiment 143, wherein one or more clinical measurements of efficacy is selected from the group consisting of mean height velocity, annual height velocity, gain in height standard deviation score (SDS), body mass index, bone maturation, insulin growth factor-1 (IGF-1) SDS, insulin-like growth factor binding protein 3 IGFBP-3 SDS, pubertal status changed from Tanner 1, mean glucose, HbAlc, thyroid function, cholesterol values and a combination thereof.
  • SDS standard deviation score
  • IGF-1 SDS insulin growth factor-1
  • IGFBP-3 SDS insulin-like growth factor binding protein 3
  • Embodiment 145 A plurality of long-acting recombinant human growth hormone (long- acting rhGH) molecules, wherein each long-acting rhGH molecule comprises the amino acid sequence of mature human growth hormone (hGH) with one copy of C-terminal peptide (CTP) from the beta chain of human chorionic gonadotropin at the hGH N-terminus and two copies of CTP in tandem at the hGH C-terminus, and wherein the plurality comprises about 9 to 20 ()- glycans per intact long-acting rhGH molecule.
  • long-acting rhGH long-acting recombinant human growth hormone
  • Embodiment 146 The plurality of embodiment 145, wherein each long-acting rhGH molecule comprises the amino acid sequence shown in SEQ ID NO: 2.
  • Embodiment 147 The plurality of embodiment 145 or 146, wherein the long-acting rhGH molecule are O-glycosylated on twelve to twenty serines.
  • Embodiment 148 The plurality of any one of embodiments 145 to 147, wherein he plurality comprises a predominant gly coform having a molecular mass of about 40314 Da.
  • Embodiment 149 The plurality of embodiment 148, wherein the plurality comprises additional predominant O-gly coforms having molecular masses of about 39657 and 40970 Da.
  • Embodiment 150 The plurality of any one of embodiments 145 to 147, wherein the plurality comprises about 10-19 O-gly cans per intact long-acting rhGH molecule.
  • Embodiment 151 The plurality of any one of embodiments 145 to 147, wherein the plurality comprises asialylated and di-sialylated core-1 O-gly cans.
  • Embodiment 152 The plurality of any one of embodiments 145 to 147, wherein each CTP region comprises 0-5 hydroxy additions per intact somatrogon molecule.
  • Somatrogon is a long-acting recombinant human growth hormone (rhGH) consisting of the amino acid sequence of human growth hormone and 3 copies of the carboxy -terminal peptide of human chorionic gonadotropin. Somatrogon is currently being developed as a once- weekly (QW) treatment for pediatric patients with growth hormone deficiency (GHD).
  • rhGH human growth hormone
  • This open-label extension (OLE) phase 2 study was a continuation of a randomized 12-month study that investigated the safety, efficacy, and tolerability of 3 dose levels of somatrogon QW (0.25, 0.48, or 0.66 mg/kg/wk) compared with once daily rhGH (Genotropin® 0.034 mg/kg/d) in initially rhGH-naive prepubertal pediatric subjects with GHD.
  • This global phase 2 study (NCT01592500) is comprised of 5 treatment periods (FIG. 1).
  • Period III an additional 12 months at the original somatrogon dose
  • Genotropin® recipients were randomized to 1 of the 3 somatrogon dose regimens.
  • Period IV Years 2-4 of the OLE, where all subjects received somatrogon at 0.66 mg/kg/wk.
  • Period V currently ongoing until marketing approval; subjects transitioned from single-use vials of somatrogon (subcutaneous injection via needle and syringe) to a prefilled pen device at the same somatrogon dose (0.66 mg/kg/wk).
  • Safety evaluations included monitoring of all adverse events (AEs), including serious AEs and local injection site reactions, as well as laboratory assessments, including IGF-1 levels and immunogenicity.
  • Primary safety endpoints included the incidence of AEs and anti-drug antibody
  • ADA formation, assessment of local site injections, IGF-1 levels, and IGF-1 SDS.
  • Secondary endpoints included annual HV, change in height SDS, and annual bone maturation.
  • Completion rates for each OLE period ranged from 87.5 to 97.7%.
  • TEAE treatment-emergent AE
  • AD As were reported in 18 (37.5%) of 48 subjects during the OLE; 10 of these subjects also had AD As in the main study. [0449] No clinically meaningful differences in annual HV or TEAEs were observed between ADA-positive and ADA-negative subjects.
  • Somatrogon is a long-acting recombinant human growth hormone (rhGH) that comprises the amino acid sequence of human growth hormone and 3 copies of the carboxy- terminal peptide of human chorionic gonadotropin.
  • rhGH human growth hormone
  • Somatrogon is in development as a once weekly (QW) treatment for children with growth hormone deficiency (GHD).
  • GFD growth hormone deficiency
  • NCT02968004 12-month main study (NCT02968004) that investigated the efficacy and safety of somatrogon, administered QW compared with rhGH (Genotropin®) administered once daily (QD) in initially rhGH-naive prepubertal pediatric subjects with GHD (see Example 10).
  • the main study was an open-label, randomized, active controlled, parallel-group phase 3 study in which subjects were randomized 1:1 to receive QW subcutaneous (SC) doses of somatrogon (0.66 mg/kg/wk) or QD SC doses of Genotropin® (0.034 mg/kg/d) for 12 months.
  • SC subcutaneous
  • Genotropin® 0.034 mg/kg/d
  • Clinical endpoints included annual height velocity (HV), change in height standard deviation score (SDS), and bone maturation, which were assessed every 12 months.
  • Biochemical endpoints included IGF-1 levels, IGF-1 SDS, IGFBP-3 levels, and IGFBP-3 SDS, which were assessed on Day 4 after somatrogon dosing across study visits. Results
  • the Soma/Soma and Geno/Soma treatment groups had similar mean height SDS (-1.46 vs -1.28), mean BMI (17.84 vs 17.58 kg/m 2 ), and mean bone age (8.29 vs 8.34 y) at Month 12 of the OLE (Table 4). An increase in bone maturation was observed from baseline to Month 12 for both the Soma/Soma and Geno/Soma treatment groups, indicating continued bone maturation (Table 4). [0467] Table 4.
  • Clinical trial NCT02968004 was a 12-month, open-label, multicenter, randomized control study to compare the efficacy and safety of once weekly somatrogon to daily Genotropin® in prepubertal children with pGHD. Inclusion and exclusion criteria are shown in Table 5. The study was powered for non-inferiority to evaluate the efficacy (i.e., HV after 12 months of treatment) and safety between the 2 treatments.
  • QoL was an exploratory endpoint evaluated using the validated Quality of Life in Short Stature Youth (QoLISSY) questionnaire, which assesses the impact of short stature on the QoL in children.
  • the response scale is a 5-point Likert scale (“not at all/never” to “extremely/always”). Scores >70 indicate a good QoL.
  • GTD Growth hormone deficiency
  • Genotropin® is a recombinant human growth hormone (rhGH) with an identical amino acid sequence to the naturally occurring hormone (hGH). It was first approved in the US and other countries in the 1980s and has a well-established safety profile. Genotropin® is administered once daily as a subcutaneous (SC) injection.
