WO2022195028A2 - Therapeutic binding molecules - Google Patents
Therapeutic binding molecules Download PDFInfo
- Publication number
- WO2022195028A2 WO2022195028A2 PCT/EP2022/057029 EP2022057029W WO2022195028A2 WO 2022195028 A2 WO2022195028 A2 WO 2022195028A2 EP 2022057029 W EP2022057029 W EP 2022057029W WO 2022195028 A2 WO2022195028 A2 WO 2022195028A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- binding molecule
- ccr9
- seq
- amino acid
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/12—Antidiarrhoeals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/72—Increased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/715—Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons
- G01N2333/7158—Assays involving receptors, cell surface antigens or cell surface determinants for cytokines; for lymphokines; for interferons for chemokines
Definitions
- the present invention relates to binding molecules, such as antibodies, that bind to the chemokine receptor CCR9. More particularly, the invention relates to the treatment of CCR9-mediated diseases or conditions such as inflammatory bowel disease (IBD), and methods for the detection of CCR9, which make use of the binding molecules of the invention.
- IBD inflammatory bowel disease
- IBD is a group of chronic disorders of the gastrointestinal tract characterized pathologically by intestinal inflammation and epithelial injury.
- Two forms of IBD, Crohn’s disease and ulcerative colitis, are associated with marked morbidity and can have a major impact on an individual’s quality of life and their ability to work [1] These morbidities highlight the need for improved therapies for IBD.
- Targeting anti-CCR9 antibodies has been proposed as a mechanism for the treatment of cancer.
- Aberrant CCR9 expression in ovarian carcinomas, prostate cancer, breast cancer and melanomas is correlated with in vitro invasiveness in response to CCL25.
- CCL25 engagement enhances cell survival and resistance to apoptosis.
- Somovilla-Crespo et al. 2018 [4] and WO2015075269 A1 describe mouse anti-CCR9 antibodies 91 R (mouse anti-human CCR9 lgG2b) and 92R (mouse anti-human CCR9 lgG2a).
- the inventors have found that the chemokine receptor, CCR9, is highly expressed in the colon and ileum of patients with IBD where it co-expresses with the inflammatory cytokines IFN-g, IL-4 and IL-17.
- the inventors have successfully generated binding molecules which bind to CCR9-expressing cells, inhibit the interaction between CCR9 and its natural ligand CCL25 and prevent CCL25 mediated CCR9 internalisation.
- the binding molecules can induce death of the CCR9- expressing cells to which they bind, for example by mediating an antibody dependent cell-mediated cytotoxicity (ADCC) against the CCR9-expressing cells to which they bind.
- ADCC antibody dependent cell-mediated cytotoxicity
- the development of a binding molecule that inhibits binding of CCL25 to CCR9 and induces death of a CCR9-expressing cell to which it binds is particularly advantageous for subjects with IBD.
- the invention relates to binding molecules that bind to CCR9.
- the binding molecules of the invention preferably inhibit binding of CCL25 to CCR9.
- the binding molecules of the invention are preferably capable of inducing death of CCR9-expressing cells to which they bind.
- the binding molecules may be capable of mediating an ADCC response against cells to which they bind.
- the binding molecules of the invention are preferably capable of preventing or inhibiting migration of CCR9-expressing cells to which they bind.
- the binding molecules may prevent migration of CCR9-expressing cells in response to CCL25, orthe binding molecules may be capable of preventing migration of CCR9-expressing cells from the periphery into the gut of a subject.
- the invention provides a binding molecule that binds to CCR9 and comprises a heavy chain variable (VH) region having a set of CDRs HCDR1 , HCDR2 and HCDR3 and a light chain variable (VL) region having a set of CDRs LCDR1 , LCDR2 and LCDR3, wherein (a) the VH region amino acid sequence comprises HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2 and HCDR3 of SEQ ID NO: 3, and wherein the VL region amino acid sequence comprises LCDR1 of SEQ ID NO: 4 (RSSQSLVHX NX NTYLH wherein Xi and X 2 are any amino acid), LCDR2 of SEQ ID NO: 5 and LCDR3 of SEQ ID NO: 6; (b) the VH region amino acid sequence comprises HCDR1 of SEQ ID NO: 7, HCDR2 of SEQ ID NO: 8 and HCDR3 of SEQ ID NO: 9, and
- the binding molecule of the invention may comprise a VH region amino acid sequence comprising HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2 and HCDR3 of SEQ ID NO: 3, and a VL region amino acid sequence comprising LCDR2 of SEQ ID NO: 5 and LCDR3 of SEQ ID NO: 6, and LCDR1 having an amino acid sequence selected from: SEQ ID NO: 4, SEQ ID NO: 19 (RSSQSLVHX NX NTYLH wherein Xi of SEQ ID NO: 19 is P or S and X of SEQ ID NO: 19 is R, T or G), SEQ ID NO: 20, SEQ ID NO: 21 , and SEQ ID NO: 22.
- the binding molecules of the invention preferably comprise an immunoglobulin Fc domain, or a fragment thereof that retains the ability to bind to one or more Fc receptors.
- the binding molecule may comprise a human lgG1 Fc domain or fragment thereof.
- the binding molecules of the invention are preferably afucosylated.
- the binding molecules may be afucosylated at amino acid position 297.
- the binding molecule of the invention may be present in a composition comprising multiple copies of said binding molecule, wherein at least 50%, 75%, 90%, 95%, 98%, 99% or 100% ofthe copies of the binding molecule in the composition are afucosylated.
- the invention provides a binding molecule that binds to CCR9, wherein the binding molecule does not compete for binding to CCR9 with another binding molecule of the invention, such as does not compete for binding to CCR9 with a binding molecule as described above, such as does not compete for binding to CCR9 with a binding molecule as described herein for use in therapy.
- the binding molecule of this aspect may be used to determine the abundance of CCR9+ cells in a sample which has been contacted with a binding molecule of the invention.
- the invention provides a method of assessing the depletion of CCR9-expressing cells by a binding molecule of the invention, the method comprising: (i) contacting said binding molecule with a population of cells, wherein the population of cells comprises CCR9-expressing cells and immune effector cells, under conditions suitable to allow for antibody dependent cell-mediated cytotoxicity by the effector cells; (ii) contacting said population of cells with a binding molecule that binds to CCR9, and that does not compete for binding to CCR9 with the binding molecule of step (i); (iii)detecting CCR9- expressing cells in the population of cells that are bound by the binding molecule of (ii); (iv) comparing the amount of CCR9-expressing cells detected in step (iii) with the amount of CCR9-expressing cells in the original cell population used in step (i), and thereby determining the amount of CCR9-expressing cells that were depleted in step (i).
- the invention also provides an isolated polynucleotide encoding any binding molecule of the invention. Also provided is a vector comprising a polynucleotide of the invention operably associated with a promoter. Also provided is a vector comprising a polynucleotide encoding the VH region of a binding molecule of the invention, and a polynucleotide encoding the VL region of a binding molecule of the invention, wherein said polynucleotides are operably associated with one or more promoters.
- the invention provides a host cell comprising a polynucleotide of the invention or a vector of the invention. Also provided is a method of producing a binding molecule of the invention, comprising expressing a polynucleotide of the invention or a vector of the invention in a host cell.
- the invention provides a pharmaceutical composition comprising the binding molecule of the invention, and a pharmaceutically acceptable carrier or diluent.
- the invention also relates to using the binding molecules of the invention in medicine, such as a binding molecule of the invention for use in therapy.
- the invention relates to treating a CCR9- mediated disease or condition in a subject, by a method comprising administering to the subject an effective amount of a binding molecule of the invention, ora composition of the invention.
- the invention also relates to treating a CCR9-mediated disease or condition in a subject, by a method comprising administering to the subject an effective amount of a binding molecule which binds to CCR9, wherein said binding molecule is capable of (i) inhibiting binding of CCL25 to CCR9, and (ii) mediating antibody dependent cell-mediated cytotoxicity against a CCR9-expressing cell to which it binds.
- the binding molecules as described herein may also be used to detect CCR9.
- the invention provides a method for detecting the presence of a CCR9 polypeptide in a sample, comprising: (a) contacting a sample with a binding molecule that binds to CCR9, such as any binding molecule of the invention or binding molecule as described herein, to provide a binding molecule- antigen complex; (b) detecting the presence or absence of said binding molecule-antigen complex; (c) wherein the presence of the binding molecule-antigen complex confirms the presence of a CCR9 polypeptide.
- the present invention relates to improved anti-CCR9 antibodies and there use in the treatment of inflammatory bowel disease.
- the present invention particularly relates to a humanized afucosylated monoclonal antibody that specifically binds to the C-C motif chemokine receptor 9 (CCR9). Via its Fc receptor functionality, binding of the antibody to the CCR9 receptor initiates an ADCC response resulting in depletion of the CCR9 expressing cell populations.
- the antibodies of the invention are humanised, CDR optimized. The antibodies are afucosylated without any loss of potency.
- Figure 1A Expression of CCR9 in CD4+ cells from cynomolgus and human cells blood, mesenteric lymph node (cynomolgus only), colon, ileum, and thymus
- Figure 1B Expression of CCR9 in B cells in the ileum (left) and colon (right) of healthy and IBD patients
- Figure 1C Expression of CCR9 in T effector cells and Tregs from the colon or ileum of healthy or IBD patients.
- Figure 2 The association of CCR9 with pro-inflammatory cytokines in CD4+ T cells.
- Figure 2A IFN-g, IL-4, and IL-17 expression in CCR9- and CCR9 + cells
- Figure 2B Fold change in expression level of cytokines assessed in Figure 2A between CD4+CCD9- cells and CD4+CCR9+ cells.
- Figure 3 The aligned amino acid sequences of the variable regions of nine anti-CCR9 antibodies
- Figure 3A VH region
- Figure 3B VL region. Locations of CDRs (HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 are indicated underlined. Locations of framework (FW) regions are also indicated.
- Figure 4 The aligned VH and VL regions of antibody AB1020243, a humanised form of that antibody (AB1020243-fgl), and two CDR optimised forms of the antibody (243LO0326 and 243LO0331)
- Figure 5 The binding of anti-CCR9 antibodies to cells expressing, or not expressing CCR9 [0022]
- Figure 5A Binding to Molt 4 cell line;
- Figure 5B Binding to the Molt 4 and Jurkat cell lines
- Figure 6 The binding of AB1020243 to different forms of CCR9 in HEK cells
- binding was assessed in HEK cells not transfected with CCR9 (Parental HEK), and binding was then also assessed in HEK cells overexpressing human CCR9A (Hu A HEK), human CCR9B (Hu B HEK), cynomolgus CCR9 (Cyno HEK), mouse CCR9 (Mouse HEK) and rat CCR9 (Rat HEK).
- Figure 7 The activation of NK cells by afucosylated anti-CCR9 antibodies pre-incubated with HEK cells expressing CCR9A (top) or Molt 4 cells (bottom).
- Figure 8 The effects of treatment with anti-CCR9 antibodies on the number of CCR9+ CD4+PBMC.
- Figure 9 Comparison of the binding to various ligands of the chimeric antibody AB1020243 and its humanised version.
- Figure 9A human CCR9B; Figure 9B: cynomolgus CCR9; Figure 9B: CXCR1 ; Figure 9D: CXCR2; Figure 9E: CCR5; Figure 9F: CCR8; Figure 9G: HEK cells not transfected with CCR9.
- Figure 10A NK cell activation after binding to the Molt 4 cell line
- Figure 10B Kinetic properties of the humanised and chimeric AB1020243 afuc antibodies.
- Figure 11 The ability of anti-CCR9 antibodies to compete with CCL25 for binding to CCR9.
- Figure 12 The binding of 243LO0326 and AB1020243 to ligands
- Figure 12A human CCR9A
- Figure 12B human CCR9B
- Figure 12C cynomolgus CCR9A
- Figure 12D CCR5
- Figure 12E CCR8
- Figure 12F CXCR1
- Figure 12F CXCR2.
- Figure 13 The amount of antibody AB1020243 or antibody 243LO0326 bound at the cell surface over time
- Figure 14A PBMC and Jurkat cells ( Figure 14B); and human or cynomolgus PBMC ( Figure 14C).
- Figure 15B Effect of afucosuylation on ADDC.
- Figure 15A ADCC activity of fucosylated vs. afucosylated species in a fucosylation spiking study.
- RP Relative potency.
- Figure 16A The effect of intravenous injection of 243LO0326 on the number of CCR9+ memory CD4+ T cells in the blood of cynomolgus monkeys.
- Figure 16B High and low doses of 243LO0326 decrease CDR4+CCR9+ cells in the peripheral blood of cynomolgus monkeys within 2 days.
- Figure 16C High and low doses of 243LO0326 decrease CDR4+CCR9+ cells in the illeum of cynomolgus monkeys, as measured at day 15 by FACS.
- Figure 16D High and low doses of 243LO0326 decrease CDR4+CCR9+ cells in the gut mucosa of cynomolgus monkeys, as measured at day 15 by IHC.
- Figure 18 The effects of 243LO0326 on IBD markers in human gut explants taken from IBD patients.
- Figure 18A CCR9 levels
- Figure 18B IL-6 levels
- Figure 18C GM-CSF levels
- Figure 18D IL-22 levels.
- amino acids are referred to herein using the name of the amino acid, the three letter abbreviation or the single letter abbreviation.
- protein includes proteins, polypeptides, and peptides.
- amino acid sequence is synonymous with the term “polypeptide” and/or the term “protein”.
- amino acid sequence is synonymous with the term “peptide”.
- amino acid sequence is synonymous with the term “enzyme”.
- protein and polypeptide are used interchangeably herein. In the present disclosure and claims, the conventional one-letter and three-letter codes for amino acid residues may be used.
- “About” may generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Exemplary degrees of error are within 20 percent (%), typically, within 10%, and more typically, within 5% of a given value or range of values. Preferably, the term “about” shall be understood herein as plus or minus ( ⁇ ) 5%, preferably ⁇ 4%, ⁇ 3%, ⁇ 2%, ⁇ 1%, ⁇ 0.5%, ⁇ 0.1%, of the numerical value of the number with which it is being used.
- Embodiments described herein as “comprising” one or more features may also be considered as disclosure of the corresponding embodiments “consisting of’ and/or “consisting essentially of’ such features.
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government, or listed in the U.S. Pharmacopeia, European Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- epitope refers to a target protein region (e.g. polypeptide) capable of binding to (e.g. being bound by) a binding molecule of the invention.
- target protein region e.g. polypeptide
- Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art, including those described herein.
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention.
- IC50 is the median inhibitory concentration of a binding molecule. In functional assays, IC50 is the concentration that reduces a biological response by 50% of its maximum. IC50 can be calculated by any number of means known in the art.
- EC50 is the concentration that induces a median response between baseline and maximum after a specified exposure time.
- EC50 can be calculated by any number of means known in the art.
- the present invention relates to binding molecules that bind to CCR9.
- Chemokine receptor 9, CCR9 (also known as CDw199 and GPR-9-6) is a member of the beta chemokine receptor family.
- CCR9 is organized into 15 domains, corresponding to an N-terminal extracellular domain (Nt), seven transmembrane domains, three intracellular domains, three extracellular domains and an intracellular C-terminal domain (Ct).
- Nt N-terminal extracellular domain
- Ct intracellular C-terminal domain
- CCR9 exists in two isoforms CCR9A and CCR9B.
- Isoform A has an additional 12 N-terminal amino acids and has higher affinity for the ligand CCL25 compared with isoform B.
- Isoforms A and B are reported to be co-expressed at a ratio of 10:1.
- Previous described anti-CCR9 antibodies 91 R and 92R only bind isoform CCR9A, and do not bind C
- CCR9 positive CD4 T lymphocytes co-expresses the proinflammatory cytokines IFN- y, IL-4 and IL-17 in the gut compared with CCR9 negative CD4 T lymphocytes suggests that CCR9 can identify CD4 T lymphocytes that contribute to the pathogenesis of IBD.
- RNA, DNA, and amino acid sequences of CCR9 are known to those skilled in the art and can be found in many databases, for example, in the databases ofthe National Centerfor Biotechnology Information (NCBI) and UniProt. Examples of these sequences found at UniProt are at P51686-1 for human CCR9A and P51686-2 for human CCR9B; Q0H741 for cynomolgus CCR9; Q9WUT7 for mouse CCR9; and Q8CH33 for rat CCR9.
- NCBI National Centerfor Biotechnology Information
- the binding molecule of the invention binds to human CCR9. In some embodiments the binding molecule binds to human CCR9A and/or human CCR9B. In some embodiments, the binding molecule binds to human CCR9A and binds to human CCR9B.
- the binding molecule binds to CCR9 from a non-human mammalian species, such as from a non-human primate. In some embodiments, the binding molecule binds to cynomolgus CCR9. In some embodiments the binding molecule binds to human and cynomolgus CCR9, such as binding to human CCR9A and human CCR9B and cynomolgus CCR9. [0053] In some embodiments, the binding molecule does not bind to mouse and/or rat CCR9.
- the binding molecule binds to human and cynomolgus CCR9, such as human CCR9A and human CCR9B and cynomolgus CCR9, but does not bind to mouse or rat CCR9.
- the binding molecule binds selectively to (also referred to interchangeably herein as specifically to) CCR9.
- CCR9 By selective binding, it will be understood that the CDRs of a binding molecule together bind to CCR9, with no significant cross-reactivity to any other molecule.
- a binding molecule that binds selectively to CCR9 may have no significant crossreactivity to any other cytokine receptor.
- a binding molecule that binds selectively to CCR9 may have no significant cross-reactivity to any one, any two, any three or all four of CCR5, CCR8, CXCR1 and CXCR2.
- the binding molecule does not bind to CCR5, CCR8, CXCR1 or CXCR2.
- a binding molecule that binds selectively to human CCR9 may have no significant cross-reactivity with CCR9 from another species, such as with mouse and/or rat CCR9.
