WO2022147133A1 - Engineered t cells - Google Patents

Engineered t cells Download PDF

Info

Publication number
WO2022147133A1
WO2022147133A1 PCT/US2021/065524 US2021065524W WO2022147133A1 WO 2022147133 A1 WO2022147133 A1 WO 2022147133A1 US 2021065524 W US2021065524 W US 2021065524W WO 2022147133 A1 WO2022147133 A1 WO 2022147133A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell
cells
engineered
nucleic acid
regulatory
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/065524
Other languages
English (en)
French (fr)
Inventor
Christopher RUDULIER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Intellia Therapeutics Inc
Original Assignee
Intellia Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Intellia Therapeutics Inc filed Critical Intellia Therapeutics Inc
Priority to EP21848454.1A priority Critical patent/EP4271799A1/en
Priority to AU2021411521A priority patent/AU2021411521A1/en
Priority to MX2023007801A priority patent/MX2023007801A/es
Priority to CA3206484A priority patent/CA3206484A1/en
Priority to CN202180093689.5A priority patent/CN116848235A/zh
Priority to IL304069A priority patent/IL304069A/en
Priority to US18/270,261 priority patent/US20240316100A1/en
Priority to KR1020237025734A priority patent/KR20230153356A/ko
Priority to JP2023539978A priority patent/JP2024502036A/ja
Publication of WO2022147133A1 publication Critical patent/WO2022147133A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • C12N5/0637Immunosuppressive T lymphocytes, e.g. regulatory T cells or Treg
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/22Immunosuppressive or immunotolerising
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/416Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/418Antigens related to induction of tolerance to non-self
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4254Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/10Cells modified by introduction of foreign genetic material
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2302Interleukin-2 (IL-2)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2307Interleukin-7 (IL-7)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/20Cytokines; Chemokines
    • C12N2501/23Interleukins [IL]
    • C12N2501/2315Interleukin-15 (IL-15)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50Cell markers; Cell surface determinants
    • C12N2501/515CD3, T-cell receptor complex
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2501/00Active agents used in cell culture processes, e.g. differentation
    • C12N2501/50Cell markers; Cell surface determinants
    • C12N2501/53CD2
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • T cells are immune cells that are capable of mediating this immune response.
  • T cell receptors are protein complexes on the surface of T cells that are capable of recognizing antigens.
  • T cell diversity is derived from rearrangements of TCR alpha and beta loci.
  • One feature of adaptive immunity is the ability to distinguish “self’ from “non-self ’ antigens.
  • Autoimmune and autoinflammatory disorders are characterized by pathogenic immune responses against “self’ antigens.
  • Some rearrangements TCR alpha and beta loci generate self-reactive T cells.
  • Many self-reactive T cells are eliminated by clonal deletion in the thymus, but others can escape clonal deletion and elicit deleterious immune responses.
  • Specialized T cells called regulatory T cells (Tregs) are important for “self’ tolerance. Id.
  • Tregs are capable of suppressing excessive immune responses, autoimmune responses, and undesired immune responses, for example in graft versus host disease.
  • Dysregulation of Tregs e.g., if the number of Tregs is insufficient or if Tregs are not functioning properly, may contribute to autoimmune responses. Id.
  • Treg therapies have been used to suppress antigen-specific immune responses in different diseases, including graft-versus-host disease (GvHD), in which donor cells mediate an immune attack of host tissues following hematopoietic stem cell transplantation. Pierini et al., T Cells Expressing Chimeric Antigen Receptor Promoter Immune Tolerance, JCI Insight 2(20) (2017).
  • GvHD graft-versus-host disease
  • Treg therapies for suppressing immune response(s), including inflammation and autoimmunity.
  • the present disclosure provides T cells or a population of T cells engineered to comprise a heterologous nucleic acid encoding a regulatory T cell promoting molecule under control of a promoter sequence; a modification of an endogenous nucleic acid sequence encoding an interferon-gamma (IFNG) wherein the modification knocks down expression of the IFNG; and a modification of an endogenous a nucleic acid sequence encoding a tumor necrosis factor alpha (TNFA) wherein the modification knocks down expression of TNFA, and compositions and uses thereof, e.g., for suppressing immune response(s), including inflammation and autoimmunity.
  • IFNG interferon-gamma
  • TNFA tumor necrosis factor alpha
  • the regulatory T cell promoting molecule is a selected from interleukin- 10 (IL10), cytotoxic T-lymphocyte associated protein 4 (CTLA4), transforming growth factor beta 1 (TGFB1), indoleamine 2,3-dioxygenase 1 (IDO1), ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), 5'-nucleotidase ecto (NT5E), interleulin-22 (IL-22), amphiregulin (AREG), interleukin-35 (IL35), GARP, CD274 molecule (CD274), forkhead box P3 (FOXP3), IKAROS family zinc finger 2 (IKZF2), eosinophilia familial (EOS), interferon regulatory factor 4 (IRF4), lymphoid enhancer binding factor 1 (LEF1), and BTB domain and CNC homolog 2 (BACH2).
  • IL10 interleukin- 10
  • CTL4 cytotoxic T