  • SC subcutaneous
  • Somatrogon is a long-acting rhGH comprised of the amino acid sequence of hGH and 3 copies of the carboxy-terminal peptide from human chorionic gonadotropin. The carboxy- terminal peptides extend the half-life of the attached rhGH, allowing longer intervals between doses. Somatrogon is being developed as a once weekly SC injection for children with GHD. Phase 3 trial results have shown that once weekly somatrogon was generally well tolerated and demonstrated noninferiority to once daily Genotropin® in promoting growth in pediatric GHD. [0487] A recent patient preference study conducted as a discrete-choice experiment showed that patients with GHD preferred a less frequent injection schedule. The current study compared treatment burden of the once weekly somatrogon regimen vs once daily Genotropin® for pediatric GHD.
  • This phase 3, 24-week study (NCT03831880) used a randomized, open-label, crossover design. It was conducted between February 2019 and August 2020, and enrolled patients at centers in Bulgaria, Czech Republic, Slovakia, the UK, and the US. [0489] Eligible patients with pediatric GHD were aged >3 to ⁇ 18 years, had insulin-like growth factor- 1 (IGF- 1) standard deviation score ⁇ 2, and had received stable rhGH therapy for >3 months.
  • IGF- 1 insulin-like growth factor- 1
  • DCOA Dyad Clinical Outcome Assessment
  • the DCOA questionnaire is comprised of 2 parts (DCOA 1 and 2), with a comprehensive list of questions to determine the treatment burden. At baseline and after each 12- week treatment period, patients and caregivers completed DCOA 1 (rating treatment experience) and a Patient Global Impression Scale - Impact on Daily Activities (PGIS-IDA).
  • the primary endpoint was the difference in mean overall life interference total score after each 12-week treatment period, assessed by the Patient Life Interference Questionnaire, a subset of the DCOA 1 questionnaire.
  • Results of the DCOA 1 questionnaire are summarized in FIG. 7 and FIG. 8.
  • Results of the DCOA 2 questionnaire are summarized in FIG. 9.
  • FIG. 9 for the 3 items of the “pen ease of use” domain where ⁇ 50% of patients preferred somatrogon, a substantial proportion of patients had no preference (38.1%, 29.8%, 64.3%, for setting the dose, injecting the medicine, and storing the pen, respectively) between the injection schedules; two- sided 95% Cl computed using the Wilson score method.
  • Somatrogon is a long-acting recombinant human growth hormone (rhGH) comprising the amino acid sequence of human growth hormone and 3 copies of the carboxy -terminal peptide of human chorionic gonadotropin (SEQ ID NO:2), with a half-life that permits once weekly (QW) administration (Fares et ah, Int. J. Cell Biol. (2011) 275063; Fares et ah, Proc. Nat. Acad. Sci. USA (1992) 89(10):4304-8). Somatrogon is currently in development as QW treatment for pediatric patients with growth hormone deficiency (GHD).
  • GDD growth hormone deficiency
  • Subjects were excluded if they had any prior history of cancer or had received radiation therapy or chemotherapy.
  • Subjects who were malnourished (body mass index has a SDS of ⁇ -2 [age and sex standardized]), were bom small for their gestational age, or had anti-hGH antibodies at screening, diabetes mellitus, psychosocial dwarfism, or known or suspected chromosomal abnormalities or genetic/epigenetic variants (including Turner syndrome, Laron syndrome, Noonan syndrome, Prader-Willi syndrome, Silver-Russell syndrome, SHOX mutations/deletions, and skeletal dysplasias) were also excluded from the study.
  • AEs Adverse events
  • injection site reactions were assessed at each study visit, with the exception of injection site reactions, which were not assessed at predose visits; subjects were also trained to record injection site reactions in a diary.
  • PK and PD assessments For subjects in the somatrogon group, blood samples were collected 12 to 120 hours post dose for analysis of serum somatrogon and IGF-1 in accordance with sampling sub-blocks. For each of the 3 dose groups, 2 samples were collected at different times after administration of the second dose, with a total of 6 samples collected for each subject. Median concentrations were calculated for each dose using naive pooled estimate at each time point. Subjects who received Genotropin had blood samples collected regularly over the study period. Assessment of anti-drug antibodies (AD As) against somatrogon and Genotropin were performed at protocol-specified time points by Eurofms Pharma Bioanalytics Services US Inc. The development of binding and/or neutralizing antibodies against somatrogon was assessed using qualitative, validated methods (Zelinska et ak, J. Clin. Endocrinol. Metab. (2017)
  • Safety evaluations included all adverse events (AEs), concomitant medication use, treatment compliance, vital signs, electrocardiogram, physical examination, and laboratory assessments (hematology, blood chemistry, glucose metabolism, endocrinology, IGF-1 levels, immunogenicity, and urinalysis).
  • An AE was defined as any adverse change from the subject’s condition at baseline, regardless of whether it was considered related to the investigational product.
  • AEs including injection-site reactions
  • Any injection-site reactions that met the criteria for “abnormal” were assessed as AEs.
  • An abnormal injection-site reaction was defined as a reaction that was moderate to severe in intensity, required medical attention, was deemed abnormal by an investigator, or had a pain score >4, based on the protocol-specified Pain Assessment Scale (ranging from 0 [“no hurt”] to 5 [“hurts worse”]).
  • the somatrogon group the severity of injection-site pain after each weekly injection was recorded.
  • the Genotropin® group only the most severe pain for the week was recorded (i.e., once a week), rather than after each daily injection. Where a Genotropin® subject experienced multiple events of pain score >4, only 1 occurrence was recorded in the diary, hence only 1 AE would be recorded.
  • the secondary efficacy endpoints were annualized HV following 6 months of treatment, change in height SDS at 6 and 12 months (compared with pretreatment), and change in bone maturation (defined as the ratio of bone age to chronological age) after 12 months (compared with bone maturation pretreatment).
  • GH growth hormone
  • GHRP-2 growth hormone-releasing peptide 2
  • IGF insulin-like growth factor
  • max maximum
  • min minimum
  • SDS standard deviation score
  • Study Participants 65 subjects were screened and 44 subjects randomized at 24 sites in Japan; of the 44 dosed subjects, 43 completed the 12-month main study, and 1 subject in the Genotropin® group discontinued from the study due to an AE (craniopharyngioma). Demographic and baseline characteristics were similar between the 2 treatment groups (somatrogon and Genotropin®), with most (70%) subjects aged between 3 and 7 years. Approximately half (47.7%) of the subjects were male.