- a binding molecule that binds selectively to human CCR9 may have cross- reactivity with a closely related CCR9 molecule, such as cynomolgus CCR9, but may have no significant cross-reactivity with a more distantly related CCR9 such as mouse and/or rat CCR9.
- Cross-reactivity may be assessed by any suitable method.
- binding may be measured by assaying binding of the binding molecule to overexpressing cell lines expressing the receptor of interest. Binding may also be measured by a radioimmunoassay (RIA), BIACORE® (using recombinant CCR9 as the analyte and binding molecule as the ligand, or vice versa), KINEXA®, ForteBio Octet system, or other binding assays known in the art.
- RIA radioimmunoassay
- BIACORE® using recombinant CCR9 as the analyte and binding molecule as the ligand, or vice versa
- KINEXA® ForteBio Octet system, or other binding assays known in the art.
- crossreactivity of binding molecule with a molecule other than CCR9 may be considered significant if the binding molecule binds to the other molecule at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 100% as strongly as it binds to CCR9.
- a binding molecule that binds selectively to CCR9 may bind to another molecule, such as a different cytokine receptor, such as any one, two, three or all four of CCR5, CCR8, CXCR1 , and CXCR2, at less than 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25% or 20% the strength that it binds to CCR9.
- the binding molecule binds to the other molecule at less than 20%, less than 15%, less than 10% or less than 5%, less than 2% or less than 1% the strength that it binds to CCR9.
- the CCR9 is preferably a naturally occurring CCR9, such as human CCR9, such as human CCR9A and/or human CCR9B.
- the binding molecule binds to a cell that expresses CCR9.
- the binding molecule may bind to a CCR9 receptor that is present in the cell membrane of a cell.
- the cell may be a cell that naturally expresses CCR9, or the cell may be engineered to express CCR9, such as by introducing a nucleic acid encoding CCR9 under conditions that allow for the expression of CCR9.
- the cell may be engineered to overexpress CCR9 such that the engineered cell line expresses higher levels of CCR9 than a corresponding un-engineered cell.
- the cell may express human CCR9A or human CCR9B.
- the cell may be a HEK cell line that has been engineered to express CCR9, such as human CCR9A and/or human CCR9B.
- the Molt 4 cell line is a human T-lymphocyte cell line from acute lymphoblastic leukemia that naturally expresses CCR9 at high levels.
- the Molt 4 cell line is obtainable from ATCC, CRL-1582.
- the binding molecule binds to a Molt 4 cell.
- the binding molecule binds to a Molt 4 cell by binding to CCR9 on the surface of said Molt 4 cell or CCR9 present in the cell membrane of said Molt 4 cell.
- the binding molecule does not bind to a cell that does not express CCR9, such as a Jurkat cell.
- the Jurkat cell line is obtainable from ATCC as Jurkat, Clone E6.1.
- the binding molecule binds to a CCR9 (e.g., a human CCR9) with a dissociation constant (KD) of ⁇ 1 mM, ⁇ 100 nM, ⁇ 10 nM, ⁇ 5 nM, ⁇ 1 nM, ⁇ 0.5 nM, ⁇ 0.1 nM, or ⁇ 10 pM.
- KD dissociation constant
- the binding molecule binds to CCR9 (e.g., CCR9 present on a Molt 4 cell) with a KD of between about 0.01 nM to about 0.45nM, between about 0.025nM to about 0.25nM, or between about 0.05nM to about 0.1 nM. In some embodiments, the binding molecule binds to CCR9 (e.g., CCR9 present on a Molt 4 cell) with a KD of about 0.09nM.
- the binding molecule binds to CCR9 (e,g, , CCR9 present on a Molt 4 cell) with a KD of between about 2nM to about 5nM, between about 2.5nM to about 4nM, or between about 3nM to about 3.5nM. In some embodiments, the binding molecule binds to CCR9 (e.g., CCR9 present on a Molt 4 cell) with a KD of about 3.4nM.
- the KD measurements may be carried out by any suitable assay known in the art.
- suitable assays include an affinity assay performable via a Ligand Tracer system, KinExA system (e.g., KinExA 3100, KinExA 3200, or KinExA 4000) (Sapidyne Instruments, Idaho), or ForteBio Octet system.
- the binding molecule is a CCR9 antagonist.
- the binding molecule may prevent or inhibit the normal function of CCR9.
- the binding molecule may prevent or inhibit migration of a CCR9-expressing cell by antagonising CCR9 present on the cell.
- the binding molecule inhibits binding of a ligand to CCR9.
- the binding molecule binds to CCR9 and blocks or inhibits the binding of a ligand to the CCR9 molecule. This may be assessed by common methods known in the art, including those described herein.
- the binding molecule may be a competitive inhibitor of CCR9.
- the binding molecule may compete with a ligand of CCR9 for binding to CCR9.
- Competitive binding may be assessed by common methods known in the art, including those described herein.
- the ligand of CCR9 is CCL25.
- CCL25 also known as TECK
- TECK is a cytokine belonging to the CC chemokine family.
- the RNA, DNA, and amino acid sequences of CCL25 are known to those skilled in the art and can be found in many databases, for example, in the databases of the National Center for Biotechnology Information (NCBI) and UniProt. Examples of these sequences found at UniProt are at 015444 for human CCL25; 035903 for mouse CCL25; Q32PX4 for rat CCL25 and A0A2K5TSD9 and A0A2K5TSC0 for cynomolgus CCL25.
- NCBI National Center for Biotechnology Information
- the binding molecule blocks or inhibits binding of CCL25 to CCR9.
- CCL25 may have reduced binding to CCR9 in the presence of a binding molecule of the present invention.
- the binding molecule is capable of binding to CCR9 present on the surface or membrane of a cell and inhibiting binding of CCL25 to CCR9 on the cell.
- the binding molecule is capable of preventing or inhibiting migration of a CCR9-expressing cell to which it binds.
- a cell bound by a binding molecule of the invention may migrate less efficiently in response to a stimulus than a cell not bound by a binding molecule of the invention.
- the binding molecule prevents or inhibits migration of a CCR9-expressing cell in response to CCL25.
- the binding molecule is capable of preventing or inhibiting migration of a CCR9-expressing cell from the periphery to the gut of a subject.
- the binding molecule of the invention is capable of inducing death of a CCR9-expressing cell to which it binds.
- the binding molecule is capable of mediating antibody dependent cell-mediated cytotoxicity (ADCC) against a CCR9- expressing cell to which it binds.
- the binding molecule is capable of mediating antibody dependent cell-mediated cytotoxicity (ADCC) against a CCR9-expressing lymphocyte to which it binds.
- ADCC antibody dependent cell-mediated cytotoxicity
- immediateating antibody dependent cell-mediated cytotoxicity or “mediating ADCC” means that the binding molecule is capable of inducing ADCC.
- ADCC is a mechanism of cell-mediated immune defence whereby an immune effector cell is activated to lyse a target cell whose membrane-surface antigens have been bound by binding molecules.
- immune effector cells include natural killer cells (NK cells), macrophages, neutrophils and eosinophils. Therefore, in some embodiments, the binding molecule is capable of inducing activation of such an immune effector cell.
- a binding molecule of the invention may be capable of inducing activation of such an immune effector cell when the binding molecule is bound to a CCR9-expressing cell.
- the binding molecule of the invention is capable of depleting CCR9- expressing cells in a population of cells comprising CCR9-expressing cells and immune effector cells.
- a binding molecule of the invention may be incubated with PBMCs and the percentage of CD4+CCR9+ cells remaining at the end of the incubation period determined using a non-competing CCR9 binding molecule. Varying concentrations of a binding molecule may be used to calculate a concentration-dependent killing effect of the binding molecule. From this, the EC50 of the binding molecule may be calculated.
- the EC50 may be calculated based on the killing of CD4+CCR9+ cells by PBMCs after binding of a binding molecule of the invention to the CD4+CCR9+ cells.
- the EC50 of a binding molecule of the invention (e.g. measured as described herein) is less than 100 nM, such as less than 50 nM, less than 25 nM, less than 10 nM, or less than 5 nM.
- the EC50 may be less than 3 nM, less than 2 nM, less than 1 nM, less than 500 pM, or less than 250 pM.
- the EC50 may be from about 2 pM to about 200 pM, such as from about 3.5 pM to about 200 pM. In some embodiments, the EC50 is from about 1 pM to about 5 nM, such as from about 4 pM to about 3 nM. In some embodiments, the EC50 is from about 2 nM to about 3 nM, such as from about 2.5 nM to about 3 nM, such as about 2.6 nM. In some embodiments, the EC50 is from about 0.25 nM to about 2.5 nM, such as from about 0.5 nM to about 1 nM, such as about 0.5 nM.
- the EC50 is from about 50 pM to about 250 pM, such as about 150 pM to about 250 pM, such as about 200 pM. In some embodiments, the EC50 is from about 3.5 pM to about 50 pM, such as from about 3.5 pM to about 25 pM. In some embodiments, the EC50 is from about 3.5 pM to about 5 pM or from about 4 pM to about 10 pM. In some embodiments, the EC50 is from about 6 pM to about 60 pM, such as from about 25 pM to about 60 pM, preferably from about 25 pM to about 35 pM such as about 30 pM.
- the EC50 when the binding molecule is bound to human CCR9 is from about 3.5 pM to about 10 pM, such as from about 4pM to about 5pM. In some embodiments, the EC50 where the binding molecule is bound to cynomolgus CCR9 is from about 6 pM to about 60 pM, such as from about 25 pM to about 60 pM, preferably from about 25 pM to about 35 pM such as about 30 pM.
- binding molecules can cross-link an immune effector cell to a CCR9- expressing cell.
- the binding molecules of the invention are capable of cross-linking an immune effector cell to a CCR9-expressing cell.
- binding molecules may be capable of cross-linking an immune effector cell to a CCR9-expressing cell by binding an Fc receptor on an immune effector cell.
- Fc receptors There are a number of Fc receptors that are specific for different classes of antibody, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors). Therefore, in some embodiments, the binding molecule is capable of binding to an Fc receptor.
- the binding molecule is capable of binding to an FcyR, such as a receptor selected from FcyRI, FcyRIla, FcyRIIb, FcyRIIIa, and FcyRIIIb. In some embodiments, the binding molecule is capable of binding to FcyRIIIa. In some embodiments, the binding molecule is capable of binding to an Fc receptor that is present on an immune effector cell.
- FcyR such as a receptor selected from FcyRI, FcyRIla, FcyRIIb, FcyRIIIa, and FcyRIIIb.
- the binding molecule is capable of binding to FcyRIIIa.
- the binding molecule is capable of binding to an Fc receptor that is present on an immune effector cell.
- Binding molecules can be bound by an Fc receptor on an immune effector cell via an Fc domain present in the binding molecule. Therefore, in some embodiments a binding molecule of the invention comprises a region that is capable of binding to an Fc receptor, such as an Fc receptor as defined above. In some embodiments, the binding molecule comprises an immunoglobulin Fc domain, or a fragment thereof that retains the ability to bind to one or more Fc receptors, such as one or more Fc receptors as defined above. As used herein, the term “Fc domain” refers to the portion of a single immunoglobulin heavy chain beginning in the hinge region and ending at the C-terminus of the antibody.
- a complete Fc domain may comprise at least a portion of a hinge (e.g. upper, middle, and/or lower hinge region) domain, a CH2 domain, and a CH3 domain.
- the binding molecule comprises a homodimer of an Fc domain.
- the binding molecule comprises a region that binds to CCR9, and further comprises such an immunoglobulin Fc domain or fragment thereof.
- the binding molecule is an immunoglobulin molecule or fragment thereof, which comprises an antigen-binding region that binds CCR9, and an Fc- binding region that binds to one or more Fc receptors as defined above.
- the Fc-binding region, immunoglobulin Fc domain, or fragment thereof is an IgG Fc domain or fragment thereof, such as an lgG1 , lgG2, lgG3 or lgG4 Fc domain or fragment thereof. In some embodiments, the Fc-binding region, immunoglobulin Fc domain or fragment thereof is an lgG1 Fc domain or fragment thereof. In some embodiments, the Fc-binding region, immunoglobulin Fc domain or fragment thereof is a human immunoglobulin Fc domain or fragment thereof, such as a human lgG1 Fc domain or fragment thereof. In some embodiments, the binding molecule comprises an immunoglobulin Fc domain having an amino acid sequence set forth in SEQ ID NO: 78. For example, in some embodiments the Fc domain comprises amino acids 111-330 of SEQ ID NO: 78.
- Binding of a binding molecule of the invention to an Fc receptor on an immune effector cell can cross-link the immune effector cell with a cell to which the antigen-binding portion of the binding molecule is bound.
- the binding molecule of the invention is capable of inducing immune effector cell activation.
- cross-linking of an immune effector cell to a CCR9-expressing cell by the binding molecule activates ADCC by the effector cell.
- Immune effector cell activation may be assessed by the methods described herein such as by an in vitro ADCC bioassay. Briefly, immune effector cells may be modified to express a reporter, such as a luciferase reporter, which acts as a surrogate for effector function. Immune effector cells comprising such a reporter are added to target cells which have been pre-incubated with a binding molecule. After incubation of the effector and target cells, reporter function (e.g. luminescence) is quantified. Such a method may thus be used to identify a binding molecule that is capable of activating an immune effector cell.
- a reporter such as a luciferase reporter
- the target cell may be a cell that is known to express CCR9.
- Such a method may be used to identify a target cell that expresses CCR9.
- the binding molecule may be a binding molecule that is known to bind to CCR9, such as a binding molecule of the invention.
- the binding molecule of the invention has an NK cell activation potency of ⁇ 5 nM, such as ⁇ 3 nM, ⁇ 2 nM, ⁇ 1 nM or ⁇ 0.5 nM as determined using a HEK cell line expressing CCR9A. In some embodiments, the binding molecule of the invention has an NK cell activation potency of 0.8 nM as determined using a Molt 4 cell line. In some embodiments, the activation of antibody dependent cell-mediated cytotoxicity by the effector cell causes lysis of the CCR9-expressing cell.
- a binding molecule to be considered capable of mediating ADCC against a CCR9- expressing cell to which it binds should have an immune effector cell activation potency, such as a NK cell activation potency, of ⁇ 20 nM as determined using a Molt 4 cell line, or ⁇ 30 nM as determined using a HEK cell line expressing CCR9A and/or a PBMC killing EC50 of ⁇ 3 nM.
- an immune effector cell activation potency such as a NK cell activation potency, of ⁇ 20 nM as determined using a Molt 4 cell line, or ⁇ 30 nM as determined using a HEK cell line expressing CCR9A and/or a PBMC killing EC50 of ⁇ 3 nM.
- a binding molecule of the invention provides for altered effector functions that, in turn, affect the biological profile of the binding molecule.
- alteration of the glycosylation profile of a constant region domain of an immunoglobulin molecule can increase Fc receptor binding of the modified binding molecule.
- constant region modifications consistent with this invention, may moderate complement binding.
- modifications of the constant region can be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
- modifications to the constant region in accordance with this invention can easily be made using well-known biochemical or molecular engineering techniques well within the purview of the skilled artisan.
- a binding molecule of the invention may have enhanced effector functions that increase the ability of the binding molecule to interact with an immune effector cell, such as that increase the ability of the binding molecule to cross-link an immune effector cell with a CCR9-expressing cell that is bound by the binding molecule, or that increase the ability opt the binding molecule to induce ADCC.
- the immunoglobulin Fc domain of a binding molecule provided herein is modified compared to the corresponding wild-type Fc domain, wherein said modification leads to an increased affinity for one or more Fc receptors, preferably one or more Fey receptors.
- the immunoglobulin Fc domain is modified compared to the corresponding wild-type Fc domain, wherein said modification leads to an enhanced antibody dependent cell-mediated cytotoxicity response.
- a binding molecule can be made that has an altered type of glycosylation, such as an afucosylated/hypofucosylated binding molecule having reduced amounts of fucosyl residues or a binding molecule having increased bisecting GlcNac structures. Such altered glycosylation profiles have been demonstrated to increase the ADCC ability of binding molecules. These modifications can be accomplished by any known means in the art such as those described in the Examples section herein.
- a binding molecule provided herein may be afucosylated.
- the binding molecule may comprise no fucose.
- the binding molecule may include at least one N- linked glycan which lacks a core fucose sugar unit.
- the binding molecule is afucosylated at EU position 297, also referred to herein as position N297 (Edelman et al., 1969, Proc Natl Acad Sci USA 63(1): 78-85). That is, the N- linked glycan at position N297 may be absent, may lack fucose, or may lack a core fucose sugar unit.
- the N-linked glycan at amino acid position N297 corresponds to position N180 in SEQ ID NO: 78.
- the binding molecule comprises SEQ ID NO: 78 wherein N180 of SEQ ID NO: 78 is afucosylated.
- the binding molecule comprises an Fc domain comprising amino acids 111-330 of SEQ ID NO: 78 wherein N180 of SEQ ID NO: 78 is afucosylated.
- the binding molecule may comprise an Fc domain or a fragment thereof, such as an hlgG1 Fc domain or a fragment thereof.
- the binding molecule comprises an afucosylated Fc domain or fragment thereof, such as an afucosylated hlgG1 Fc domain or fragment thereof. Any of the Fc domains or Fc domain fragments as described herein may be present in an afucosylated form.
- the Fc domain or fragment may comprise no fucose. At least one N-linked glycan of the Fc domain or fragment may lack a core fucose sugar unit.
- the Fc domain or fragment may be afucosylated at EU position 297.
- the binding molecule comprises an afucosylated Fc domain comprising amino acids 111-330 of SEQ ID NO: 78.
- the binding molecule may comprise an afucosylated Fc domain comprising amino acids 111-330 of SEQ ID NO: 78 wherein N180 of SEQ ID NO: 78 is afucosylated.
- the binding molecule comprises an afucosylated Fc domain and a non-afucosylated Fc domain.