  • Efficacy The least squares (LS) mean of height velocity (HV) at Month 12 was 9.65 cm/y in the somatrogon group and 7.87 cm/y in the Genotropin® group; similar results were observed for annualized HV at Month 6. LS mean treatment difference of +1.79 cm/y (95% Cl: 0.97-2.60) in HV at Month 12 was greater than the pre-established margin of -1.8 cm/y, demonstrating QW somatrogon was comparable to QD Genotropin®.
  • the mean IGF-1 SDS (relative to baseline) increased across all post-baseline visits for the somatrogon treatment group (FIG. 11).
  • mean IGF-1 SDS increased until month 6 and decreased at months 9 and 12.
  • mean IGF-1 SDS values in the somatrogon group approached 0 SDS and remained above 0 SDS through month 12.
  • Mean IGF-1 SDS values in the Genotropin® group ranged from -0.59 to -0.25 SDS at all post-baseline visits.
  • PK/PD Peak serum concentrations of somatrogon were achieved at 12 hours to 18 hours after dosing, and the maximum concentration of somatrogon increased with increasing dosage. The calculated median concentrations of IGF-1, IGF-1 SDS, and IGFBP-3 based on sparse sampling showed that somatrogon treatment resulted in an IGF-1 and IGFBP-3 response. Median IGF-1 standard deviation scores (SDS) did not exceed +2 through the course of the week or at regular study visits over 12 months (FIG. 11).
  • TEAEs The most common all-causality TEAEs were nasopharyngitis (somatrogon: 54.5%; Genotropin®: 50.0%), injection site pain (somatrogon: 72.7%; Genotropin®: 13.6%), influenza (somatrogon: 27.3%; Genotropin®: 27.3%), pyrexia (somatrogon: 18.2%; Genotropin®: 13.6%), and pharyngitis (somatrogon: 13.6%; Genotropin®: 18.2%); the majority of TEAEs were mild to moderate in severity (somatrogon: 90.9%; Genotropin®: 77.3%).
  • AE adverse event
  • SAE serious adverse event.
  • SAEs are based on the investigator's assessment. a Subjects who have an AE record that indicates that the AE caused the subject to be discontinued from the study. b Subjects who have an AE record that indicates that action taken with study treatment was drug withdrawn but AE did not cause the subject to be discontinued from study.
  • Immunogenicitv A total of 18/22 subjects in the somatrogon group and 4/22 subjects in the Genotropin® group tested positive for AD As during the 12-month treatment period. Most subjects in the somatrogon group who tested positive for AD As had AD As that were specific for the hGH component of somatrogon. Two subjects in the somatrogon group tested positive for neutralizing antibodies (nAbs) against somatrogon at a single visit but were negative for all subsequent visits. None of the subjects in the Genotropin® group tested positive for nAbs.
  • Somatrogon administered once weekly was concluded as being comparable to Genotropin® administered once daily as the mean treatment difference (somatrogon- Genotropin®) in HV was +1.79 cm/year (95% Cl, 0.97-2.60), which was greater than the pre- established margin of-1.8 cm/year.
  • the somatrogon group had higher HV at 12 months (9.65 cm/year vs 7.87 cm/year) and showed a greater improvement in height SDS from baseline to 12 months (0.94 vs 0.52). Both treatment groups showed similar changes in bone maturation; advancement in bone age did not exceed advancement in chronological age.
  • Nonadherence may reduce the efficacy of GH treatment, resulting in suboptimal growth responses and reduced HV and final adult height (Graham et al., Patient Prefer. Adherence (2020) 14:1889-99). Reducing the number of rhGH injections required is likely to significantly lower the treatment burden associated with GH treatment, which may encourage greater adherence in patients and caregivers. As such, somatrogon administered once weekly may alleviate many of the issues associated with compliance with once-daily Genotropin.
  • somatrogon group had a higher incidence of injection-site pain compared with the Genotropin group, subjects may prefer to receive 1 injection of somatrogon compared with 7 injections of Genotropin during the course of a week. This is supported by a discrete choice experiment conducted in Japanese children with GHD, which found a clear preference for a once-weekly injection schedule instead of a once- daily injection schedule (Tanaka et al., Pediatr. Int. (2021)). Although the use of once-weekly somatrogon may improve adherence among patients with GHD, it is possible that some patients with poor adherence to daily GH treatment (e.g., adolescents) will also show poor adherence to long-acting treatments such as once-weekly somatrogon.
  • IGF-1 concentrations may be monitored to assess compliance and response to treatment.
  • daily rhGH there is no concern about the time after dose for collection of samples because the peaktrough ratios are small and any observations are reflective of what would be observed over the dosing interval.
  • once-weekly treatment as was shown in this study, the peak:trough variability is larger.
  • a PK/PD analyses performed on the Phase 2 study and showed that mean IGF-1 SDS over the 1-week dosing interval was best approximated by IGF-1 assessments 4 days (96 hours) after dose administration (Fisher et al., Horm. Res.
  • This Example illustrates patient counseling information to be provided to the patient and/or caregiver when administering long-acting rhGH, contraindications, warnings and precautions, drug interactions, and use in specific populations.
  • Patient Counseling Advise the patient and/or caregiver to read the FDA-approved patient labeling (Patient Information and Instructions for Use).
  • Adrenal Cortical Hypofunction hypoadrenalism may develop in patients who have or who are at risk for pituitary hormone deficiency(s). Advise patients/caregivers that if hyperpigmentation, extreme fatigue, dizziness, weakness, or weight loss is experienced during treatment with somatrogon to report this to their healthcare provider.
  • Thyroid Function undiagnosed/untreated hypothyroidism may prevent an optimal response to the long-acting rhGH. Advise patients/caregivers that periodic thyroid function tests may be required during treatment with the long-acting rhGH.
  • Benign Intracranial Hypertension advise patients/caregivers to report any visual changes, headache, and nausea and/or vomiting to their healthcare provider.
  • Hypersensitivity Reaction advise patients/caregivers that serious systemic hypersensitivity reactions (anaphylaxis and angioedema) are possible and that prompt medical attention should be sought if an allergic reaction occurs.
  • Glucose Metabolism advise patients/caregivers that new onset of insulin resistance and hyperglycemia may occur and monitoring of blood glucose during treatment with the long- acting rhGH in patients with glucose intolerance or who have risk factors for diabetes, may be needed.
  • Active Malignancy Based on experience with daily growth hormone products, long- acting rhGH is contraindicated in patients with active malignancy.