- the binding molecule may comprise an afucosylated Fc domain comprising amino acids 111-330 of SEQ ID NO: 78, wherein N180 of SEQ ID NO: 78 is afucosylated, and a non-afucosylated Fc domain comprising amino acids 111-330 of SEQ ID NO: 78.
- the binding molecule is fully afucosylated.
- all of the N-linked glycans of the binding molecule may be afucosylated.
- the Fc domain of the binding molecule is fully afucosylated.
- all of the N-linked glycans of the Fc domain may be afucosylated.
- the binding molecule is present in a composition comprising multiple copies of said binding molecule, wherein at least 50%, 75%, 90%, 95%, 98%, 99% or 100% of the copies of the binding molecule in the composition are afucosylated, e.g. lacking fucose, lacking a core fucose sugar unit in at least one N-linked glycan, or afucosylated at EU position 297, as described herein.
- the binding molecule has an amino acid sequence as disclosed herein, but the copies of the binding molecule in the composition may vary in their glycosylation pattern, e.g. some copies may comprise fucose and some copies may lack fucose, e.g. lacking a core fucose sugar unit in at least one N-linked glycan, or being afucosylated at EU position 297, as described herein.
- the CCR9-expressing cell is a gut-resident cell. In any of the embodiments disclosed herein, the CCR9-expressing cell is a peripheral blood cell. In any of the embodiments disclosed herein, the CCR9-expressing cell expresses CD4, CD8, CD20, CD19, CD69 and/or CD103. In any of the embodiments disclosed herein, the CCR9-expressing cell expresses GM-CSF, IL-22, TNFa, IL-6, IFNy, IL-4 and/or IL-17. For example, the CCR9-expressing cell may express IFNy, IL-4 and/or IL-17.
- the CCR9- expressing cell is a lymphocyte, e.g. a gut-resident lymphocyte or a peripheral blood lymphocyte.
- the lymphocyte is a T-lymphocyte such as a CD4+ T-lymphocyte.
- the lymphocyte is a B-lymphocyte.
- the immune effector cell is a NK cell, a macrophage, a neutrophil, an eosinophil or a combination thereof. In any of the embodiments disclosed herein, the immune effector cell is a NK cell.
- a binding molecule of the invention may have any one or more of the functional characteristics set out above. Additionally or alternatively, it may have any one or more of the structural (e.g. sequence) characteristics set out below.
- Figure 3 and Figure 4 illustrate sequences from exemplified binding molecules of the invention.
- the binding molecules illustrated in Figure 3 and Figure 4 are antibodies, where the antibodies comprise a variable heavy domain (VH) and variable light domain (VL) region sequence as illustrated in these Figures.
- the binding molecule of the invention may comprise a VH and VL of any antibody illustrated in Figure 3 or Figure 4.
- the binding molecule of the invention may comprise a VH and VL of any antibody illustrated in Figure 4.
- Table 3 provides the amino acid sequences of the VH and VL regions
- Table 4 provides CDR sequences, for exemplary binding molecules of the invention.
- the binding molecule of the invention may comprise the VH and VL of any binding molecule illustrated in Table 3.
- the binding molecule of the invention may comprise a set of six CDRs (HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3) of any binding molecule illustrated in Table 4.
- a binding molecule of the invention may comprise the CDR sequences of any antibody as shown in Figure 3 or Figure 4.
- a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Figure 3 or Figure 4.
- a binding molecule of the invention may comprise the CDR sequences of any antibody as shown in Figure 4.
- a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Figure 4.
- a binding molecule of the invention may comprise a set of six CDRs as illustrated in Table 4.
- a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Table 4.
- a binding molecule of the invention may comprise a heavy chain variable (VH) region having a set of CDRs HCDR1 , HCDR2 and HCDR3 and a light chain variable (VL) region having a set of CDRs LCDR1 , LCDR2 and LCDR3.
- VH heavy chain variable region
- VL light chain variable region
- the binding molecule may comprise a heavy chain variable region (VH) which comprises HCDR1 , HCDR2, HCDR3 as indicated for any one of the antibodies illustrated in Figure 3 or Figure 4, and a light chain variable region (VL) which comprises LCDR1 , LCDR2 and LCDR3 as indicated for the same antibody illustrated in Figure 3 or Figure 4.
- the binding molecule may comprise a heavy chain variable region (VH) which comprises HCDR1 , HCDR2, HCDR3 as indicated for any one of the antibodies illustrated in Figure 4, and a light chain variable region (VL) which comprises LCDR1 , LCDR2 and LCDR3 as indicated for the same antibody illustrated in Figure 4.
- the binding molecule may comprise a heavy chain variable region (VH) which comprises HCDR1 , HCDR2, HCDR3 as indicated for any one of the antibodies illustrated in Table 4, and a light chain variable region (VL) which comprises LCDR1 , LCDR2 and LCDR3 as indicated for the same antibody illustrated in Table 4.
- the binding molecule comprises: a) HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, HCDR3 of SEQ ID NO: 3, LCDR1 of SEQ ID NO: 4, LCDR2 of SEQ ID NO: 5 and LCDR3 of SEQ ID NO: 6 wherein Xi and X of SEQ ID NO: 4 are any amino acid; b) HCDR1 of SEQ ID NO: 7, HCDR2 of SEQ ID NO: 8, HCDR3 of SEQ ID NO: 9, LCDR1 of SEQ ID NO: 10, LCDR2 of SEQ ID NO: 11 and LCDR3 of SEQ ID NO: 12; or c) HCDR1 of SEQ ID NO: 13, HCDR2 of SEQ ID NO: 14, HCDR3 of SEQ ID NO: 15, LCDR1 of SEQ ID NO: 16, LCDR2 of SEQ ID NO: 17 and LCDR3 of SEQ ID NO: 18.
- the binding molecule comprises: a) a VH region comprising HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2 and HCDR3 of SEQ ID NO: 3, and a VL region comprising LCDR1 of SEQ ID NO: 4, LCDR2 of SEQ ID NO: 5 and LCDR3 of SEQ ID NO: 6 wherein Xi and X of SEQ ID NO: 4 are any amino acid; b) a VH region comprising HCDR1 of SEQ ID NO: 7, HCDR2 of SEQ ID NO: 8 and HCDR3 of SEQ ID NO: 9, and a VL region comprising LCDR1 of SEQ ID NO: 10, LCDR2 of SEQ ID NO: 11 and LCDR3 of SEQ ID NO: 12; or c) a VH region comprising HCDR1 of SEQ ID NO: 13, HCDR2 of SEQ ID NO: 14 and HCDR3 of SEQ ID NO: 15, and a VL region
- the binding molecule may comprise HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, HCDR3 of SEQ ID NO: 3, LCDR2 of SEQ ID NO: 5, LCDR3 of SEQ ID NO: 6 and LCDR1 having an amino acid sequence selected from: (a) SEQ ID NO: 4; (b) SEQ ID NO: 19; (c) SEQ ID NO: 20; (d) SEQ ID NO: 21 ; and (e) SEQ ID NO: 22 wherein Xi and X of SEQ ID NO: 4 are any amino acid, and wherein Xi of SEQ ID NO: 19 is P or S and X of SEQ ID NO: 19 is R, T or G.
- the binding molecule comprises: a) HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, HCDR3 of SEQ ID NO: 3, LCDR1 of SEQ ID NO: 4, LCDR2 of SEQ ID NO: 5, and LCDR3 of SEQ ID NO: 6 wherein Xi and X 2 of SEQ ID NO: 4 are any amino acid; b) HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, HCDR3 of SEQ ID NO: 3, LCDR1 of SEQ ID NO: 19, LCDR2 of SEQ ID NO: 5, and LCDR3 of SEQ ID NO: 6 wherein Xi of SEQ ID NO: 19 is P or S and X 2 of SEQ ID NO: 19 is R, T or G; c) HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, HCDR3 of SEQ ID NO: 3, LCDR1 of SEQ ID NO: 20,
- the binding molecule comprises: a) a VH region comprising HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, and HCDR3 of SEQ ID NO: 3, and a VL region comprising LCDR1 of SEQ ID NO: 4, LCDR2 of SEQ ID NO: 5, and LCDR3 of SEQ ID NO: 6 wherein Xi and X of SEQ ID NO: 4 are any amino acid; b) a VH region comprising HCDR1 of SEQ ID NO: 1 , HCDR2 of SEQ ID NO: 2, and HCDR3 of SEQ ID NO: 3, and a VL region comprising LCDR1 of SEQ ID NO: 19, LCDR2 of SEQ ID NO: 5, and LCDR3 of SEQ ID NO: 6 wherein Xi of SEQ ID NO: 19 is P or S and X 2 of SEQ ID NO: 19 is R, T or G; c) a VH region comprising HCDR1 of SEQ ID NO: 1 ,
- the present invention encompasses the binding molecules defined herein having the recited CDR sequences (reference binding molecules), as well as functional variants thereof.
- a functional variant binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross-reactivity profile as the reference binding molecule.
- the functional variant may bind to the same naturally occurring forms of CCR9 as the reference binding molecule, such as binding to the same subset of molecules from the following list: human CCR9A, human CCR9B, cynomolgus CCR9, rat CCR9 and mouse CCR9.
- the functional variants may have a different affinity for a target antigen when compared to the reference binding molecule, but substantially the same affinity is preferred.
- a functional binding molecule variant may comprise a functional variant of a CDR.
- the term “functional variant” is used in the context of a CDR sequence, this means that the CDR has 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence, and when combined with the remaining 5 CDRs (or variants thereof) enables the variant binding molecule to bind to the same target antigen as the reference binding molecule, and preferably to exhibit the same antigen cross-reactivity profile as the reference binding molecule.
- a binding molecule comprises: a light chain CDR1 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; a light chain CDR2 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; a light chain CDR3 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; a heavy chain CDR1 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; a heavy chain CDR2 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; and a heavy chain CDR3 having 1 , 2 or 3 amino acid differences when compared to a corresponding reference CDR sequence; wherein the binding molecule binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross- reactivity as the reference binding molecule.
- a binding molecule comprises: a light chain CDR1 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; a light chain CDR2 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; a light chain CDR3 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; a heavy chain CDR1 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; a heavy chain CDR2 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; and a heavy chain CDR3 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence; wherein the binding molecule binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross-reactivity profile as the reference binding molecule.
- a binding molecule comprises a light chain CDR1 having at most 2 amino acid differences when compared to a corresponding reference CDR sequence;
- a binding molecule may comprise: a light chain CDR1 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; a light chain CDR2 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; a light chain CDR3 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; a heavy chain CDR1 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; a heavy chain CDR2 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; and a heavy chain CDR3 having at most 1 amino acid difference when compared to a corresponding reference CDR sequence; wherein the binding molecule binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross- reactivity profile as the reference binding molecule.
- a variant binding molecule may have at most 5, 4 or 3 amino acid differences total in the CDRs thereof when compared to a corresponding reference binding molecule, with the proviso that there are at most 3, at most 2 or at most 1 amino acid differences per CDR.
- a variant binding molecule has at most 2 (more preferably at most 1) amino acid differences total in the CDRs thereof when compared to a corresponding reference binding molecule, with the proviso that there are at most 2 amino acid differences per CDR.
- More a variant binding molecule has at most 2 (more preferably at most 1) amino acid differences total in the CDRs thereof when compared to a corresponding reference binding molecule, with the proviso that there is at most 1 amino acid difference per CDR.
- such a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences of a reference binding molecule (such as any one of the antibodies illustrated in Figure 3 or Figure 4 or Table 3), wherein any one or more of said HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences comprises 1 , 2 or 3 amino acid changes, compared to the respective CDR sequences of the reference binding molecule.
- a reference binding molecule such as any one of the antibodies illustrated in Figure 3 or Figure 4 or Table 3
- a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences of a reference binding molecule (such as any one of the antibodies illustrated in Figure 3 or Figure 4), except for having 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one of said CDR sequences.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one or more of said light chain CDRs and/or any one or more of said heavy chain CDRs.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one or more of HCDR1 , HCDR2, LCDR1 , LCDR2 and LCDR3.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in LCDR1 .
- the reference binding molecule in any of the embodiments herein may be an antibody having a VH and VL sequences of any of the antibodies illustrated in Figure 3 or Figure 4 or binding molecules of Table 3, or an antibody having the set of six CDRs of any of the antibodies illustrated in Figure 3 or Figure 4 or Table 4.
- the amino acid difference may be an amino acid substitution, insertion or deletion. In some embodiments the amino acid difference is a conservative amino acid substitution as described herein.
- the binding molecule comprises all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Figure 3 or Figure 4, or Table 4 or as indicated above, or a functional variant of any thereof.
- such a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Figure 3 or Figure 4 or Table 4 or as indicated above, wherein any one or more of said HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences comprises 1 , 2 or 3 amino acid changes, e.g. substitutions, compared to the respective sequences as recited in Figure 3 or Figure 4 or Table 4 or above.
- a binding molecule may comprise all six of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences as indicated for any one of the antibodies illustrated in Figure 3 or Figure 4 or binding molecules of Table 3 or as indicated above, except for having 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one of said CDR sequences.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one or more of said light chain CDRs and/or any one or more of said heavy chain CDRs.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in any one or more of HCDR1 , HCDR2, LCDR1 , LCDR2 and LCDR3.
- the binding molecule may comprise 1 , 2 or 3 amino acid changes, e.g. substitutions, in LCDR1.
- a binding molecule of the invention may comprise the heavy chain variable region (VH) and the light chain variable region (VL) of any antibody as shown in Figure 3 or Figure 4 or binding molecule of Table 3.
- the binding molecule comprises: a) a VH region amino acid sequence comprising SEQ ID NO: 51 and a VL region amino acid sequence comprising SEQ ID NO: 52; b) a VH region amino acid sequence comprising SEQ ID NO: 51 and a VL region amino acid sequence comprising SEQ ID NO: 53; c) a VH region amino acid sequence comprising SEQ ID NO: 51 and the VL region amino acid sequence comprising SEQ ID NO: 54; d) a VH region amino acid sequence comprising SEQ ID NO: 51 and a VL region amino acid sequence comprising SEQ ID NO: 55
- Xi and X2 are each any amino acid (SEQ ID NO: 76); or (b) Xi is P or S and X2 is R, T or G (SEQ ID NO: 77)); or e) a VH region amino acid sequence comprising SEQ ID NO: 56 and a VL region amino acid sequence comprising SEQ ID NO: 57.
- the binding molecule comprises: a) a VH region amino acid sequence comprising SEQ ID NO: 58 and a VL region amino acid sequence comprising SEQ ID NO: 59; or b) a VH region amino acid sequence comprising SEQ ID NO: 60 and a VL region amino acid sequence comprising SEQ ID NO: 61.
- the present invention encompasses binding molecules as described herein comprising the recited VH and VL region sequences (reference binding molecules), as well as functional variants thereof.
- a functional variant binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross-reactivity as the reference binding molecule.
- the functional variants may have a different affinity for the target antigen when compared to the reference binding molecule, but substantially the same affinity is preferred.
- the VH region sequence of a binding molecule may have at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to the corresponding VH region sequence of a reference binding molecule.
- the VL region sequence of a binding molecule may have at least 80%, at least 85%, at least 90%, at least 95%, at least 98% or at least 99% sequence identity to the corresponding VL region sequence of a reference binding molecule.
- the CDRs of such a binding molecule are identical to the CDRs of the reference binding molecule, and the differences all lie outside those CDRs, e.g. the differences between the binding molecule and the reference binding molecule are in the framework regions of the VH and/or VL sequences.
- the CDRs of such a binding molecule are functional variants, as described above.
- such a binding molecule comprises amino acid differences in one or more CDRs and amino acid differences in one or more framework regions compared with the VH and/or VL sequences of the corresponding reference binding molecule.
- a binding molecule has the same framework sequences as the reference binding molecules.
- the binding molecule comprises a framework region having at most 2, preferably at most 1 amino acid difference (when compared to a corresponding reference framework sequence).
- each framework region may have at most 2, preferably at most 1 amino acid difference (when compared to a corresponding reference framework sequence).
- a binding molecule may have at most 5, 4 or 3 amino acid differences total in the framework regions thereof when compared to a corresponding reference binding molecule, with the proviso that there is at most 2 (preferably at most 1) amino acid differences per framework region.
- Such a binding molecule may have at most 2 (more preferably at most 1) amino acid differences total in the framework regions thereof when compared to a corresponding reference binding molecule, with the proviso that there is at most 2 amino acid differences per framework region.
- Such a binding molecule may have at most 2 (more preferably at most 1) amino acid differences total in the framework regions thereof when compared to a corresponding reference binding molecule, with the proviso that there is at most 1 amino acid difference per framework region.
- a binding molecule may comprise a VH region and a VL region as described herein, wherein: the VH region has at most 14 amino acid differences (at most 2 amino acid differences in each CDR and at most 2 amino acid differences in each framework region) when compared to the VH region of a reference binding molecule herein; and the VL region has at most 14 amino acid differences (at most 2 amino acid differences in each CDR and at most 2 amino acid differences in each framework region) when compared to the VL region of a reference binding molecule herein; wherein the variant binding molecule binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross- reactivity as the reference binding molecule.
- Said variant VH or VL regions may be referred to as “functional equivalents” of the reference VH or VL regions.
- a binding molecule may comprise a VH region and a VL region as described herein, wherein: the VH region has at most 7 amino acid differences (e.g. at most 1 amino acid difference in each CDR and at most 1 amino acid difference in each framework region) when compared to a VH region of a reference binding molecule herein; and the VL region has at most 7 amino acid differences (e.g. at most 1 amino acid difference in each CDR and at most 1 amino acid difference in each framework region) when compared to a VL region of a reference binding molecule herein; wherein the variant binding molecule binds to the same target antigen as the reference binding molecule, and preferably exhibits the same antigen cross-reactivity as the reference binding molecule.
- the VH region has at most 7 amino acid differences (e.g. at most 1 amino acid difference in each CDR and at most 1 amino acid difference in each framework region) when compared to a VH region of a reference binding molecule herein
- the VL region has at most 7 amino acid
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 55 or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto, wherein (i) Xi and X of SEQ ID NO: 55 are each any amino acid (SEQ ID NO: 76); or (ii) Xi of SEQ ID NO: 55 is P or S and X 2 of SEQ ID NO: 55 is R, T or G (SEQ ID NO: 77).
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 76 or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 77 or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: d) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and e) a VL region comprising the amino acid sequence of SEQ ID NO: 52, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 53, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 51 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 54, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 56, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 57, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 58, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 59, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 60, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 61 , or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- the binding molecule comprises: a) a VH region comprising an amino acid sequence having at least 80%, 85%, 90%, 95%, 98%, 99% or 100% sequence identity to a reference amino acid sequence of SEQ ID NO: 51 , 56,
- VL region comprising an amino acid sequence having at least 70%, 75%, 80%, 90%, 95% or 100% sequence identity to a reference amino acid sequence of SEQ ID NO: 52, 53, 54, 55, 57,
- X1 and X2 of SEQ ID NO: 55 are each any amino acid (SEQ ID NO: 76); or (ii) X1 of SEQ ID NO: 55 is P or S and X2 of SEQ ID NO: 55 is R, T or G (SEQ ID NO: 77).
- the foregoing can be applied to any of the antibodies illustrated in Figure 3 or Figure 4 or binding molecules of Table 3, or to any of the binding molecules described herein, wherein the amino acid differences are defined relative to the VH and/or VL sequences thereof, and wherein the binding molecule binds to the same target antigen as said binding molecules, and preferably exhibits the same antigen cross-reactivity.
- the reference binding molecule in any of the embodiments herein may be an antibody having a VH and VL sequence of any of the antibodies illustrated in Figure 3 or Figure 4 or binding molecules of Table 3.
- the amino acid difference may be an amino acid substitution, insertion or deletion. In some embodiments the amino acid difference is a conservative amino acid substitution as described herein.
- binding molecule of the invention may be provided in isolated form.
- the binding molecule of the invention is an immunoglobulin molecule. In some embodiments, the binding molecule is an antibody, or an antigen-binding fragment thereof.
- an antibody is a protein including at least one or two, heavy (H) chain variable regions (abbreviated herein as VH), and at least one or two light (L) chain variable regions (abbreviated herein as VL).
- VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions” (“CDR"), interspersed with regions that are more conserved, termed “framework regions” (FW).
- CDR complementarity determining regions
- FW framework regions
- the extent of the framework region and CDRs has been precisely defined (see, Kabat, E.A., et al. Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.
- each VH and VL region is composed of three CDRs and four FWs, arranged from amino-terminus to carboxy-terminus in the following order: FW1 , CDR1 , FW2, CDR2, FWS, CDR3, FW4.
- the heavy or light chain of the antibody can further include all or part of a heavy or light chain constant region.
- the binding molecule comprises all or part of a heavy chain constant region of SEQ ID NO: 78 and all or part of a light chain constant region of SEQ ID NO: 79.
- the binding molecule comprises a heavy chain constant region and a light chain constant region as shown in Table 7.
- the binding molecule may comprise a functional fragment of a heavy chain constant region and/or a light chain constant region as shown in Table 7, such as a fragment wherein the binding molecule retains the ability to bind to one or more Fc receptors, as described herein.
- the binding molecule may comprise a heavy chain constant region and a light chain constant region as shown in Table 7, and may further comprise a VH region and a VL region as disclosed herein, e.g. the VH and VL sequences of any of the antibodies illustrated in Figure 3 or Figure 4 or binding molecules of Table 1.
- the binding molecule is an antibody that is a tetramer of two heavy immunoglobulin chains and two light immunoglobulin chains, wherein the heavy and light immunoglobulin chains are interconnected by, e.g., disulfide bonds.
- the heavy chain constant region includes three domains, CH1 , CH2 and CH3.
- the binding molecule has a heavy chain constant region of SEQ ID NO: 78.
- the light chain constant region is comprised of one domain, CL.
- the binding molecule has a light chain constant region of SEQ ID NO: 79.
- the variable region of the heavy and light chains contains a binding domain that interacts with an antigen.
- the “Kabat numbering system” is generally used when referring to a residue in the variable region (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al. , Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- amino acid position numbering refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FW or CDR of the variable domain.
- a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FW residue 82.
- the Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901- 917 (1987)).
- the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention, varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The table below lists the positions of the amino acids comprising the variable regions of the antibodies in each system.
- ImMunoGeneTics also provides a numbering system for the immunoglobulin variable regions, including the CDRs. See, e.g., Lefranc, M.P. et al., Dev. Comp. Immunol. 27: 55-77(2003).
- the IMGT numbering system is based on an alignment of more than 5,000 sequences, structural data, and characterization of hypervariable loops and allows for easy comparison of the variable and CDR regions for all species.
- HCDR1 is at positions 26 to 35
- HCDR2 is at positions 51 to 57
- HCDR3 is at positions 93 to 102
- LCDR1 is at positions 27 to 32
- LCDR2 is at positions 50 to 52
- LCDR3 is at positions 89 to 97.
- antibody includes intact immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof), wherein the light chains of the immunoglobulin may be of types kappa or lambda.
- the binding molecule of the invention may be, or may comprise, a full-length antibody, or may be or comprise an antigen-binding fragment thereof.
- antigen binding fragment refers to a portion of an antibody that binds to CCR9, e.g., a molecule in which one or more immunoglobulin chains is not full length, but which binds to CCR9.
- the antigenbinding fragment is one or more selected from a Fv fragment, an Fab fragment, an F(ab')2 fragment, an Fab' fragment, a dsFv fragment, an scFv fragment, an sc(Fv)2 fragment, a dAb fragment, a single chain antibody, or a combination thereof.
- the antigen-binding fragment is a Fab fragment.
- the binding molecule comprises a Fab domain.
- the antibodies of the invention or antigen-binding fragments thereof may have any antibody format.
- the antibody has the “conventional” format described above.
- the antibody can be in some embodiments a Fab fragment.
- the antibody or antigenbinding fragment according to the invention can also be a Fab', an Fv, an scFv, an Fd, a V NAR domain, an IgNAR, an intrabody, an IgG CH2, a minibody, a single-domain antibody, an Fcab, an scFv-Fc, F(ab')2, a di-scFv, a bi-specific T-cell engager (BiTE®), a F(ab')3, a tetrabody, a triabody, a diabody, a DVD-lg, an (scFv)2, or a mAb2.
- the binding molecule is a monoclonal antibody (mAb). In some embodiments, the binding molecule is a polyclonal antibody.
- a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
- the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
- “monoclonal antibody” refers to such antibodies made in any number of ways including, but not limited to, hybridoma, phage selection, recombinant expression, and transgenic animals.
- the antibody or antigen binding fragment is one or more selected from a murine antibody, a humanised antibody, a chimeric antibody, a fully human antibody, a monoclonal antibody, a polyclonal antibody, a recombinant antibody, a multispecific antibody, or a combination thereof.
- the antibody or antigen binding fragment is a humanised antibody.
- an antibody of the invention does not induce an anti-human antibody response, for example, a murine anti-human antibody response.
- the antibodies of the invention and antigen-binding fragments thereof may be derived from any species by recombinant means.
- the antibodies or antigen-binding fragments may be mouse, rat, goat, horse, swine, bovine, chicken, rabbit, camelid, donkey, human, or chimeric versions thereof.
- non-human derived antibodies or antigen-binding fragments may be genetically or structurally altered to be less antigenic upon administration to the human patient.
- human or humanized antibodies especially as recombinant human or humanized antibodies.
- the term “humanised antibody” refers to an antibody derived from a nonhuman (e.g., murine) immunoglobulin, which has been engineered to contain minimal non-human (e.g., murine) sequences.
- humanised antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a nonhuman species (e.g., mouse, rat, rabbit, or hamster) that have the desired specificity, affinity, and capability (Jones et al.
- CDR complementary determining region
- the Fv framework region residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and capability.
- Humanised antibodies can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
- humanised antibodies will comprise substantially all of at least one, and typically two orthree, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- Humanised antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanised antibodies are described in U.S. Pat. Nos. 5,225,539 or 5,639,641 .
- an antibody of the invention is a human antibody.
- human antibody means an antibody produced in a human or an antibody having an amino acid sequence corresponding to an antibody produced in a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
- an antibody ofthe invention is a chimeric antibody.
- chimeric antibodies refers to antibodies in which the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid eliciting an immune response in that species.
- IgA immunoglobulin G
- IgG immunoglobulin G
- IgD immunoglobulin D
- IgE immunoglobulin M
- IgM immunoglobulin M
- IgG is separated into four subclasses known as IgGI, lgG2, lgG3, and lgG4.
- Ig molecules interact with multiple classes of cellular receptors.
- IgG molecules interact with three classes of Fey receptors (FcyR) specific for the IgG class of antibody, namely FcyRI, FcyRII, and FcyRIII.
- FcyR Fey receptors
- the antibodies of the invention or antigen-binding fragments thereof may be any isotype, i.e. IgA, IgD, IgE, IgG and IgM, and synthetic multimers of the four-chain immunoglobulin (Ig) structure.
- the antibodies or antigen-binding fragments thereof are IgG isotype.
- the antibodies or antigen-binding fragments can be any IgG subclass, for example lgG1 , lgG2, lgG3, or lgG4 isotype.
- the antibodies or antigen-binding fragments thereof are of an lgG1 or lgG2 isotype.
- the antibodies comprise a heavy chain constant region that is of IgG isotype. In some embodiments, the antibodies comprise a portion of a heavy chain constant region that is of IgG isotype. In some embodiments, the IgG constant region or portion thereof is an lgG1 , lgG2, lgG3, or lgG4 constant region. Preferably, the IgG constant region or portion thereof is an lgG1 or lgG2 constant region.
- Antibody molecules can also have other formats, e.g. lgG1 with YTE (Dall'Acqua et al. (2002) J. Immunology, 169: 5171- 5180; Dall'Acqua et al. (2006) J Biol. Chem. 281 (33):23514-24) and/or TM mutations (Oganesyan et al. (2008) Acta Cryst D64:700-4) in the Fc region.
- the antibodies ofthe invention or antigen-binding fragments thereof may comprise a lambda light chain or a kappa light chain.
- Engineered antibodies and antigen-binding fragments thereof include those in which modifications have been made to framework residues within the VH region and/or VL region. Such modifications may improve the properties of the antibody, for example to decrease the immunogenicity ofthe antibody and/or improve antibody production and purification.
- the binding molecules of the invention include both intact and modified forms of the binding molecules disclosed herein.
- a binding molecule ofthe invention can be functionally linked (e.g. by chemical coupling, genetic fusion, noncovalent association, or otherwise) to one or more other molecular entities, such as a pharmaceutical agent, a detection agent, and/or a protein or peptide that can mediate association of a binding molecule disclosed herein with another molecule (e.g.
- Non-limiting examples of detection agents include: enzymes, such as alkaline phosphatase, glucose-6-phosphate dehydrogenase ("G6PDH”), alpha-D- galactosidase, glucose oxydase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase and peroxidase, e.g., horseradish peroxidase; dyes; fluorescent labels or fluorescers, such as fluorescein and its derivatives, fluorochrome, rhodamine compounds and derivatives, GFP (GFP for "Green Fluorescent Protein”), dansyl, umbelliferone, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine; fluorophores such as lanthanide cryptates and chelates, e
- enzymes such as alkaline phosphatase, glucose
- the binding molecules of the invention also include derivatives that are modified (e.g., by the covalent attachment of any type of molecule to the binding molecule) such that covalent attachment does not prevent the binding molecule from binding to its target (e.g. epitope), or otherwise impair the biological activity of the binding molecule.
- Suitable derivatives may be produced by methods that include, but are not limited to fucosylation, glycosylation, acetylation, PEGylation, phosphorylation, and amidation.
- binding molecules of the present invention including antibodies of the present invention, can be obtained using conventional techniques known to persons skilled in the art and their utility confirmed by conventional binding studies -exemplary methods are described in Examples 3 and 4.
- a simple binding assay is to incubate the cell expressing an antigen with the antibody. If the antibody is tagged with a fluorophore, the binding of the antibody to the antigen can be detected by FACS analysis.
- Antibodies of the present invention can be raised in various animals including mice, rats, rabbits, goats, sheep, monkeys or horses. Antibodies may be raised following immunisation with individual capsular polysaccharides, or with a plurality of capsular polysaccharides. Blood isolated from these animals contains polyclonal antibodies - multiple antibodies that bind to the same antigen. Antigens may also be injected into chickens for generation of polyclonal antibodies in egg yolk. To obtain a monoclonal antibody that is specific for a single epitope of an antigen, antibody-secreting lymphocytes are isolated from an animal and immortalized by fusing them with a cancer cell line. The fused cells are called hybridomas, and will continually grow and secrete antibody in culture.
- Single hybridoma cells are isolated by dilution cloning to generate cell clones that all produce the same antibody; these antibodies are called monoclonal antibodies.
- Methods for producing monoclonal antibodies are conventional techniques known to those skilled in the art (see e.g. Making and Using Antibodies: A Practical Handbook. GC Howard. CRC Books. 2006. ISBN 0849335280).
- Polyclonal and monoclonal antibodies are often purified using Protein A/G or antigen-affinity chromatography.
- the antibody or antigen binding fragment thereof of the invention may be prepared as a monoclonal anti-CCR9 antibody, which can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature 256:495 (1975). Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro.
- the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
- Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or an in vitro binding assay, e.g., radioimmunoassay (RIA) or enzyme-linked immunosorbent assay (ELISA) can then be propagated either in in vitro culture using standard methods (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, 1986) or in vivo as ascites tumors in an animal.
- the monoclonal antibodies can then be purified from the culture medium or ascites fluid using known methods.
- the binding molecule (e.g. a monoclonal antibody) can also be made using recombinant DNA methods as described in U.S. Patent No. 4,816,567.
- the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cell, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
- the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E.
- monoclonal antibodies are generated by the host cells.
- recombinant monoclonal antibodies or antigen-binding fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described in McCafferty et al., Nature 348:552-554 (1990); Clackson et al. , Nature, 352:624-628 (1991); and Marks et al., J. Mol. Biol. 222:581-597 (1991).
- the polynucleotide(s) encoding a binding molecule of the invention can further be modified in a number of different manners using recombinant DNA technology to generate alternative binding molecules.
- the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted (1) for those regions of, for example, a human antibody to generate a chimeric antibody or (2) for a non-immunoglobulin polypeptide to generate a fusion antibody.
- the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
- the antibody or antigen-binding fragment thereof is a human antibody or antigen-binding fragment thereof.
- Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated. See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., J. Immunol. 147 (1):86-95 (1991); U.S. Patent 5,750,373.
- the antibody or antigen-binding fragment thereof can be selected from a phage library, where that phage library expresses human antibodies, as described, for example, in Vaughan et al., Nat. Biotech. 14:309-314 (1996); Sheets et al average Proc. Natl. Acad. Sci. USA, 95:6157- 6162 (1998); Hoogenboom and Winter, J. Mol. Biol. 227:381 (1991); and Marks et al span J. Mol. Biol. 222:581 (1991). Techniques forthe generation and use of antibody phage libraries are also described in U.S. Patent Nos.
- Affinity maturation strategies and chain shuffling strategies are known in the art and can be employed to generate high affinity human antibodies or antigen-binding fragments thereof. See Marks et al. , BioTechnology 10:779-783 (1992), incorporated by reference in its entirety.
- the antibody or antigen binding fragment thereof can be a humanised antibody.
- Methods for engineering, humanizing or resurfacing nonhuman or human antibodies can also be used and are well known in the art.
- a humanised, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is nonhuman, e.g., but not limited to, mouse, rat, rabbit, non-human primate, or other mammal. These nonhuman amino acid residues are replaced by residues that are often referred to as “import” residues, which are typically taken from an “import” variable, constant or other domain of a known human sequence.
- CDR residues may be directly and most substantially involved in influencing CCR9 binding. Accordingly, part or all of the non-human or human CDR sequences are preferably maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids.
- Antibodies can also optionally be humanised, resurfaced, engineered or human antibodies engineered with retention of high affinity for the antigen CCR9 and other favourable biological properties.
- humanised (or human) or engineered anti-CCR9 antibodies and resurfaced antibodies can be optionally prepared by a process of analysis of the parental sequences and various conceptual humanised and engineered products using three-dimensional models of the parental, engineered, and humanised sequences.
- Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art.
- Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.
- FW residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
- Humanization, resurfacing or engineering of anti-CCR9 antibodies or antigen-binding fragments thereof of the present invention can be performed using any known method, such as but not limited to those described in, Jones et al. , Nature 321 :522 (1986); Riechmann et al. , Nature 332:323 (1988); Verhoeyen et al., Science 239:1534 (1988); Sims et al., J. Immunol. 151 : 2296 (1993); Chothia and Lesk, J. Mol. Biol. 196:901 (1987); Carter et al., Proc. Natl. Acad. Sci. USA 89:4285 (1992); Presta et al., J.
- Anti-CCR9 humanised antibodies and antigen-binding fragments thereof can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patent Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661 ,016.
- a fragment (e.g. antibody fragment) of the antibody e.g. anti-CCR9 antibody
- Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies, as described, for example, by Morimoto et al., J. Biochem. Biophys. Meth. 24:107-117 (1993) and Brennan et al., Science 229:81 (1985).
- anti-CCR9 antibody fragments are produced recombinantly.
- Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
- anti- CCR9 antibody fragments can also be isolated from the antibody phage libraries discussed above.