  • Acute Critical Illness Based on experience with pharmacologic amounts of daily growth hormone products, long-acting rhGH is contraindicated in patients with acute critical illness due to complications following open heart or abdominal surgery, multiple accidental trauma, or acute respiratory failure.
  • Hypersensitivity The long-acting rhGH is contraindicated in patients with known hypersensitivity to the long-acting rhGH or any of its excipients.
  • Acute Critical Illness Treatment with pharmacologic amounts of daily growth hormone products has been associated with increased mortality in patients with acute critical illness due to complications following open heart surgery, abdominal surgery or multiple accidental trauma, or those with acute respiratory failure. Based on experience with daily growth hormone products, if patients who are receiving the long-acting rhGH therapy become acutely critically ill, the potential benefit of continued treatment should be weighed against the potential risk.
  • Glucose Metabolism Treatment with daily growth hormone products may induce a state of insulin resistance and hyperglycemia. Additional monitoring should be considered in patients treated with the long-acting rhGH who have glucose intolerance, or additional risk factors for diabetes. In patients treated with the long-acting rhGH who have diabetes mellitus, anti-diabetic therapy may require adjustment.
  • IH Intracranial hypertension
  • papilledema Intracranial hypertension
  • visual changes headache, nausea, and/or vomiting
  • Symptoms usually occurred within the first 8 weeks after the initiation of daily growth hormone therapy.
  • IH-associated signs and symptoms rapidly resolved after cessation of therapy or a reduction of the daily growth hormone dose.
  • the long-acting rhGH should be temporarily discontinued in patients with clinical or fundoscopic evidence of IH.
  • Hypersensitivity Reactions Serious systemic hypersensitivity reactions (e.g., anaphylaxis, angioedema) have been reported with daily growth hormone products. If a serious hypersensitivity reaction occurs, immediately discontinue use of the long-acting rhGH therapy; treat promptly per standard of care and monitor until signs and symptoms resolve. Do not use in patients with previous hypersensitivity to the long-acting rhGH therapy.
  • Adrenal Cortical Hypofunction Based on published data patients receiving daily growth hormone therapy who have or are at risk for pituitary hormone deficiency(s) may be at risk for reduced serum cortisol levels and/or unmasking of central (secondary) hypoadrenalism.
  • patients treated with glucocorticoid replacement for previously diagnosed hypoadrenalism may require an increase in their maintenance or stress doses following initiation of the long-acting rhGH therapy treatment. Monitor patients for reduced serum cortisol levels and/or need for glucocorticoid dose increases in those with known hypoadrenalism.
  • Thyroid Function Based on experience with daily growth hormone products, undiagnosed/untreated hypothyroidism may prevent an optimal response to the long-acting rhGH therapy. During the long-acting rhGH therapy, thyroid function should be monitored as indicated based on clinical evaluation.
  • Epiphyseal disorders including slipped capital femoral epiphysis, may occur more frequently in patients with endocrine disorders or in patients undergoing rapid growth. Any pediatric patient with the onset of a limp or complaints of hip or knee pain during treatment should be carefully evaluated.
  • Glucocorticoids In patients receiving concomitant the long-acting rhGH therapy and glucocorticoid treatments, glucocorticoid dosing should be carefully monitored to avoid both hypoadrenalism and an inhibitory effect on growth.
  • the microsomal enzyme 11 b-hydroxysteroid dehydrogenase type 1 (1 l HSD-l) is required for conversion of cortisone to its active metabolite, cortisol, in hepatic and adipose tissue.
  • Treatment with daily growth hormone products inhibits IIbHd ⁇ -I, reducing serum cortisol concentrations, which may unmask previously undiagnosed central (secondary) hypoadrenalism or render low glucocorticoid replacement doses ineffective.
  • Patients treated with cortisone acetate and prednisone may be affected more than others because conversion of these drugs to their biologically active metabolites is dependent on the activity of l ⁇ HSD-l.
  • Insulin and/or Oral/Injectable Hypoglycemic Agents In patients with diabetes mellitus requiring drug therapy, the dose of insulin and/or oral/injectable agent may require adjustment when the long-acting rhGH therapy is initiated.
  • Lactation The long-acting rhGH therapy should be administered to lactating women only if clearly needed.
  • This Example illustrates pharmacodynamics and pharmacokinetics of somatrogon.
  • Somatrogon increases IGF-1. Pharmacodynamic evaluations were performed approximately 96 hours after dose administration in order to assess the mean IGF-1 SDS over the dosing interval.
  • Somatrogon pharmacokinetics was assessed using a population PK approach for somatrogon in 42 pediatric patients with GHD. Following SC injection, serum concentrations increased slowly, peaking 6 to 18 hours after dosing. In pediatric patients with GHD, somatrogon exposure increases in a dose-proportional manner for doses of 0.25 mg/kg/wk, 0.48 mg/kg/wk, and 0.66 mg/kg/wk. There is no accumulation of somatrogon after once weekly administration. In pediatric patients with GHD, the mean population PK estimated steady-state peak concentrations following 0.66 mg/kg/wk was 690 ng/mL.
  • the mean population PK estimated apparent central volume of distribution was 0.812 L/kg and apparent peripheral volume of distribution was 0.169 L/kg.
  • the mean population PK estimated apparent clearance was 0.0336 L/h/kg.
  • somatrogon will be present in the circulation for about 6 days after the last dose.
  • age, sex, race, and ethnicity do not have a clinically meaningful effect on the pharmacokinetics of somatrogon in pediatric patients with GHD.
  • the exposure of somatrogon decreases with an increase in body weight.
  • the somatrogon dosing regimen of 0.66 mg/kg/wk provide adequate systemic exposure over the body weight range of 10 to 54 kg evaluated in the clinical studies.
  • Somatrogon is a glycoprotein produced in Chinese Hamster Ovary (CHO) cells by recombinant DNA technology. It is comprised of the amino acid sequence of human growth hormone (hGH) with one copy of the C-terminal peptide (CTP) from the beta chain of human chorionic gonadotropin (hCG) at the N-terminus and two copies of CTP (in tandem) at the C- terminus. Each CTP includes multiple O-linked glycosylation sites. The glycosylation and CTP domains prolong the half-life of somatrogon, which allows for weekly dosing.
  • hGH human growth hormone
  • CTP C-terminal peptide
  • hCG human chorionic gonadotropin
  • the O-glycan occupancy ranges from 9 to 20 moieties per intact somatrogon molecule.
  • the predominant somatrogon gly coforms include the molecule with 15 monosialylated, core-1 O-glycans or 16 monosialylated, core-1 O-glycans. Additionally, each CTP region contains hydroxyproline residues, which range from 0-5 hydroxy additions per intact somatrogon molecule.