- the anti-CCR9 antibody fragments can also be linear antibodies as described in U.S. Patent No. 5,641 ,870. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- techniques can be adapted for the production of singlechain antibodies specific to CCR9. See, e.g., U.S. Pat. No. 4,946,778).
- methods can be adapted for the construction of Fab expression libraries to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for CCR9, or derivatives, fragments, analogs or homologs thereof. See, e.g., Huse et al. , Science 246:1275-1281 (1989).
- Antibody fragments can be produced by techniques known in the art including, but not limited to: F(ab')2 fragment produced by pepsin digestion of an antibody molecule; Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment; Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent; or Fv fragments.
- a modified binding molecule can comprise any type of binding region that provides forthe association of the binding molecule with CCR9.
- the binding region may be a variable region, that can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired antigen.
- the variable region of an anti-CCR9 antibody or antigen-binding fragment thereof can be, for example, of human, murine, non-human primate (e.g., cynomolgus monkeys, macaques, etc.) or lupine origin.
- variable and constant regions of the modified antibody or antigen-binding fragment thereof are human.
- variable regions of a compatible antibody usually derived from a non-human source
- variable regions useful in the present invention can be humanised or otherwise altered through the inclusion of imported amino acid sequences.
- variable domains in both the heavy and light chains of an antibody or antigen-binding fragment thereof are altered by at least partial replacement of one or more CDRs and/or by partial framework region replacement and sequence changing.
- the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It is not necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen-binding capacity of one variable domain to another. Rather, it is only necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site.
- a modified antibody or antigen-binding fragment thereof of this invention can comprise an antibody (e.g., full-length antibody or antigen-binding fragment thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased effector function including improved ability to induce ADCC when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
- the constant region of the modified antibody will comprise a human constant region.
- Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
- a modified antibody disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CH1 , CH2 or CH3) and/or to the light chain constant domain (CL).
- a modified constant region wherein one or more domains are partially or entirely deleted are contemplated.
- a modified antibody will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (DOH2 constructs).
- the omitted constant region domain can be replaced by a short amino acid spacer (e.g., 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
- sequence alignment methods can be used to determine percent identity, including, without limitation, global methods, local methods and hybrid methods, such as, e.g., segment approach methods. Protocols to determine percent identity are routine procedures within the scope of one skilled in the art. Global methods align sequences from the beginning to the end of the molecule and determine the best alignment by adding up scores of individual residue pairs and by imposing gap penalties. Non-limiting methods include, e.g., CLUSTAL W, see, e.g., Julie D. Thompson et al.
- Non-limiting methods include, e.g., Match-box, see, e.g., Eric Depiereux and Ernest Feytmans, Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences, 8(5) CABIOS 501 -509 (1992); Gibbs sampling, see, e.g., C. E.
- percent sequence identity is determined by conventional methods. See, for example, Altschul et al., Bull. Math. Bio. 48: 603-16, 1986 and Henikoff and Henikoff, Proc. Natl. Acad. Sci. USA 89:10915-19, 1992. Briefly, two amino acid sequences are aligned to optimize the alignment scores using a gap opening penalty of 10, a gap extension penalty of 1 , and the "blosum 62" scoring matrix of Henikoff and Henikoff (ibid.) as shown below (amino acids are indicated by the standard one- letter codes).
- the "percent sequence identity" between two or more nucleic acid or amino acid sequences is a function of the number of identical positions shared by the sequences. Thus, % identity may be calculated as the number of identical nucleotides / amino acids divided by the total number of nucleotides / amino acids, multiplied by 100. Calculations of % sequence identity may also take into account the number of gaps, and the length of each gap that needs to be introduced to optimize alignment of two or more sequences. Sequence comparisons and the determination of percent identity between two or more sequences can be carried out using specific mathematical algorithms, such as BLAST, which will be familiar to a skilled person.
- the present invention further embraces variants and equivalents that are substantially homologous to a binding molecule of the invention (e.g. an antibody, such as a murine, chimeric, humanised or human antibody, or antigen-binding fragments thereof).
- a binding molecule of the invention e.g. an antibody, such as a murine, chimeric, humanised or human antibody, or antigen-binding fragments thereof.
- These can contain, for example, conservative substitution mutations, i. e. , the substitution of one or more amino acids by similar amino acids.
- conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art.
- Substantially homologous polypeptides are characterized as having one or more amino acid substitutions, deletions or additions. These changes are preferably of a minor nature, that is conservative amino acid substitutions (see below) and other substitutions that do not significantly affect the folding or activity of the polypeptide; small deletions, typically of one to about 30 amino acids; and small amino- or carboxyl-terminal extensions, such as an amino-terminal methionine residue, a small linker peptide of up to about 20-25 residues, or an affinity tag.
- non-standard amino acids such as 4- hydroxyproline, 6-N-methyl lysine, 2-aminoisobutyric acid, isovaline and a -methyl serine
- a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, and unnatural amino acids may be substituted for polypeptide amino acid residues.
- the binding molecules of the present invention can also comprise non-naturally occurring amino acid residues.
- Non-naturally occurring amino acids include, without limitation, trans-3-methylproline, 2,4- methano-proline, cis-4-hydroxyproline, trans-4-hydroxy-proline, N-methylglycine, allo-threonine, methyl-threonine, hydroxy-ethylcysteine, hydroxyethylhomo-cysteine, nitro-glutamine, homoglutamine, pipecolic acid, tert-leucine, norvaline, 2-azaphenylalanine, 3-azaphenyl-alanine, 4-azaphenyl-alanine, and 4-fluorophenylalanine.
- Several methods are known in the art for incorporating non-naturally occurring amino acid residues into proteins.
- an in vitro system can be employed wherein nonsense mutations are suppressed using chemically aminoacylated suppressor tRNAs.
- Methods for synthesizing amino acids and aminoacylating tRNA are known in the art. Transcription and translation of plasmids containing nonsense mutations is carried out in a cell free system comprising an E. coli S30 extract and commercially available enzymes and other reagents. Proteins are purified by chromatography. See, for example, Robertson et al. , J. Am. Chem. Soc. 113:2722, 1991 ; Ellman et al. , Methods Enzymol.
- coli cells are cultured in the absence of a natural amino acid that is to be replaced (e.g., phenylalanine) and in the presence of the desired non-naturally occurring amino acid(s) (e.g., 2-azaphenylalanine, 3-azaphenylalanine, 4- azaphenylalanine, or 4-fluorophenylalanine).
- the non-naturally occurring amino acid is incorporated into the polypeptide in place of its natural counterpart. See, Koide et al., Biochem. 33:7470-6, 1994.
- Naturally occurring amino acid residues can be converted to non-naturally occurring species by in vitro chemical modification. Chemical modification can be combined with site-directed mutagenesis to further expand the range of substitutions (Wynn and Richards, Protein Sci. 2:395-403, 1993).
- a limited number of non-conservative amino acids, amino acids that are not encoded by the genetic code, non-naturally occurring amino acids, and unnatural amino acids may be substituted for amino acid residues of binding molecules of the present invention.
- Essential amino acids in the binding molecules of the present invention can be identified according to procedures known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244: 1081-5, 1989). Sites of biological interaction can also be determined by physical analysis of structure, as determined by such techniques as nuclear magnetic resonance, crystallography, electron diffraction or photoaffinity labelling, in conjunction with mutation of putative contact site amino acids. See, for example, de Vos et al., Science 255:306-12, 1992; Smith et al., J. Mol. Biol. 224:899-904, 1992; Wlodaver et al., FEBS Lett. 309:59-64, 1992. The identities of essential amino acids can also be inferred from analysis of homologies with related components (e.g. the translocation or protease components) of the binding molecules of the present invention.
- related components e.g. the translocation or protease components
- compositions comprising a binding molecule of the invention.
- the composition may comprise any binding molecule as described herein.
- the composition may comprise more than one binding molecule as described herein.
- composition comprising a binding molecule that binds to CCR9, wherein said binding molecule is capable of (i) inhibiting binding of CCL25 to CCR9, and (ii) mediating antibody dependent cell-mediated cytotoxicity against a CCR9-expressing cell to which it binds.
- a composition as described herein may be a pharmaceutical composition, such as a composition comprising a binding molecule of the present invention and further comprising at least one pharmaceutically acceptable carrier or diluent.
- pharmaceutical composition refers to a preparation that is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the composition would be administered.
- Such composition can be sterile, and can comprise a pharmaceutically acceptable carrier, such as physiological saline.
- Suitable pharmaceutical compositions can comprise one or more of a buffer (e.g., acetate, phosphate or citrate buffer), a surfactant (e.g., polysorbate), a stabilizing agent (e.g., human albumin), a preservative (e.g., benzyl alcohol), and absorption promoter to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
- a buffer e.g., acetate, phosphate or citrate buffer
- a surfactant e.g., polysorbate
- a stabilizing agent e.g., human albumin
- a preservative e.g., benzyl alcohol
- absorption promoter to enhance bioavailability, and/or other conventional solubilizing or dispersing agents.
- a pharmaceutical composition of the invention can comprise a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
- a pharmaceutically acceptable, non-toxic, sterile carrier such as physiological saline, non-toxic buffers, preservatives and the like.
- suitable formulations for use in the therapeutic methods disclosed herein are described in Remington's Pharmaceutical Sciences, 22nd ed., Ed. Lloyd V. Allen, Jr. (2012).
- a pharmaceutical composition of the invention may be comprised within one or more formulation selected from a capsule, a tablet, an aqueous suspension, a solution, a nasal aerosol, or a combination thereof.
- the pharmaceutical composition comprises more than one type of binding molecule of the invention.
- a pharmaceutical composition may comprise two or more selected from an antibody, an antigen-binding fragment, or a combination thereof.
- a pharmaceutically effective amount of a binding molecule means an amount sufficient to achieve effective binding to a target and to achieve a benefit, e.g., to ameliorate symptoms of a disease or condition or to detect a substance or a cell.
- a pharmaceutical composition may comprise a buffer (e.g., acetate, phosphate or citrate buffer), a surfactant (e.g., polysorbate), optionally a stabilizer agent (e.g., human albumin), etc.
- a buffer e.g., acetate, phosphate or citrate buffer
- a surfactant e.g., polysorbate
- a stabilizer agent e.g., human albumin
- the binding molecule of the invention binds to CCR9 molecule with sufficient affinity such that the binding molecule is useful as a therapeutic agent or a diagnostic reagent in targeting CCR9. 5.3 Therapeutic methods
- the invention also relates to using the binding molecules and compositions of the invention in therapeutic methods.
- the invention provides a binding molecule of the invention for use in such therapeutic methods, e.g. a binding molecule of the invention for use in a method of treating the human or animal body by therapy.
- a binding molecule of the invention for use in a method of treating the human or animal body by therapy.
- therapeutic methods and uses are described herein with reference to the binding molecule of the invention, also encompassed are the same methods and uses where the binding molecule is present in a composition, such as a pharmaceutical composition, such as a pharmaceutical composition as described herein.
- the invention embraces the above defined binding molecule and the above defined pharmaceutical composition for use in a method of treating a CCR9-mediated disease or condition.
- a binding molecule of the invention for use in treating a CCR9- mediated disease or condition.
- a composition of the invention e.g., a pharmaceutical composition of the invention, for use in treating a CCR9-mediated disease or condition.
- a binding molecule of the invention in the manufacture of a medicament for the treatment of a CCR9-mediated disease or condition.
- binding molecule for use in treating a CCR9-mediated disease or condition in a subject wherein said binding molecule is capable of (i) inhibiting binding of CCL25 to CCR9, and (ii) mediating antibody dependent cell-mediated cytotoxicity against a CCR9- expressing cell to which it binds.
- a method of treating a CCR9-mediated disease or condition in a subject comprising administering to the subject an effective amount of a binding molecule which binds to CCR9, wherein said binding molecule is capable of (i) inhibiting binding of CCL25 to CCR9, and (ii) mediating antibody dependent cell-mediated cytotoxicity against a CCR9-expressing cell to which it binds.
- the CCR9-mediated disease or condition that is treated is an inflammatory bowel disease.
- the binding molecule is capable of depleting CCR9-expressing cells in the subject, for example, in the gut of the subject. Without being bound by theory, this may be due to the ability of the binding molecule to prevent migration of a CCR9-expressing cell from the periphery into the gut of a subject and/or due to the ability of the binding molecule to induce death of a CCR9- expressing cell to which it binds.
- a method of depleting CCR9-expressing cells in a subject in need thereof comprising administering to the subject an effective amount of a binding molecule of the invention.
- the CCR9 polypeptide is comprised within a CCR9 polypeptide sequence, or a fragment thereof.
- a “CCR9 polypeptide” may comprise the full length polypeptide sequence of CCR9, or may comprise a fragment of CCR9 of any length of the full length polypeptide sequence of CCR9 (e.g. comprising a polypeptide sequence of 5%, 15%, 25%, 35%, 45%, 55%, 65%, 75%, 85% or 95% of the full length polypeptide sequence of CCR9) which comprises an epitope which can bind (e.g. be bound by) a binding molecule of the invention.
- the binding molecule may advantageously be used in methods for detecting a CCR9 epitope, and associated methods of diagnosis.
- the term “treat” or “treating” as used herein encompasses therapeutic measures that cure, slow down, alleviate symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder. Thus, those in need of treatment include those already with the disorder.
- the term “treat” or “treating” as used herein means corrective treatment.
- the term “treat” or “treating” encompasses treating inflammatory bowel disease, and treating symptoms thereof and diseases/disorder associated therewith.
- the term “treat” or “treating” refers to a symptom of IBD, such as inflammation in the gut, abdominal pain, diarrhea, blood in the stool.
- a subject is successfully “treated” for a CCR9-mediated disease or disorder (e.g., inflammatory bowel disease), according to the methods provided herein if the patient shows, e.g., total, partial, or transient alleviation or elimination of symptoms associated with the CCR9-mediated disease or disorder (e.g., inflammatory bowel disease).
- “Treat” or “treatment” also includes prophylactic treatment, e.g. to prevent the onset of disease, such as to prevent the onset of IBD.
- prevent refers to prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of prevention include those prone to have or susceptible to the disorder.
- a disease or disorder e.g., inflammatory bowel disease
- a disease or disorder is successfully prevented according to the methods provided herein if the patient develops, transiently or permanently, e.g., fewer or less severe symptoms associated with the disease or disorder, or a later onset of symptoms associated with the disease or disorder, than a patient who has not been subject to the methods of the invention.
- the terms “subject”, “individual” and “patient” are used interchangeably herein to refer to a mammalian subject.
- the “subject” is a human, domestic animals, farm animals, sports animals, and zoo animals, e.g., humans, non-human primates, dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, etc..
- the subject is a cynomolgus monkey ( Macaca fascicularis).
- the subject is a human.
- the subject may not have been previously diagnosed as having inflammatory bowel disease.
- the subject may have been previously diagnosed as having inflammatory bowel disease.
- the subject may also be one who exhibits disease risk factors, or one who is asymptomatic for inflammatory bowel disease.
- the subject may also be one who is suffering from or is at risk of developing inflammatory bowel disease.
- a method of the invention may be used to confirm the presence of inflammatory bowel disease in a subject.
- the subject may previously have been diagnosed with inflammatory bowel disease by alternative means.
- the subject has been previously administered an inflammatory bowel disease therapy.
- methods of treatment of the invention comprise one or more administration step selected from oral, intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal, or vaginal, inhalation, topical, or a combination thereof.
- the binding molecule is delivered directly to the site of the adverse cellular population (e.g. thereby increasing the exposure of the diseased tissue to the therapeutic agent).
- the administration is directly to the airway, e.g., by inhalation or intranasal administration.
- the inflammatory bowel disease is Crohn’s disease, such as ileal or ileocolonic Crohn’s disease. In some embodiments, the inflammatory bowel disease is ulcerative colitis.
- a binding molecule of the invention may be used in such methods.
- a method of detecting the presence or absence of a CCR9 polypeptide comprises: a) contacting a sample with a binding molecule of the invention to provide a binding molecule- antigen complex; b) detecting the presence or absence of said binding molecule-antigen complex; c) wherein the presence of the binding molecule-antigen complex confirms the presence of a CCR9 polypeptide.
- any of steps (i)-(iii) above are performed ex vivo or in vitro. In some embodiments, all of steps (i)-(iii) above are performed ex vivo or in vitro. In some embodiments, any of steps (i)-(iii) above are performed in vivo.
- the binding molecule may be any binding molecule described herein, e.g. a binding molecule comprising a set of six CDRs as illustrated for any antibody in Figure 3 or Figure 4 or Table 4, or a binding molecule comprising a VH and VL as illustrated for any antibody in Figure 3 or Figure 4 or binding molecules of Table 3.
- the detection methods described herein are carried out in vitro. In some embodiments, the detection methods described herein are carried out ex vivo. In some embodiments, the detection methods described herein are carried out on a sample from a subject, such as a sample that has previously been obtained from the subject.
- the detection methods may, or may not, include a step of obtaining the sample from the subject.
- a “sample” is a sample obtained from a subject (e.g. biopsy), cell line, tissue culture, or other source of cells potentially expressing CCR9.
- a sample is a biopsy from a subject. Said biopsy may be from the gut of a subject suffering from an inflammatory bowel disease, or from the gut of a subject at risk of suffering from an inflammatory bowel disease.
- the sample may be an isolated sample from a subject.
- the invention embraces a corresponding use of the binding molecule of the invention for detecting a CCR9 polypeptide (e.g. CCR9 polypeptide epitope).
- a CCR9 polypeptide e.g. CCR9 polypeptide epitope
- the presence of binding molecule-antigen complex is indicative of the presence of an inflammatory bowel disease
- the absence of the binding molecule-antigen complex is indicative of the absence of an inflammatory bowel disease
- the inflammatory disease is an inflammatory bowel disease comprising a cell expressing a CCR9 polypeptide (e.g. CCR9 polypeptide epitope).
- CCR9 polypeptide e.g. CCR9 polypeptide epitope
- the present invention embraces use of the binding molecule of the invention in methods of diagnosing a subject with an inflammatory bowel disease, preferably wherein said inflammatory bowel disease comprises a CCR9-expressing cell.
- a method of detection or method ofdiagnosis may comprise measuring the expression level of CCR9 in a sample from a subject, and comparing the measured CCR9 expression level with a reference CCR9 level, wherein an increase in the measured CCR9 expression level compared to the reference CCR9 level is indicative of the presence of inflammatory bowel disease.
- said reference CCR9 level is the expression level of CCR9 in a non-IBD (e.g. normal) sample of the same type, such as of the same tissue type.
- a “binding molecule-antigen complex” means a complex (e.g. macromolecular complex) comprising an antigen which is bound to its respective binding molecule, e.g. CCR9 which is bound to a binding molecule of the invention.
- binding molecule-antigen complex may be used synonymously with the terms “bound CCR9-binding molecule complex” and “binding molecule bound to CCR9”.
- a binding molecule-antigen complex may be detected by any means known to the skilled person.
- the binding molecule is labelled with a detectable label.
- Said label may be an epi-fluorescent label.
- a binding molecule-antigen complex is detected by means of a secondary (e.g. detection) antibody which binds the binding molecule and/or binding molecule-antigen complex.
- said secondary antibody comprises a detection means, such as a tag/label to aid detection.
- Said detection means is preferably conjugated to the secondary antibody.
- suitable labels include detectable labels such as radiolabels or fluorescent or coloured molecules, enzymatic markers or chromogenic markers - e.g. dyes that provide a visible colour change upon binding of the detection antibody to an antigen.
- the label may be fluorescein- isothiocyanate (FITC), R-phycoerythrin, Alexa 532, CY3 or digoxigenin.
- the label may be a reporter molecule, which is detected directly, such as by detecting its fluorescent signal, or by exposure of the label to photographic or X-ray film.
- the label is not directly detectable, but may be detected, for example, in a two-phase system.
- An example of indirect label detection is binding of an antibody to the label.
- said secondary antibody comprises a fluorescent tag
- a binding molecule-antigen complex is detected by the florescence emitted from a, binding molecule-antigen- secondary antibody complex.
- a “binding molecule-antigen-secondary antibody complex” means a complex comprising an antigen (e.g. CCR9) which has become bound to a binding molecule, wherein said complex has further become bound by a secondary antibody which binds said binding molecule and/or binding molecule-antigen complex.
- a binding molecule-antigen complex is detected when the signal (e.g., fluorescence) emitted from the detection label is greater than the signal detected in a control comprising no binding molecule (e.g. no binding molecule which binds a CCR9).
- Said control may alternatively comprise a CCR9, but the sample is not applied to said control.
- a second binding molecule that binds to CCR9 wherein said second binding molecule does not compete for binding to CCR9 with a first binding molecule.
- the first binding molecule may be any binding molecule as disclosed herein that binds to CCR9.
- a suitable first binding molecule may be a binding molecule as illustrated in Figure 4.
- a suitable first binding molecule may be a binding molecule comprising the VH and VL of any binding molecule illustrated in Table 3, or comprising a set of six CDRs (HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2, and LCDR3) of any binding molecule illustrated in Table 4.
- a suitable first binding molecule may be a binding molecule that: a) comprises a heavy chain variable (VH) region having a set of CDRs HCDR1 , HCDR2 and HCDR3 and a light chain variable (VL) region having a set of CDRs LCDR1 , LCDR2 and LCDR3, of an antibody as shown in Figure 4; b) comprises a heavy chain variable (VH) region and a light chain variable (VL) region of an antibody shown in Figure 4; c) comprises a heavy chain variable (VH) region sequence of SEQ ID NO: 51 and a light chain variable (VL) region sequence of SEQ ID NO: 55, wherein (i) Xi and X of SEQ ID NO: 55 are each any amino acid (SEQ ID NO: 76); or (ii) Xi of SEQ ID NO: 55 is P or S and X 2 of SEQ ID NO: 55 is R, T or G (SEQ ID NO: 77); or d) comprises a heavy chain variable
- the invention embraces the use of the second binding molecule (which does not compete for binding with the first binding molecule) to determine the abundance of CCR9- expressing cells in a sample which has been contacted with the first binding molecule.
- a method of assessing the depletion of CCR9-expressing cells by a first binding molecule comprising: a) contacting said first binding molecule with a population of cells, wherein the population of cells comprises CCR9-expressing cells and immune effector cells, under conditions suitable to allow for antibody dependent cell-mediated cytotoxicity by the effector cells; b) contacting said population of cells with a second binding molecule that binds to CCR9, and that does not compete for binding to CCR9 with the first binding molecule of step (i); c) detecting CCR9-expressing cells in the population of cells that are bound by the second binding molecule of (ii); d) comparing the amount of CCR9-expressing cells detected in step (iii) with the amount of CCR9- expressing cells in the original cell population used in step (i), and thereby determining the amount of CCR9-expressing cells that were depleted in step (i).
- the second binding molecule comprises the VH and VL sequences illustrated in Table 6, or the set of six CDRs illustrated in Table 6.
- the first binding molecule may comprise the VH and VL of any binding molecule illustrated Table 3, or comprising a set of six CDRs of any binding molecule illustrated in Table 4, and the second binding molecule may comprise the VH and VL sequences illustrated in Table 6, or the set of six CDRs illustrated in Table 6.
- the second binding molecule is a binding molecule as described herein that binds CCR9 and that comprises: a) a HCDR1 of SEQ ID NO: 44, or a functional variant thereof; b) a HCDR2 of SEQ ID NO: 45, or a functional variant thereof; c) a HCDR3 of SEQ ID NO: 46, or a functional variant thereof; d) a LCDR1 of SEQ ID NO: 47, or a functional variant thereof; a LCDR2 of SEQ ID NO: 5, or a functional variant thereof; and e) a LCDR3 of SEQ ID NO: 48, or a functional variant thereof, wherein a functional variant is as defined herein
- the second binding molecule is a binding molecule that binds to CCR9 and that comprises a heavy chain variable (VH) region having a set of CDRs HCDR1 , HCDR2 and HCDR3 and a light chain variable (VL) region having a set of CDRs LCDR1 , LCDR2 and LCDR3, wherein the VH region amino acid sequence comprises HCDR1 of SEQ ID NO: 44, HCDR2 of SEQ ID NO: 45 and HCDR3 of SEQ ID NO: 46, and wherein the VL region amino acid sequence comprises LCDR1 of SEQ ID NO: 47, LCDR2 of SEQ ID NO: 5 and LCDR3 of SEQ ID NO: 48.
- VH heavy chain variable
- VL light chain variable
- the second binding molecule is a binding molecule that binds to CCR9 and that comprises: a) a VH region comprising the amino acid sequence of SEQ ID NO: 72, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto; and b) a VL region comprising the amino acid sequence of SEQ ID NO: 73, or a sequence having at least 80%, 85%, 90%, 95%, 98% or 99% sequence identity thereto.
- polynucleotide comprising a nucleic acid sequence encoding a binding molecule of the invention.
- the polynucleotide is an isolated polynucleotide.
- the polynucleotide encodes one, some, or all of the polypeptide chains of the binding molecule.
- the polynucleotide may encode the heavy chain polypeptide and the light chain polypeptide of a binding molecule.
- the polynucleotide encodes a VH region of a binding molecule.
- a polynucleotide of the invention encodes a VL region of a binding molecule.
- the polynucleotide encodes a VH region and a VL region of a binding molecule.
- the polynucleotide further encodes a leader sequence (e.g. which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
- a leader sequence e.g. which functions as a secretory sequence for controlling transport of a polypeptide from the cell.
- Polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both.
- a polynucleotide variant comprises an alteration that produces silent substitutions, additions, or deletions, but does not alter the properties or activities of the encoded polypeptide.
- a polynucleotide variant is produced by a silent substitution due to the degeneracy of the genetic code.
- a polynucleotide variant can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
- a vector comprising the polynucleotide of the invention operably associated with a promoter; or comprising a polynucleotide encoding the VH region of a binding molecule of the invention and a polynucleotide encoding the VL region of a binding molecule of the invention wherein said polynucleotides are operably associated with one or more promoter(s).
- promoter means any nucleic acid sequence that regulates the expression of a polynucleotide sequence by driving transcription of the polynucleotide sequence.
- the term “operably associated” and “operatively linked” means that the promoter is in a correct functional location and/or orientation in relation to a polynucleotide sequence it regulates to control transcriptional initiation and/or expression of that sequence.
- the nucleic acid sequences encoding the VH region and VL region are operably associated with the same promoter.
- the nucleic acid sequences encoding the VH region and VL region are each operably associated with a separate promoter.
- the separate promoters are promoters of the same type.
- the separate promoters are promoters of different types.
- vectors include viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
- the polynucleotide of the invention can be operatively linked to a promoter appropriate for expression of the polypeptide in a desired host.
- a vector may comprise additional nucleic acid sequence(s) which control expression of the polynucleotide.
- a vector may comprise one or more of an enhancer and a repressor sequence.
- enhancer means a nucleic acid sequence that binds one or more proteins to increase transcriptional activation of a polynucleotide.
- repressor means a nucleic acid sequence that binds one or more proteins to decrease transcriptional activation of a polynucleotide.
- Another aspect provided herein is a host cell comprising a polynucleotide of the invention or a polynucleotide as disclosed herein, or a host cell comprising a vector of the invention or a vector as disclosed herein wherein the host cell is capable of producing a polypeptide encoded by the polynucleotide or vector.
- Another aspect provided herein is a method of producing a binding molecule of the invention comprising expressing a polynucleotide or vector of the invention in a host cell.
- the method comprises culturing a host cell under conditions suitable for producing a binding molecule of the invention encoded by a polynucleotide or vector present in the host cell.
- Suitable host cells for expression of a binding molecule of the invention include a prokaryote, yeast, insect, or higher eukaryotic cells (preferably wherein the polynucleotide is under the control of appropriate promoters).
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include established cell lines of mammalian origin as described herein. Cell-free translation systems can also be employed.
- the host cell is a cell that does not fucosylate the Fc region of the binding molecule.
- the host cell is a cell that expresses an enzyme which diverts the fucose pathway to produce GDP-D-rhamnose.
- Antibody effector function may be modified through the generation of antibodies with altered glycosylation patterns.
- an antibody can be made that has an altered type of glycosylation, such as an afucosylated/hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures.
- Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies.
- carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation.
- EP 1 ,176,195 describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation.
- PCT Publication WO 03/035835 describes a variant CHO cell line, Led 3 cells, with reduced ability to attach fucose to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (see also [5])
- PCT Publication WO 99/54342 describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., beta(1 ,4)- N-acetylglucosaminyltransferase 111 (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (see also [6])
- WO 2011/035884 A1 describes processes for producing molecules lacking fucos
- WO 2011/035884 A1 particularly describes cells for producing molecules, wherein the cells comprise at least one enzyme that uses GDP-6-deoxy-D-lyxo-4-hexulose as a substrate, wherein the enzyme converts the substrate to GDP-D-rhamnose, GDP-D-perosamine, GDP-deoxy-D- talose, GDP-6-deoxy-Daltrose, or GDP-4-keto-3,6-dideoxy-D-mannose.
- kits comprising a binding molecule of the invention. There is further embraced use of said kit in the methods of the present invention.
- kits further comprises an isolated (e.g. purified) antigen or a cell expressing an antigen.
- the kit may further comprise an isolated (e.g. purified) CCR9, or a cell expressing CCR9.
- the kit comprises one or more containers.
- the kit comprises all of the components necessary and/or sufficient to perform a detection assay as described herein, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results.
- a binding molecule of the invention can be used in assays for immunospecific binding by any method known in the art.
- the immunoassays that can be used include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blot, RIA, ELISA, ELISPOT, “sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays.
- a binding molecule of the invention can be employed histologically, as in immunofluorescence, immunoelectron microscopy, or non-immunological assays, for example, for in situ detection of CCR9 or conserved variants or peptide fragments thereof.
- In situ detection can be accomplished by removing a histological specimen from a patient, and applying thereto a labelled binding molecule ofthe invention, e.g., applied by overlaying the labelled binding molecule onto a biological sample. Through the use of such a procedure, it is possible to determine not only the presence of CCR9, or conserved variants or peptide fragments, but also its distribution in the examined tissue.
- histological methods such as staining procedures
- Table 3 Amino acid sequence of the VH and VL regions of exemplary binding molecules of the invention.
- Cells were isolated from various tissues in human and from cynomolgus monkey. The proportion of cells from a given tissue and/or of a given cell type that expressed CCR9 was determined using flow cytometry.
- CCR9 expression was assessed in human tissue. The greatest proportion of CCR9-expressing cells was found in CD4+ T cells of the thymus (76% of cells expressing CCR9), with high levels also being seen in CD4+ T cells (47% of cells expressing CCR9) and CD8+ T cells (37% of cells expressing CCR9) ofthe ileum of IBD patients. Some CCR9 expression was also seen in cells of the colon of IBD patients that were CD4+ T cells (9% of cells expressing CCR9) or CD8+ T cells (12% of cells expressing CCR9), with only low numbers of CCR9-expressing cells in the CD4+ and CD8+ T cells in the blood ( ⁇ 5%) of IBD patients.
- CCR9 expression was seen in 28% of B cells in the blood, with a lower level (11% and 16% respectively) in B cells in the colon and ileum. Only very low numbers of monocytes, dendritic cells (DCs) and plasmacytoid dendritic cells (pDCs) expressed CCR9 ( ⁇ 5%).
- DCs dendritic cells
- pDCs plasmacytoid dendritic cells
- Figure 1 B shows the percentage of B cells expressing CCR9 in the ileum (left chart) and colon (right chart) of healthy and IBD patients.
- B cell type nonaive B cell, memory B cell, plasma cell
- the results from healthy subjects are provided on the left and the results for IBD patients are provided on the right. It was found that there was a decrease in the number of B cells expressing CCR9 in IBD, with the greatest decrease observed in memory B cells. It is hypothesised that this may be due to high CCR9 ligand expression driving receptor internalisation in IBD.
- Figure 1C shows the percentage of T effector cells and T regs from the colon or ileum of healthy subjects or from IBD patients that express CCR9. For each tissue type indicated, the % of T effector cells expressing CCR9 is show on the left, and the % of Tregs expressing CCR9 is shown on the right. It was found that there was no apparent difference in the T effectorTreg ratio in either tissue type between healthy and IBD patients.
- Anti-CCR9 antibodies were generated using hybridoma technology following immunization of CD1 mice with alternating human CCR9 and mouse CCR9 over expressing HEK cell lines. Three groups of mice were used. For Group 1 , mice were immunised with alternating CHO and HEK cells over-expressing hCCR9; Group 2 mice were immunised with alternating HEK cells over-expressing hCCR9 and HEK cells over-expressing mCCR9; Group 3 mice were immunised with HEK cells overexpressing mCCR9.
- the recombinant cell lines were administered at 1e7 cells/100 pL diluted in PBS, emulsified with equal volumes of complete Freund’s adjuvant, and injected into the mice at two sites, 100 pL per site. For the subsequent three injections, the cells were emulsified in Freund’s incomplete adjuvant and injections performed as above. The final boost was carried out on day 24, by injecting 200 pL of cells in PBS intraperitoneally.
- Tail vein bleeds were obtained from mice before immunisation, on day 13 after the first immunization, and on day 20 after second immunisation.
- the IgG titres to human CCR9, mouse CCR9 and the parental HEK and CHO cells were determined by serum ELISA. The animals with the highest antigen specific titres were taken forward for hybridoma generation.
- the individual mouse serum IgG titres to hCCR9 and mCCR9 were determined by ELISA.
- the hCCR9 and mCCR9 HEK and CHO cell lines described above, along with parental HEK and CHO cells were coated on to 96 well Poly-D-Lysine microtitre plates at a 40,000 cells/well and cultured overnight at 37°C in a CO incubator. After overnight incubation, the supernatant was removed and the cells fixed for 5 min in 3.7% solution of formaldehyde/PBS at RT. All subsequent incubations were carried out at room temperature. After removal of the formaldehyde solution, the wells were then blocked by addition of 3%witz/PBS blocking buffer.
- Enhancement solution Perkin Elmer
- lymph nodes were aseptically harvested, and cells were isolated by mechanical disruption and counted. These cells were mixed with SP2/0 myeloma cells and fused using an electrofusion apparatus. The resultant fusions were mixed with a methylcellulose-based semi- solid media and plated out into OmniTray plates.
- the semi-solid media comprised CloneMatrix and DMEM supplemented with 20% FCS, 10% BM Condimed H1 , 1 mM sodium pyruvate and OPI media supplement, 2% hypoxanthine azaserine and FITC conjugated goat anti-mouse IgG.
- the cells in semisolid media were cultured for 13 days at 37°C in a 5% CO2 incubator.
- mRNA Messenger RNA
- dT magnetic oligo
- Mouse hybridoma IgG clones were molecularly reformatted to generate constructs expressing mouse VH and VL domains and the relevant mouse IgG constant domains for each hybridoma essentially as described by Persic et al 1997 [7] with the following modifications.
- An OriP fragment was included in the expression vectors to facilitate use with CHO-transient cells and to allow episomal replication.
- the VH domain was cloned into the relevant vector containing the mouse heavy chain constant domains and regulatory elements to express whole lgG1 heavy chain in mammalian cells.
- the VL domain was cloned into a vector for the expression of the appropriate mouse light chain (lambda or kappa) constant domains and regulatory elements to express whole IgG light chain in mammalian cells.
- mammalian suspension CHO cells were transiently transfected with the heavy and light chain IgG vectors. IgGs were expressed and secreted into the medium. Harvests were filtered prior to purification, then IgG was purified using Protein A chromatography. Culture supernatants were loaded on a column of appropriate size of Ceramic Protein A (Pall 20078-036) and washed with 50 mM Tris-HCI pH 8.0, 250 mM NaCI.