  • amino acid sequence of somatrogon is shown in SEQ ID NO: 2.
  • the functional, intact molecule is composed of recombinant hGH and one copy of CTP from the beta chain of hCG at the N-terminus (amino acids residues 1-28) and two copies of CTP (in tandem) at the C- terminus (amino acids residues 220-247 and 248-275.
  • the experimental masses of two additional predominant O-gly coforms, 39657.3 and 40970.3 Da agree well with theoretical values of somatrogon gly coforms consisting of the intended amino acid sequence with two disulfide bonds and 14 or 16 core-1 monosialylated O-glycans, respectively.
  • somatrogon contains a single polypeptide chain with the correct amino acid sequence, two disulfide bonds, as well as the expected core-1 monosialylated O-glycans. Additional minor and trace level isoforms were detected by ESI MS, which is consistent with the expected O-linked oligosaccharide heterogeneity.
  • the core-1 monosialylated O-glycans observed in ESI MS of somatrogon RM range from 10-18 for the intact protein. Up to 19 O-glycans have been previously observed.
  • each CTP region contains 0-5 hydroxy additions per intact somatrogon molecule.
  • the major O-gly cosylati on distribution for each material ranged from 10 to 18 O-glycans.
  • An additional, minor glycoform distribution was observed in all samples and corresponded to the major distribution species + sialic acid (N-acetylneuraminic acid, NeuAc).
  • the minor unlabelled distribution represents major isoforms + sialic acid.
  • Hydroxyproline was also detected for each O-gly coform in all somatrogon materials in similar proportions.
  • the mass spectra of intact PRC-GC and PRC-RB are compared, no new gly coforms are observed in PRC-GC as compared to PRC-RB. Only a minor redistribution in the relative abundance of O-gly coforms is observed.
  • the intact somatrogon mass spectrometry assessment confirms that the PRC-GC and PRC-RB materials are comparable at the intact level.
  • GHD growth hormone deficiency
  • This study was a 12-month, open-label, multicenter, randomized, active-controlled, parallel-group, phase 3 study comparing the safety and efficacy of somatrogon administered once-weekly to Genotropin® administered once-daily in prepubertal children with GHD who were GH-treatment naive. This study was conducted from April 2017 to August 2019 at 83 sites in 21 countries (Argentina, Australia, Belarus, Bulgaria, Canada, Colombia, Georgia, Greece, India, Israel, Mexico, New Zealand, Tru, Russian Federation, Spain, Republic of Korea, Taiwan, Turkey, Ukraine, the United Kingdom, and United States).
  • IGF-1 insulin-like growth factor
  • the dose-adjustment algorithm was followed based on two, repeated day 4 (-1) levels of IGF-1 having an standard deviation score (SDS) of > +2.0 (which may be abbreviated as > +2.0 SDS).
  • SDS standard deviation score
  • the dose was decreased based on repeated IGF-1 levels > +2.0 SDS.
  • Day 4 (-1) means that IGF-1 levels were measured on day 4 following the administration of somatrogon, including up to 24 hours before (i.e., between day 3 and day 4).
  • a patient had an IGF-1 level > +2.0 SDS they were requested to return for an unscheduled visit within 4-6 weeks after the > +2.0 SDS result, on day 4 (-1) post dose for somatrogon treated subjects, or on any day for Genotropin® treated subjects. If the subject’s IGF-1 level was still > +2.0 SDS, the most recent dose was reduced by 15% (i.e. to 0.56 mg/kg/week for somatrogon and to 29 pg/kg/day for Genotropin®. The subject was treated with the new dose for at least 4 weeks before a subsequent IGF-1 determination could result in a further dose modification.
  • IGF-1 level was retested. If the IGF-1 level was still > +2.0 SDS, the dose was reduced an additional 15% to 0.48 mg/kg/week for somatrogon and to 24.7 pg/kg/day for Genotropin®. If the IGF-1 was still > +2.0 SDS following 2 dose reductions, (at least 4 weeks after second dose reduction), the Global Study medical monitor (MM) (with the assistance of the Data Safety Monitoring Board if necessary) decided on the course of treatment on an individual basis. During the LT-OLE dose reduction for IGF-1 level > +2.0 SDS was made following consultation with the Global Study MM on an individual patient basis.
  • the primary objective of the study was to demonstrate that 12-month HV following once-weekly somatrogon administration was noninferior to daily Genotropin® administration in children with GHD.
  • the secondary objectives included an evaluation of the safety and tolerability of weekly somatrogon administration.
  • Prepubertal children (boys ages 3-11 years, girls ages 3-10 years) diagnosed with GHD were eligible for enrollment in this study if they had impaired height and HV (annualized HV below the 25th percentile for chronological age [HV ⁇ -0.7 SDS]), baseline IGF-1 level >1 SD below the age- and sex-standardized mean IGF-1 level (SDS ⁇ -l), and had not received prior rhGH therapy.
  • Subject height was not required to be ⁇ -2 SDS for inclusion in this study. IGF-1 levels were quantified using the same validated assay across all testing laboratories to ensure test alignment, irrespective of physical location.
  • Subjects were excluded if they had any prior history of cancer or had received radiation therapy or chemotherapy.
  • BMI body mass index
  • chromosomal abnormalities including Turner syndrome, Laron syndrome, Noonan syndrome, Prader-Willi syndrome, Russell-Silver syndrome, SHOX mutations/deletions, or skeletal dysplasia
  • Bone age was determined via X-ray according to the Greulich-Pyle method using a central bone age reader at screening, baseline, and month 12 (Gruelich and Pyle, Radiographic atlas of skeletal development of the hand and wrist 1 st ed. Palo Alto: Stanford University Press (1959) 1-272). IGF-1 measurements were obtained at the same visits as the height measurements, as well as at month 1. IGF-1 SDS was calculated using the modified least squares (LS) mean model (Bidlingmaier et al. J. Clin. Endocrinol. Metab. (2014) 99(5): 1712-1721). A previously developed indirect response PK/PD model was applied to IGF-1 observations to estimate IGF-1 SDS profiles over the dosing interval (Fisher et al. Horm. Res. Paediatr. (2017) 87(5):324-332).
  • LS modified least squares
  • Safety evaluations included all AEs, concomitant medication use, treatment compliance (monitored via patient diaries), vital signs, electrocardiogram, physical examination, and laboratory assessments that consisted of: hematology, blood chemistry, glucose metabolism (fasting blood glucose, fasting insulin level, and hemoglobin Ale (HbAlc)), endocrinology (free T4 and TSH levels), IGF-1 level, immunogenicity (anti-hGH antibodies in both groups and anti- somatrogon antibodies in the somatrogon group) and urinalysis.
  • An AE was defined as any adverse change from the baseline condition of the subject, regardless of whether it was considered related to the investigational product.
  • AEs were coded using the Medical Dictionary for Regulatory Activities (MedDRA v22.0) and were classified according to the MedDRA preferred term and system organ class. The intensity or severity of an AE was characterized as mild, moderate, or severe. AEs of special interest were selected from the class- based important potential identified risks relating to somatropin-containing products.
  • Adherence to somatrogon and Genotropin® treatment was assessed according to the following method: adherence rate (number of doses administered/number of doses expected) xlOO where number of doses administered was the difference between the number of expected doses and the number of missed doses.
  • the safety analysis set consisted of all enrolled subjects who received at least 1 dose of the study treatment.
  • the full analysis set included all randomized subjects who received at least 1 dose of the study drug.
  • the primary study endpoint was annual HV (cm/year) following 12 months of treatment.
  • the noninferiority of somatrogon compared with Genotropin® was concluded if the lower bound of the 2-sided 95% confidence interval (Cl) for the mean treatment difference (somatrogon-Genotropin®) in the primary efficacy endpoint was >-1.8 cm/year.
  • the Cl for the difference in means between the 2 treatments was derived using ANCOVA.
  • the ANCOVA model included terms for treatment, age group, sex, peak GH level, geographic region, and baseline height SDS as covariates. Delta-adjusted pattern imputation was applied, and the imputed values were reduced by 1.8 cm/year, i.e., the noninferiority margin. [0607]
  • the secondary endpoints were annualized HV following 6 months of treatment, change in height SDS at 6 and 12 months (compared with baseline), and change in bone maturation after 12 months (compared with bone age at screening). These endpoints were characterized using descriptive statistics. To support the interpretation of the ANCOVA-based primary analysis, additional sensitivity analyses included using observed data, last height carried forward, and sub-group analyses were also conducted.
  • One subject from the somatrogon group discontinued from the study due to injection site erythema and injection site induration, and one subject in the Genotropin® group was withdrawn from the study (FIG. 13). In all, 99% of subjects completed the study.
  • BMI body mass index
  • GH growth hormone
  • min max minimum maximum
  • the LS mean estimate of annual HV using the ANCOVA model was 10.10 cm/year for somatrogon and 9.78 cm/year for Genotropin®.
  • the treatment mean difference (somatrogon-Genotropin®) was 0.33 cm (95% Cl: -0.24, 0.89).
  • the study was considered to have met its primary objective of demonstrating that somatrogon administered once-weekly was noninferior to Genotropin® administered once-daily with respect to annual HV at 12 months in children with GHD. Results obtained using various sensitivity analyses were consistent with and supportive of the primary endpoint.
  • the prespecified subgroup analyses comparing somatrogon and Genotropin® treatment based on age, sex, or peak GH levels showed that similar HVs were achieved in response to both treatments (FIG. 14).
  • the 2 treatment groups had a similar mean (SD) duration of treatment: somatrogon: 363 (32) days; Genotropin®: 355 (28) days.
  • somatrogon 363 (32) days
  • Genotropin® 355 (28) days.
  • 192 of 224 patients (85.7%) experienced a treatment-emergent AE (TEAE).
  • the incidence of TEAEs was similar between the somatrogon (87.2%) and Genotropin® groups (84.3%) (Table 11).
  • Most of the all-causality TEAEs experienced with somatrogon vs Genotropin® were mild (54.1% vs 60.0%) or moderate (24.8% vs 19.1%) in intensity.
  • the incidence of severe TEAEs was 8.3% and 5.2% in the respective groups.
  • Serious AEs are based on the investigator’s assessment. a Subjects who have an AE record that indicated that the AE caused the subject to be discontinued from the study.
  • Glucose and HbAl c levels rose discretely during the 12-month period in both treatment groups, and values remained within the normal range. No clinically meaningful differences in thyroid function, lipids, vital assessments, or physical examinations were observed between subjects treated with somatrogon or Genotropin®. There were no cases of drug-induced liver injury in any subjects.
  • AD As anti drug antibodies
  • the overall adherence rate for this study was 99.6%, with very high adherence observed in both the somatrogon (99.4%) and Genotropin® (99.7%) groups. The lowest adherence rate observed for an individual patient was 87.5% in the somatrogon group and 91.5% in the Genotropin® groups.
  • the objective of this Example was to evaluate the safety and efficacy of somatrogon administered once-weekly compared with Genotropin® administered once-daily in prepubertal children with GHD. Conducted in 21 countries, the primary objective was met, demonstrating that once-weekly treatment with somatrogon was non-inferior to daily treatment with Genotropin®.
  • the LS mean estimate of annual HV at 12 months was 10.10 cm/year for somatrogon and 9.78 cm/year for Genotropin®.
  • the somatrogon and Genotropin® groups were also similar with regards to the mean annualized HV at 6 months, improvements in mean change in height SDS from baseline to 6 and 12 months, and mean change in bone maturation at 12 months.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Endocrinology (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Zoology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Food Science & Technology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Analytical Chemistry (AREA)
  • Diabetes (AREA)
  • General Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2022/020804 2021-03-19 2022-03-17 Methods of administering long-acting growth hormone polypeptides Ceased WO2022197961A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2022238386A AU2022238386A1 (en) 2021-03-19 2022-03-17 Methods of administering long-acting growth hormone polypeptides
IL305661A IL305661A (en) 2021-03-19 2022-03-17 Methods of administration of polypeptides of growth hormones that have effects over time
MX2023010997A MX2023010997A (es) 2021-03-19 2022-03-17 Métodos de administración de polipéptidos de la hormona del crecimiento de acción prolongada.
CN202280033510.1A CN117425490A (zh) 2021-03-19 2022-03-17 施用长效生长激素多肽的方法
US18/282,844 US20240166710A1 (en) 2021-03-19 2022-03-17 Methods of administering long-acting growth hormone polypeptides
EP22772229.5A EP4308151A4 (en) 2021-03-19 2022-03-17 METHODS OF ADMINISTRATION OF LONG-ACTING GROWTH HORMONE POLYPEPTIDES
BR112023018980A BR112023018980A2 (pt) 2021-03-19 2022-03-17 Métodos de administração de polipeptídeos de hormônio de crescimento de ação prolongada
CA3214273A CA3214273A1 (en) 2021-03-19 2022-03-17 Methods of administering long-acting growth hormone polypeptides
KR1020237035239A KR20230171936A (ko) 2021-03-19 2022-03-17 지속 작용성 성장 호르몬 폴리펩타이드를 투여하는 방법