- Bound IgG was eluted from the column using 0.1 M Sodium Citrate (pH 3.0) and neutralised by the addition of Tris-HCI (pH 9.0). The eluted material was buffer exchanged into PBS using Nap10 columns (GE Lifesciences 17-0854-02) and the concentration of IgG was determined spectrophotometrically using an extinction coefficient based on the amino acid sequence of the IgG [8] The purified IgG were analysed for purity using SDS-PAGE. Purified IgGs were screened for binding to human CCR9 on HEK cells.
- Figure 3 shows the amino acid sequences of the variable heavy chain ( Figure 3A) and variable light chain (Figure 3B) sequences for nine unique hits identified in this screen.
- cDNA for AB1020243 for example, was prepared from clone ZY10OI-A02 and the sequence for the VH and VL domains determined.
- FW framework region.
- the locations of the CDRs are underlined as indicated by Kabat assignment (Kabat etal., Sequences of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- the VH and VL sequences of humanized AB1020243 (AB1020243-fgl) are illustrated in Figure 4, where they are aligned with the original chimeric sequences.
- CDRs were mutated by site-directed mutagenesis of mammalian expression vectors with low-redundancy biased nucleotide (NNC) codon mixtures, designed to maximize the abundance of alternative amino acids (aa) whilst eliminating undesirable amino acids (Met, Trp) from the library.
- NNC low-redundancy biased nucleotide
- 566 CDR variants were produced and CDR-optimised versions of humanised AB1020243 were generated.
- the screening library was expressed in CHO-cells from 24- well deep plates before protein A purification of variants.
- Binding of the antibodies to CCR9-expressing cells was assessed using HEK cells overexpressing human CCR9A, or using Molt4 cells.
- the Molt4 cell line is derived from human T cells and is known to express CCR9
- Test antibodies were diluted to a concentration of 10 pg/mL in PBS supplemented with 1% Fetal Bovine Serum. Antibodies were titrated as single point using three-fold titrations over 8 points on a 96 well plate and cells were stained at 4°C for 20 min. Cells were washed and stained with a secondary goat anti mouse or human IgG PE at 2.5 pg/ml in sterile PBS + 1% FBS serum at 4C for 20 minutes
- Figure 5A shows that at least AB1020243, AB1020229, and AB1020011 bound to the Molt4 cells. Binding to Molt4 cells was compared with binding to Jurkat cells, which do not express human CCR9. As illustrated in Figure 5B, binding to Molt4 cells was similarto that seen in Figure 5A, whereas no significant binding to Jurkat cells was detected.
- test antibody was diluted to a concentration of 60 ug/mL in assay buffer containing Hanks Balanced Salt solution (Sigma HB264) plus 0.1% Bovine Serum Albumin (Sigma A9576).
- Antibody was titrated in duplicate using single fold titrations over 24 points on a 384 black clear bottomed, non-binding microplate (Corning ® NBS TM 3655) so that the final volume of test antibody was 10 uL per well.
- the secondary detection antibody Alexa Fluor 647 labelled human IgG (H+L) (Jackson Immuno- Research; 209-665-082) was prepared according to the manufacturer’s instructions and diluted 1 :1000 in assay buffer as described above.
- the secondary detection antibody was dispensed to the assay plate containing test antibodies using a Multidrop dispenser (Thermo Scientific) in a volume of 10 uL per well.
- Transfected HEK CCR9 overexpressing cell lines or un-transfected parental control cells were suspended in assay buffer at a concentration of 1x10 6 cells per ml, and 10 uL of cells were dispensed to the assay plate containing test antibody and secondary antibody using a Multidrop dispenser (Thermo Scientific). Assay plates were incubated overnight at 4°C and were read on a mirrorball® (laser scanning fluorescence cytometer; TTP-Labtech) using excitation at 488 nm and emission using the FL4 channel (667-685 nm).
- NK cell activation assay As follows: All potency assays were run at an Effector (NK-92 Ml CD16a NFAT cells) to Target (Molt4; HEK CCR9 over expressing cells or Jurkat cells) ratio of 5:1.
- the Effector NK-92 cell line does not naturally express the FcyRIIIa receptor (CD16).
- a modified form of NK-92 was used that overexpresses the high affinity (ha) CD16 V158 FcyRIIIa receptor, which has increased binding to Fc domains (Boissel et al Proceedings of the 107th Annual Meeting of the American Association for Cancer Research; 2016 Apr 16-20; New La, LA.
- NK-92 cells also express a NFAT luciferase reporter, which can be used as a surrogate for effector function. Binding of the target-bound antibody to the NK cell induces activation of the NFAT transcription factor, which drives a luciferase reporter gene. The luminescence signal is proportional to the ADCC activity.
- Both target and effector cells were prepared in assay media containing Advanced RPMI (GibcoTM; 12633) with 10% Ultra Low IgG FBS (GibcoTM; 16250-078).
- Target cells were resuspended at a concentration of 8x10 5 cells per mL and effector cells were re-suspended at a concentration of 8x10 ® cells per mL.
- Test antibodies were diluted to a concentration of 60 pg/mL and duplicate 4-fold titrations were performed over 12 points on a 384 well polypropylene microplate (Greiner Bio-one International; 781280).
- Target cells were dispensed into 384 well white clear bottom tissue culture treated plates (Corning ® 3560) using a Multidrop dispenser (Thermo Scientific) in a volume of 12.5 pL per well.
- Test antibodies (6.25 pL per well) were then added to target cell containing plates using a Bravo Automated Liquid Handling Platform (Agilent).
- Target cells and antibodies were pre-incubated for 30 minutes at 37°C in a O /CO incubator. Effector cells were then added using a Multidrop dispenser (Thermo Scientific) in a volume of 6.25 pL per well. Assay plates containing target cells, effector cells and antibodies were incubated for a further 5 hours at 37°C in a O /CO incubator.
- the Luciferase detection reagent was prepared according to the manufacturer’s instructions (Steadv-Glo® Luciferase Assay System; Promega E2520), and 25 pL was dispensed to each well using manual pipetting. Assay plates were covered in foil and allowed to undergo lysis for 20 minutes at room temperature on plate shaker. Assay plates were read on an EnVision ® 2105 multimode plate reader (Perkin Elmer) using the ultra- sensitive luminescence mode. Data was analysed in GraphPad Prism version 8.0.0 for Windows (GraphPad Software, San Diego, California USA) using a four-parameter log (agonist) vs response logistic equation. Data was expressed as Log (Molar) antibody concentration v’s response (Counts per second).
- Figure 7 shows the NK cell activation by (afucosylated) antibodies when bound to the MOLT4/HEK cells.
- the afucosylated forms of the antibodies were produced from a dual expression cassette, whereby the heavy chain IgG expression is co-expressed with the RMD enzyme to produce afucosylated protein in CHO cells.
- Potency of the AB1020243 afuc antibody when bound to the HEK cells expressing human CCR9A was measured as 0.5 nM.
- Potency of the humanised AB1020243 afuc antibody when bound to the Molt4 cells was measured as 0.8 nM.
- the antibodies were serial titrated (10-fold) with a start concentration of 10 pg/mL over 8 points.
- Antibodies were added to 1x10 6 human peripheral blood mononuclear cells (PBMCs) in u-bottom 96 well plate and incubated over-night. The following day, the percentage of remaining CCR9-expressing CD4 T cells was measured by flow cytometry using a non-competing CCR9 antibody.
- the VH/VL and CDR sequences of the non-competing antibody are shown in Table 5 and Table 6.
- antibodies AB1020243, AB1020229 and AB1020011 all showed killing of CCR9+ PBMC.
- Table 5 Amino acid sequences of the VH and VL regions of the non-competing CCR9 antibody.
- Table 6 Amino acid sequences of the CDRs of the non-competing CCR9 antibody.
- Humanised AB1020243 was produced as in Example 3. In all experiments described hereforth the humanised AB1020243 was in an afucosylated form produced from a dual expression cassette, whereby the heavy chain IgG expression is co-expressed with GDP-6-deoxy-D-lyxo-4-hexulose reductase (RMD) to produce afucosylated protein in CHO cells.
- RMD GDP-6-deoxy-D-lyxo-4-hexulose reductase
- the humanised antibody (“human”) retained similar binding to the parent AB1020243 (“chimeric”) against cynomolgus CCR9 and HEK cells expressing human CCR9B ( Figure 9A and Figure 9B). No significant binding was seen against the parent HEK Jl cell line, which does not express CCR9 ( Figure 9G). Even at higher concentrations, humanised AB1020243 showed no significant off target binding to CXCR1 (Figure 9C), CXCR2 ( Figure 9D), CCR5 ( Figure 9E) or CCR8 ( Figure 9F).
- IgG binding and dissociation fluorescence profiles were measured on the instrument and then analysed with a Bivalent (1 :2) type fit model within TraceDrawer software (Ridgeview Instruments).
- the off-rate (k d ) of AB1020243 afuc was measured as 3.85 x 10 5 s 1 , and this remained similar after humanisation, being measured as 4.3 x 10 5 s 1 . This is consistent with there being no potency reduction observed upon humanisation ( Figure 10B).
- IP-One Gq assay Humanised AB1020243 was tested for its ability to compete with CCL25 in an HTRF IP-One Gq assay (Cis-Bio; 62IPAPEB).
- the IP-One assay is a competitive immunoassay that uses terbium cryptate-labelled anti-IP1 Mab and d2-labeled IP1.
- IP1 is a downstream metabolite of the IP cascade and accumulates in cells following Gq receptor activation and is stable in the presence of LiCI. LiCI is added to the cell stimulation buffer, causing the accumulation of IP1 upon receptor activation.
- Test antibodies were buffer exchanged into IP-one buffer (Krebs Ringer solution + LiCI) and were serially diluted from neat in IP-one buffer using a one plus one dilution series over 16 points (in triplicate) on a 384 well polypropylene microplate (Greiner Bio-one International; 781280) and 3.5mL of each antibody was added to white 384 shallow plates (Costar; 4513) using a Bravo Automated Liquid Handling Platform (Agilent).
- IP-one buffer Karl Ringer solution + LiCI
- MOLT 4 cells were harvested and re-suspended in IP-One assay buffer to 5.4x10 6 cells/mL and 7.5pL of cells were dispensed to the antibody containing plates using a Multidrop dispenser (Thermo Scientific) so that the final cell concentration was 40,000 cells/well.
- Antibodies were pre-incubated with cells for 30 minutes.
- Recombinant Human CCL25/TECK Protein R&D systems; 9046-TK
- FIG. 11 shows that humanised AB1020243 and the CDR optimised antibodies 234LO0331 and 243LO0326 retain similar abilities to compete with CCL25 as the parent chimeric AB1020243 antibody.
- the antibodies of the present invention therefore contrast with previous described mouse CCR9 antibodies 92R and 91 R that do not, for example, inhibit CCL25 induced migration of CCR9+ MOLT-4 cells and only partial compete with CCL25 for binding to MOLT-4 cells [4]
- CDR optimised forms of humanised AB1020243 were produced.
- the CDR optimised antibodies were in an afucosylated form.
- the CDR optimized antibodies were formatted to reduce the risk of Asn deamidation in LCDR1.
- CDR-optimised AB1020243 was tested for its ability to bind to different forms of CCR9 and to different cell types, based on the methods described in Example 4. As illustrated in Figure 12, 243LO0326 and the parent antibody AB1020243 showed similar binding to both human isotypes CCR9A and CCR9B, and to cynomolgus CCR9A. Both 243LO0326 and 243LO0331 showed no significant binding to either mouse or rat CCR9, even at high concentrations (data not shown). 243LO0326 and the parent antibody AB1020243 also failed to show any off-target receptor binding to CCR5, CCR8, CXCR1 or CXCR2.
- 243LO0326 remained bound to the membrane over an extended period of time, with the majority of the antibody remaining on the cell surface after 5 hours at 37°C.
- the amount of the parental antibody AB1020243 bound to the cell surface dropped off significantly in the first hour.
- Affinity (KD) was measured using Ligand T racer as 0.09 nM for 243LO0326 and 3.4 nM for AB1020243. Briefly, on-cell affinities were measured on a LigandTracer instrument (Ridgeview Instruments) using a 633 nm fluorescence detector, at room temperature ( ⁇ 22°C).
- IgGs in human lgG1 format were specifically labelled with DyLight 650 Maleimide fluorophore on an engineered cycteine residue on the CH2 region of the IgG.
- the labelled IgG were added to circular Nunclon D plate, with pre-adhered discrete spots of CHO K1 parent (control) and CCR9-expressing CHO K1 cells.
- IgG binding and dissociation fluorescence profiles were measured on the instrument and then analysed with a Bivalent (1 :2) type fit model within TraceDrawer software (Ridgeview Instruments).
- CDR-optimised AB1020243 was tested for its ability to induce NK cell activation and PBMC killing as described in Example 4.
- Figure 14A shows the effects of antibodies in the NK cell activation assay. It was found that 243LO0326 was more potent than the parent antibody AB1020243.
- Figure 14B shows the killing of PBMC by 243LO0326 and by the parental antibody AB1020243. 243LO0326 showed an improved potency, with an EC50 of 4 pM, compared to an EC50 of 200 pM for AB1020243.
- Figure 14C shows that 243LO0346 has a similar ability to induce killing of both human and cynomolgus CD4+CCR9+ PBMC, with an EC50 measured at 4-5 pM using human PBMC and an EC50 of 30 pM using cynomolgus PBMC.
- Afucosylation of the anti-CCR9 antibodies enhances cell killing, as shown in the ADCC NK cell activation assay ( Figure 15A).
- the impact of the level of fucosylation on potency of the antibody (243LO0326) was assessed in an fucosylation spiking study using the in vitro ADCC bioassay (see section 5.11 .2).
- ADCC potency ofthe antibody was retained compared to 100% afucosylated molecules for up to about 10% fucosylation. Acceptable potency was retained for fucosylation of up to 50% (Figure 15B).
- CCL25 induced internalisation was assessed by FACS.
- blocking CCL25-induced internalisation prevents receptor recycling.
- the antibodies of the invention thus advantageously induce ADCC, block CCL25 ligation of the CRR9 receptor, and prevent CCL25 induced CCR9 receptor recycling on CCR9 expressing T cells.
- 243LO0326 treatment of gut explant tissue from IBD patients depletes CCR9+ CD4+ cells ( Figure 16A) and reduces inflammatory mediators ( Figure 16B to Figure 16D).
- 243LO0326 is thus highly potent, and specific to CCR9. Cell depletion occurs via ADCC; however, in the absence of ADCC effector cells, such as NK cells, 243LO0326 also blocks binding between CCR9 and its ligand CCL25.
- the epitope is expected to be located within the extracellular N-terminus of CCR9B, i.e. amino acid positions 1-36 of CCR9B: MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFAS (SEQ ID NO: 80), corresponding to amino acid positions 13-48 of CCR9A (Table 9, Table 10, Figure 20).
- the CCR9 targeting antibodies disclosed herein are able to both block binding of CCL25 to CCR9 and to deplete CCR9+ T cells.