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202163163504P 2021-03-19 2021-03-19
US63/163,504 2021-03-19
US202163272417P 2021-10-27 2021-10-27
US63/272,417 2021-10-27

Publications (1)

Publication Number Publication Date
WO2022197961A1 true WO2022197961A1 (en) 2022-09-22

Family

ID=83320806

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/020804 Ceased WO2022197961A1 (en) 2021-03-19 2022-03-17 Methods of administering long-acting growth hormone polypeptides

Country Status (10)

Country Link
US (1) US20240166710A1 (https=)
EP (1) EP4308151A4 (https=)
JP (1) JP2022145646A (https=)
KR (1) KR20230171936A (https=)
AU (1) AU2022238386A1 (https=)
BR (1) BR112023018980A2 (https=)
CA (1) CA3214273A1 (https=)
IL (1) IL305661A (https=)
MX (1) MX2023010997A (https=)
WO (1) WO2022197961A1 (https=)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020155990A1 (en) * 2001-04-20 2002-10-24 Renasci, Inc., D/B/A Renasci Anti-Aging Center Method of optimizing growth hormone replacement
US20130158121A1 (en) * 2008-02-11 2013-06-20 Depomed, Inc. Methods for treating vasomotor symptoms using gaba analogs in a gastric retentive dosage form
US20160310576A1 (en) * 2013-10-21 2016-10-27 Opko Biologics Ltd. Long-acting polypeptides and methods of producing and administering same
US20170312342A1 (en) * 2014-11-21 2017-11-02 Ascendis Pharma Endocrinology Division A/S Long-Acting Growth Hormone Dosage Forms
US20180111974A1 (en) * 2014-12-10 2018-04-26 Opko Biologics Ltd. Methods of producing long acting ctp-modified growth hormone polypeptides

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3060239B1 (en) * 2013-10-21 2020-05-13 OPKO Biologics Ltd. Long-acting polypeptides and methods of producing and administering same
CA2914916A1 (en) * 2014-12-10 2016-06-10 Opko Biologics Ltd. Methods of producing ctp-modified growth hormone polypeptides