- the antibodies disclosed herein are expected to both deplete CCR9+ pathogenic T cells in blood and gut tissue and to block binding of CCL25 to CCR9 where pathogenic T cells are not fully depleted. This dual mechanism of action is expected to provide a sustained treatment effect. Specific depletion of CCR9 + gut tropic effector memory T cells will induce and sustain durable remission and deliver disease modification.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- General Physics & Mathematics (AREA)
- Biotechnology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Transplantation (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (19)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL318237A IL318237A (en) | 2021-03-18 | 2022-03-17 | A therapeutic binding molecule that binds to CCR9 |
| JP2023556501A JP7574467B2 (ja) | 2021-03-18 | 2022-03-17 | 治療用結合分子 |
| KR1020257014756A KR20250069981A (ko) | 2021-03-18 | 2022-03-17 | Ccr9에 결합하는 치료용 결합 분자 |
| MX2023010917A MX2023010917A (es) | 2021-03-18 | 2022-03-17 | Molecula de union terapeutica que se une a ccr9. |
| BR112023018331-6A BR112023018331B1 (pt) | 2021-03-18 | 2022-03-17 | Molécula de ligação que se liga a ccr9 |
| NZ804536A NZ804536A (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecule that binds to ccr9 |
| EP22716861.4A EP4308607A2 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecule that binds to ccr9 |
| CR20230488A CR20230488A (es) | 2021-03-18 | 2022-03-17 | Moléculas de unión terapéuticas |
| US18/550,757 US20240174758A1 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecules |
| AU2022236492A AU2022236492B2 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecule that binds to ccr9 |
| KR1020237034201A KR102805310B1 (ko) | 2021-03-18 | 2022-03-17 | Ccr9에 결합하는 치료용 결합 분자 |
| CA3212630A CA3212630A1 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecules |
| CN202280021611.7A CN116997571A (zh) | 2021-03-18 | 2022-03-17 | 结合ccr9的治疗性结合分子 |
| EP24154419.6A EP4406592A3 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecules |
| IL305690A IL305690B2 (en) | 2021-03-18 | 2022-03-17 | A therapeutic binding molecule that binds to CCR9 |
| ZA2023/09418A ZA202309418B (en) | 2021-03-18 | 2023-10-09 | Therapeutic binding molecule that binds to ccr9 |
| CONC2023/0013566A CO2023013566A2 (es) | 2021-03-18 | 2023-10-13 | Moléculas de unión terapéuticas |
| JP2024180571A JP2025011259A (ja) | 2021-03-18 | 2024-10-16 | 治療用結合分子 |
| AU2025205131A AU2025205131A1 (en) | 2021-03-18 | 2025-07-03 | Therapeutic binding molecules |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163162603P | 2021-03-18 | 2021-03-18 | |
| US63/162,603 | 2021-03-18 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022195028A2 true WO2022195028A2 (en) | 2022-09-22 |
| WO2022195028A3 WO2022195028A3 (en) | 2022-10-27 |
Family
ID=81327268
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2022/057029 Ceased WO2022195028A2 (en) | 2021-03-18 | 2022-03-17 | Therapeutic binding molecules |
Country Status (19)
| Country | Link |
|---|---|
| US (3) | US12049506B2 (https=) |
| EP (2) | EP4308607A2 (https=) |
| JP (2) | JP7574467B2 (https=) |
| KR (2) | KR20250069981A (https=) |
| CN (1) | CN116997571A (https=) |
| AR (1) | AR125142A1 (https=) |
| AU (2) | AU2022236492B2 (https=) |
| CA (1) | CA3212630A1 (https=) |
| CL (1) | CL2023002759A1 (https=) |
| CO (1) | CO2023013566A2 (https=) |
| CR (1) | CR20230488A (https=) |
| EC (1) | ECSP23078844A (https=) |
| IL (2) | IL305690B2 (https=) |
| MA (1) | MA71643A (https=) |
| MX (1) | MX2023010917A (https=) |
| NZ (1) | NZ804536A (https=) |
| TW (1) | TWI872319B (https=) |
| WO (1) | WO2022195028A2 (https=) |
| ZA (1) | ZA202309418B (https=) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4417623A1 (en) * | 2023-02-15 | 2024-08-21 | Fundació Institut de Recerca Contra la Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
| EP4578874A1 (en) * | 2023-12-29 | 2025-07-02 | SunRock Biopharma S.L. | Anti-ccr9 antibody |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MA53338A (fr) * | 2018-03-05 | 2022-01-05 | Janssen Pharmaceutica Nv | Dosages pour détecter la neurodégénérescence |
Citations (42)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0229246A2 (de) | 1986-01-15 | 1987-07-22 | ANT Nachrichtentechnik GmbH | Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1992006204A1 (en) | 1990-09-28 | 1992-04-16 | Ixsys, Inc. | Surface expression libraries of heteromeric receptors |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US6653068B2 (en) | 1999-07-02 | 2003-11-25 | Morphosys Ag | Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs |
| US6706484B1 (en) | 1995-08-18 | 2004-03-16 | Morphosys Ag | Protein/(poly)peptide libraries |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7538195B2 (en) | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| WO2011035884A1 (en) | 2009-09-22 | 2011-03-31 | Volker Sandig | Process for producing molecules containing specialized glycan structures |
| WO2015075269A1 (en) | 2013-11-25 | 2015-05-28 | Consejo Superior De Investigaciones Científicas | Antibodies against ccr9 and applications thereof |
| US9105939B2 (en) | 2008-03-10 | 2015-08-11 | Nissan Motor Co., Ltd. | Battery with battery electrode and method of manufacturing same |
| US9109630B2 (en) | 2013-01-15 | 2015-08-18 | Jtekt Corporation | Rolling bearing unit |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
| US9618978B2 (en) | 2013-10-03 | 2017-04-11 | Acer Incorporated | Methods for controlling a touch panel and portable computers using the same |
| US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6329159B1 (en) * | 1999-03-11 | 2001-12-11 | Millennium Pharmaceuticals, Inc. | Anti-GPR-9-6 antibodies and methods of identifying agents which modulate GPR-9-6 function |
| GB0624500D0 (en) * | 2006-12-07 | 2007-01-17 | Istituto Superiore Di Sanito | A novel passive vaccine for candida infections |
| CA2874083C (en) * | 2014-12-05 | 2024-01-02 | Universite Laval | Tdp-43-binding polypeptides useful for the treatment of neurodegenerative diseases |
-
2022
- 2022-03-17 MX MX2023010917A patent/MX2023010917A/es unknown
- 2022-03-17 KR KR1020257014756A patent/KR20250069981A/ko active Pending
- 2022-03-17 CN CN202280021611.7A patent/CN116997571A/zh active Pending
- 2022-03-17 US US17/697,041 patent/US12049506B2/en active Active
- 2022-03-17 CR CR20230488A patent/CR20230488A/es unknown
- 2022-03-17 KR KR1020237034201A patent/KR102805310B1/ko active Active
- 2022-03-17 NZ NZ804536A patent/NZ804536A/en unknown
- 2022-03-17 IL IL305690A patent/IL305690B2/en unknown
- 2022-03-17 EP EP22716861.4A patent/EP4308607A2/en active Pending
- 2022-03-17 MA MA71643A patent/MA71643A/fr unknown
- 2022-03-17 AU AU2022236492A patent/AU2022236492B2/en active Active
- 2022-03-17 JP JP2023556501A patent/JP7574467B2/ja active Active
- 2022-03-17 WO PCT/EP2022/057029 patent/WO2022195028A2/en not_active Ceased
- 2022-03-17 IL IL318237A patent/IL318237A/en unknown
- 2022-03-17 US US18/550,757 patent/US20240174758A1/en active Pending
- 2022-03-17 EP EP24154419.6A patent/EP4406592A3/en active Pending
- 2022-03-17 CA CA3212630A patent/CA3212630A1/en active Pending
- 2022-03-18 AR ARP220100634A patent/AR125142A1/es unknown
- 2022-03-18 TW TW111110226A patent/TWI872319B/zh active
-
2023
- 2023-09-15 CL CL2023002759A patent/CL2023002759A1/es unknown
- 2023-10-09 ZA ZA2023/09418A patent/ZA202309418B/en unknown
- 2023-10-13 CO CONC2023/0013566A patent/CO2023013566A2/es unknown
- 2023-10-17 EC ECSENADI202378844A patent/ECSP23078844A/es unknown
-
2024
- 2024-07-29 US US18/787,823 patent/US20250084174A1/en active Pending
- 2024-10-16 JP JP2024180571A patent/JP2025011259A/ja active Pending
-
2025
- 2025-07-03 AU AU2025205131A patent/AU2025205131A1/en active Pending
Patent Citations (57)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5814476A (en) | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
| US5817483A (en) | 1985-03-30 | 1998-10-06 | Stuart Kauffman | Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property |
| US5824514A (en) | 1985-03-30 | 1998-10-20 | Stuart A. Kauffman | Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5976862A (en) | 1985-03-30 | 1999-11-02 | Ixsys Corporation | Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| EP0229246A2 (de) | 1986-01-15 | 1987-07-22 | ANT Nachrichtentechnik GmbH | Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1992006204A1 (en) | 1990-09-28 | 1992-04-16 | Ixsys, Inc. | Surface expression libraries of heteromeric receptors |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| US7264963B1 (en) | 1995-08-18 | 2007-09-04 | Morphosys Ag | Protein(poly)peptide libraries |
| US6706484B1 (en) | 1995-08-18 | 2004-03-16 | Morphosys Ag | Protein/(poly)peptide libraries |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| EP1176195A1 (en) | 1999-04-09 | 2002-01-30 | Kyowa Hakko Kogyo Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
| US6653068B2 (en) | 1999-07-02 | 2003-11-25 | Morphosys Ag | Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs |
| WO2003035835A2 (en) | 2001-10-25 | 2003-05-01 | Genentech, Inc. | Glycoprotein compositions |
| US7538195B2 (en) | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7557189B2 (en) | 2002-11-07 | 2009-07-07 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US9105939B2 (en) | 2008-03-10 | 2015-08-11 | Nissan Motor Co., Ltd. | Battery with battery electrode and method of manufacturing same |
| WO2011035884A1 (en) | 2009-09-22 | 2011-03-31 | Volker Sandig | Process for producing molecules containing specialized glycan structures |
| US9109630B2 (en) | 2013-01-15 | 2015-08-18 | Jtekt Corporation | Rolling bearing unit |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
| US9618978B2 (en) | 2013-10-03 | 2017-04-11 | Acer Incorporated | Methods for controlling a touch panel and portable computers using the same |
| WO2015075269A1 (en) | 2013-11-25 | 2015-05-28 | Consejo Superior De Investigaciones Científicas | Antibodies against ccr9 and applications thereof |
| US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
Non-Patent Citations (57)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 2012 |
| "UniProt", Database accession no. P51686-1 |
| ALTSCHUL ET AL., BULL. MATH. BIO., vol. 48, 1986, pages 603 - 16 |
| B. SOMOVILLA-CRESPO ET AL., FRONTIERS IN IMMUNOLOGY, vol. 9, 2018 |
| BOEMER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95 |
| BOISSEL ET AL., PROCEEDINGS OF THE 107TH ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, 16 April 2016 (2016-04-16) |
| BOWIESAUER, PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 2152 - 6 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| C. E. LAWRENCE ET AL.: "Detecting Subtle Sequence Signals: A Gibbs Sampling Strategy for Multiple Alignment", SCIENCE, vol. 262, no. 5131, 1993, pages 208 - 214, XP001152872, DOI: 10.1126/science.8211139 |
| C. N. PACE ET AL., PROTEIN SCI, vol. 4, 1995, pages 2411 |
| CANCER RES, vol. 76, 2016 |
| CHOTHIA, C. ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CHUNG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 10145 - 9 |
| CHUNG ET AL., SCIENCE, vol. 259, 1993, pages 806 - 9 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1281 |
| DALL'ACQUA ET AL., J BIOL. CHEM., vol. 281, no. 33, 2006, pages 23514 - 24 |
| DALL'ACQUA ET AL., J. IMMUNOLOGY, vol. 169, 2002, pages 5171 - 5180 |
| DERBYSHIRE ET AL., GENE, vol. 46, 1986, pages 145 |
| EDELMAN ET AL., PROC NATL ACAD SCI USA, vol. 63, no. 1, 1969, pages 78 - 85 |
| ELLMAN ET AL., METHODS ENZYMOL., vol. 202, 1991, pages 301 |
| ERIC DEPIEREUXERNEST FEYTMANS: "Match-Box: A Fundamentally New Algorithm for the Simultaneous Alignment of Several Protein Sequences", CABIOS, vol. 8, no. 5, 1992, pages 501 - 509 |
| HENIKOFFHENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 10915 - 19 |
| HOOGENBOOMWINTER, J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| IVO VAN WALLE ET AL.: "Align-M - A New Algorithm for Multiple Alignment of Highly Divergent Sequences", BIOINFORMATICS, vol. 20, no. 9, 2004, pages 1428 - 1435 |
| J. MINOWADAT. OHNUMAG. E. MOORE, JNCI: JOURNAL OF THE NATIONAL CANCER INSTITUTE, vol. 49, 1972, pages 891 |
| J. TORRES ET AL., J CROHNS COLITIS, vol. 14, 2020, pages 4 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JULIE D. THOMPSON ET AL.: "CLUSTAL W: Improving the Sensitivity of Progressive Multiple Sequence Alignment Through Sequence Weighting, Position- Specific Gap Penalties and Weight Matrix Choice", NUCLEIC ACIDS RESEARCH, vol. 22, no. 22, 1994, pages 4673 - 4680, XP002956304 |
| K. VADSTRUP ET AL., PLOS ONE, vol. 11, 2016, pages e0155335 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOIDE ET AL., BIOCHEM., vol. 33, 1994, pages 7470 - 6 |
| L. PERSIC ET AL., GENE, vol. 187, 1997, pages 9 |
| LEFRANC, M.P. ET AL., DEV. COMP. IMMUNOL., vol. 27, 2003, pages 55 - 77 |
| LOWMAN ET AL., BIOCHEM., vol. 30, 1991, pages 10832 - 7 |
| M. F. NEURATH, NAT REV IMMUNOL, vol. 14, 2014, pages 329 |
| M. GAJENDRAN ET AL., DIS MON, vol. 64, 2018, pages 20 |
| MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MORIMOTO ET AL., J. BIOCHEM. BIOPHYS. METH., vol. 24, 1993, pages 107 - 117 |
| NER ET AL., DNA, vol. 7, 1988, pages 127 |
| OGANESYAN ET AL., ACTA CRYST, vol. D64, 2008, pages 700 - 4 |
| OSAMU GOTOH: "Significant Improvement in Accuracy of Multiple Protein. Sequence Alignments by Iterative Refinement as Assessed by Reference to Structural Alignments, 264(4", J. MOL. BIOL., 1996, pages 823 - 838 |
| P. UMANA ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 176 |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| R. L. SHIELDS ET AL., J BIOL CHEM, vol. 277, 2002, pages 26733 |
| REIDHAAR-OLSONSAUER, SCIENCE, vol. 241, 1988, pages 1534 - 1536 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROBERTSON ET AL., J. AM. CHEM. SOC., vol. 113, 1991, pages 2722 |
| ROTHE ET AL., J. MOLEC. BIOL., vol. 376, 2008, pages 1182 - 1200 |
| SHEETS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 95, 1998, pages 6157 - 6162 |
| SMITH ET AL., J. MOL. BIOL., vol. 224, 1992, pages 899 - 904 |
| TURCATTI ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 19991 - 8 |
| VAUGHAN ET AL., NAT. BIOTECH., vol. 14, 1996, pages 309 - 314 |
| VOS ET AL., SCIENCE, vol. 255, 1992, pages 306 - 12 |
| WLODAVER ET AL., FEBS LETT, vol. 309, 1992, pages 59 - 64 |
| WYNNRICHARDS, PROTEIN SCI, vol. 2, 1993, pages 395 - 403 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4417623A1 (en) * | 2023-02-15 | 2024-08-21 | Fundació Institut de Recerca Contra la Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
| WO2024170627A1 (en) | 2023-02-15 | 2024-08-22 | Fundació Institut De Recerca Contra La Leucèmia Josep Carreras | Ccr9 targeting moiety for the treatment of ccr9-positive cancer |
| EP4578874A1 (en) * | 2023-12-29 | 2025-07-02 | SunRock Biopharma S.L. | Anti-ccr9 antibody |
| WO2025141146A1 (en) | 2023-12-29 | 2025-07-03 | SunRock Biopharma S.L. | Anti-ccr9 antibody |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP6847037B2 (ja) | 抗cd73抗体とa2a受容体阻害薬とを含む併用治療薬及びその使用 | |
| RU2563344C2 (ru) | ГУМАНИЗИРОВАННЫЕ АНТИТЕЛА К Toll-ПОДОБНЫМ РЕЦЕПТОРАМ 2 И ИХ ПРИМЕНЕНИЯ | |
| US20250084174A1 (en) | Therapeutic binding molecules | |
| KR20250016456A (ko) | 인간 il-4ra에 대한 항체 및 이의 용도 | |
| EP3337826A1 (en) | Anti-tim-3 antibodies, compositions comprising anti-tim-3 antibodies and methods of making and using anti-tim-3 antibodies | |
| JP7596263B2 (ja) | 4-1bb及び腫瘍関連抗原に結合する抗体構築物ならびにその使用 | |
| JP2022516140A (ja) | 白血球免疫グロブリン様受容体2中和抗体 | |
| RS60795B1 (sr) | Vezujući molekuli specifični za il-21 i njihove upotrebe | |
| KR20250157389A (ko) | Fap/4-1bb/cd40 결합 분자 및 이의 의학적 용도 | |
| KR20230079397A (ko) | 신규 항-클라우딘18 항체 | |
| WO2022166846A1 (zh) | 抗tnfr2抗体及其用途 | |
| EP3328897A1 (en) | ANTI-EpCAM ANTIBODIES, COMPOSITIONS COMPRISING ANTI-EpCAM ANTIBODIES AND METHODS OF MAKING AND USING ANTI-EPCAM ANTIBODIES | |
| KR20250134734A (ko) | Cub 도메인-함유 단백질 1(cdcp1)에 대한 항체 및 이의 용도 | |
| HK40113316A (en) | Therapeutic binding molecules | |
| EA052530B1 (ru) | Терапевтическая связывающая молекула, которая связывается с ccr9 | |
| BR122024010248A2 (pt) | Molécula de ligação que se liga a ccr9, agente terapêutico, método para avaliar a depleção de células que expressam ccr9 por uma molécula de ligação, polinucleotídeo isolado, vetor, célula hospedeira, método de produção de uma molécula de ligação, composição farmacêutica, método para detectar a presença de um polipeptídeo ccr9 em uma amostra, usos e kits | |
| BR112023018331B1 (pt) | Molécula de ligação que se liga a ccr9 | |
| WO2018039107A1 (en) | Binding molecules specific for notch4 and uses thereof | |
| KR20250012013A (ko) | 신규 tm4sf5-특이적 항체 | |
| HK40016537A (en) | Anti-pd-1 antibodies and uses thereof | |
| NZ725735B2 (en) | Binding molecules specific for il-21 and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22716861 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12023552430 Country of ref document: PH Ref document number: 305690 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3212630 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2301005573 Country of ref document: TH |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023556501 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280021611.7 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/010917 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P6002350/2023 Country of ref document: AE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023018331 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202392507 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 20237034201 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020237034201 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202347068540 Country of ref document: IN Ref document number: 804536 Country of ref document: NZ Ref document number: 2022236492 Country of ref document: AU Ref document number: AU2022236492 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: NC2023/0013566 Country of ref document: CO |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022716861 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022716861 Country of ref document: EP Effective date: 20231018 |
|
| ENP | Entry into the national phase |
Ref document number: 2022236492 Country of ref document: AU Date of ref document: 20220317 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: NC2023/0013566 Country of ref document: CO |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023018331 Country of ref document: BR Free format text: APRESENTE NOVAS FOLHAS DAS REIVINDICACOES CONTENDO A EXPRESSAO ?CARACTERIZADO POR?, CONFORME ART. 17 INCISO III DA INSTRUCAO NORMATIVA/INPI/NO 31/2013, UMA VEZ QUE AS APRESENTADAS NA PETICAO NO 870230080196 DE 11/09/2023 NAO POSSUEM A EXPRESSAO CITADA NA REIVINDICACAO 35. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202306665P Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 112023018331 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230911 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450761 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450761 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 804536 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523450761 Country of ref document: SA |
|
| WWG | Wipo information: grant in national office |
Ref document number: 523450761 Country of ref document: SA |