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020155990A1 (en) * 2001-04-20 2002-10-24 Renasci, Inc., D/B/A Renasci Anti-Aging Center Method of optimizing growth hormone replacement
US20130158121A1 (en) * 2008-02-11 2013-06-20 Depomed, Inc. Methods for treating vasomotor symptoms using gaba analogs in a gastric retentive dosage form
US20160310576A1 (en) * 2013-10-21 2016-10-27 Opko Biologics Ltd. Long-acting polypeptides and methods of producing and administering same
US20170312342A1 (en) * 2014-11-21 2017-11-02 Ascendis Pharma Endocrinology Division A/S Long-Acting Growth Hormone Dosage Forms
US20180111974A1 (en) * 2014-12-10 2018-04-26 Opko Biologics Ltd. Methods of producing long acting ctp-modified growth hormone polypeptides

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
"Safety and Efficacy Phase 2 Study of Long-acting hGH (MOD-4023", GROWTH HORMONE DEFICIENT CHILDREN, 23 January 2020 (2020-01-23), pages 1 - 5, XP055971846, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/show/NCT01592500?term=NCT01592500&draw=2&rank=1> [retrieved on 20220522] *
ANONYMOUS: "MOD-4023 (Long-Lasting Human Growth Hormone (hGH)) Study in Growth Hormone Deficient Adults (GHDA)", CLINICALTRIALS.GOV, 8 October 2019 (2019-10-08), XP055971843 *
See also references of EP4308151A4 *
STRASBURGER ET AL.: "MOD-4023, a long-acting carboxy-terminal peptide-modified human growth hormone: results of a Phase 2 study in growth hormone-deficient adults", EUR J ENDOCRINOL, vol. 176, 8 December 2016 (2016-12-08), pages 283 - 294, XP055390272, DOI: 10.1530/EJE-16-0748 *
ZELINSKA ET AL.: "Long-Acting C-Terminal Peptide-Modified hGH (MOD-4023): Results of a Safety and Dose-Finding Study in GHD Children", J CLIN ENDOCRINOL METAB, vol. 102, 5 January 2017 (2017-01-05), pages 1578 - 1587, XP055971841 *

Also Published As

Publication number Publication date
EP4308151A4 (en) 2025-02-26
JP2022145646A (ja) 2022-10-04
KR20230171936A (ko) 2023-12-21
AU2022238386A1 (en) 2023-09-14
MX2023010997A (es) 2023-11-28
EP4308151A1 (en) 2024-01-24
CA3214273A1 (en) 2022-09-22
IL305661A (en) 2023-11-01
US20240166710A1 (en) 2024-05-23
BR112023018980A2 (pt) 2023-12-05

Similar Documents

Publication Publication Date Title
Gharib et al. American Association of Clinical Endocrinologists medical guidelines for clinical practice for growth hormone use in adults and children—2003 update
Reh et al. Somatotropin in the treatment of growth hormone deficiency and Turner syndrome in pediatric patients: a review
US20160310576A1 (en) Long-acting polypeptides and methods of producing and administering same
JP2017125051A (ja) Hgh−xten融合タンパク質および成長ホルモン欠乏症の処置におけるその使用
Smith et al. A growth differentiation factor 15 receptor agonist in randomized placebo-controlled trials in healthy or obese persons
US20140162954A1 (en) Fusion of human growth hormone and albumin formulation and uses thereof
CN105792839A (zh) 用于治疗的胰岛素样生长因子拟似物
US20240166710A1 (en) Methods of administering long-acting growth hormone polypeptides
CN117425490A (zh) 施用长效生长激素多肽的方法
EP3763733A1 (en) Long-acting polypeptides and methods of producing and administering same
Kemp Insulin-like growth factor-I deficiency in children with growth hormone insensitivity: current and future treatment options
Roelfsema et al. Nanomedicines in the treatment of acromegaly: focus on pegvisomant
HK40098775A (zh) 施用长效生长激素多肽的方法
Hasegawa et al. Current understanding and perspectives on growth and long-acting GH therapy in Japan
Dao et al. Human growth hormone
Çetinkaya et al. Long-acting growth hormone therapy, rational and future aspects
Yuen et al. Long-acting Growth Hormone Preparations
Wang et al. Tesamorelin, a human growth hormone releasing factor analogue
Dao et al. Human growth hormone
US20250325560A1 (en) Methods for improving muscle mass, strength, or function with a combination of testosterone and growth hormone
Luz et al. History and Current Status of Growth Hormone Treatment in Children: CC Luz, PF Collett-Solberg
US20200000884A1 (en) Treatment of adult growth hormone deficiency with human growth hormone analogues
Steelman et al. Cara, CL Roland, CT Taylor, SR Valluri, and MP Wajnrajch are employees
Ying et al. Once-Weekly Lonapegsomatropin Was Efficacious and Well Tolerated in Chinese Children with Growth Hormone Deficiency: Results from a Phase 3 Randomized Trial
Class et al. Patent application title: FUSION OF HUMAN GROWTH HORMONE AND ALBUMIN FORMULATION AND USES THEREOF Inventors: Kurt Brown (Narbeth, PA, US) Merav Bassan (Netanya, IL) Assignees: Teva Pharmaceutical Industries Ltd.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22772229

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2022238386

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 305661

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2022238386

Country of ref document: AU

Date of ref document: 20220317

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: P6002338/2023

Country of ref document: AE

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/010997

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 3214273

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023018980

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 2023126618

Country of ref document: RU

Ref document number: 2022772229

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022772229

Country of ref document: EP

Effective date: 20231019

WWE Wipo information: entry into national phase

Ref document number: 11202306578X

Country of ref document: SG

WWE Wipo information: entry into national phase

Ref document number: 202280033510.1

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023018980

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230918

WWE Wipo information: entry into national phase

Ref document number: 523450733

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450733

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450733

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 523450733

Country of ref document: SA