  • the T cells or population of T cells are engineered to comprise a heterologous nucleic acid encoding IL10 under control of a promoter sequence; a modification of an endogenous nucleic acid sequence encoding IFNG wherein the modification knocks down expression of the IFNG; and a modification of an endogenous a nucleic acid sequence encoding TNFA wherein the modification knocks down expression of TNFA.
  • the T cells or population of T cells are engineered to comprise a heterologous nucleic acid encoding CTLA4 under control of a promoter sequence; a modification of an endogenous nucleic acid sequence encoding IFNG wherein the modification knocks down expression of the IFNG; and a modification of an endogenous a nucleic acid sequence encoding TNFA wherein the modification knocks down expression of TNFA.
  • the T cells or population of T cells are engineered to comprise heterologous nucleic acid sequences encoding IL10 and CTLA4, each under control of a promoter sequence; a modification of an endogenous nucleic acid sequence encoding IFNG wherein the modification knocks down expression of the IFNG; and a modification of an endogenous a nucleic acid sequence encoding TNFA wherein the modification knocks down expression of TNFA.
  • the T cells or population of T cells are further engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an interleukin 17A (IL 17 A), an interleukin-2 (IL2), an interleukin 6 (IL6), a perforin 1 (PRF1), a granzyme A (GZMA), or a granzyme B (GZMB).
  • IL 17 A interleukin 17A
  • IL2 interleukin-2
  • IL6 interleukin 6
  • PRF1 perforin 1
  • GZMA granzyme A
  • GZMB granzyme B
  • the T cells or population of T cells are further engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an endogenous T cell receptor (TCR).
  • a modification e.g., knockdown, of an endogenous nucleic acid sequence encoding an endogenous T cell receptor (TCR).
  • the T cells or population of T cells are further engineered to comprise a heterologous coding sequence for a targeting receptor under control of a promoter sequence.
  • the targeting receptor comprises a chimeric antigen receptor (CAR) or a T cell receptor (TCR).
  • the targeting receptor is targeted to a ligand selected from mucosal vascular addressin cell adhesion molecule 1 (MADCAM1), tumor necrosis factor alpha (TNFA), CEA cell adhesion molecule 6 (CEACAM6), vascular cell adhesion molecule 1 (VCAM1), citrullinated vimentin, myelin basic protein (MBP), MOG (myelin oligodendrocyte glycoprotein), proteolipid protein 1 (PLP1), CD 19 molecule (CD 19), CD20 molecule (CD20), TNF receptor superfamily member 17 (TNFRSF17), dipeptidyl peptidase like 6 (DPP6), solute carrier family 2 member 2 (SCL2A2), glutamate decarboxylase (GAD2), desmoglein 3 (DSG3), and MHC class I HLA- A (HL A- A* 02).
  • MADCAM1 mucosal vascular addressin cell adhesion molecule 1
  • TNFA tumor necrosis factor alpha
  • At least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of the population of T cells comprises an insertion of the sequence encoding a regulatory T cell promoting molecule, e.g., as assessed by sequencing, e.g., NGS.
  • at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of the population of T cells comprises a modification, e.g., knockdown, in an IFNG sequence, e.g., as assessed by sequencing, e.g., NGS.
  • At least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of the population of T cells comprises a modification, e.g., knockdown, in an TNFA sequence, e.g., as assessed by sequencing, e.g., NGS.
  • at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of the population of T cells comprises a modification, e.g., knockdown, in a TCR sequence, e.g., as assessed by sequencing, e.g., NGS.
  • At least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of the population of T cells comprises an insertion of the sequence encoding a targeting receptor, e.g., a CAR, e.g., as assessed by sequencing, e.g., NGS.
  • a targeting receptor e.g., a CAR
  • sequencing e.g., NGS.
  • the modifications described herein for knocking down expression of a gene may comprise one or more of an insertion, deletion, or substitution.
  • the heterologous sequences described herein may be incorporated into expression construct(s). Multiple heterologous sequences may be incorporated into a single expression construction or into separate expression constructs.
  • the heterologous sequences described herein may be incorporated into episomal expression construct s).
  • the heterologous sequences described herein may be inserted into the genome, e.g., an untargeted insertion or a targeted insertion.
  • the targeted insertion is into a site selected from a TCR gene locus, a TNF gene locus, an IFNG gene locus, IL17A gene locus, IL6 gene locus, IL2 gene locus, an adeno-associated virus integration site 1 (AAVS1) locus.
  • a site selected from a TCR gene locus, a TNF gene locus, an IFNG gene locus, IL17A gene locus, IL6 gene locus, IL2 gene locus, an adeno-associated virus integration site 1 (AAVS1) locus.
  • the engineered T cells and pharmaceutical compositions thereof may be administered to a subject in need of immunosuppression.
  • the engineered T cells and pharmaceutical compositions thereof may be useful in the treatment of an immune disorder or an autoimmune disease, e.g., ulcerative colitis, Crohn’s disease, rheumatoid arthritis, psoriasis, multiple sclerosis, systemic lupus erythematosus, type 1 diabetes, and graft versus host disease (GvHD).
  • an immune disorder or an autoimmune disease e.g., ulcerative colitis, Crohn’s disease, rheumatoid arthritis, psoriasis, multiple sclerosis, systemic lupus erythematosus, type 1 diabetes, and graft versus host disease (GvHD).
  • the insertion of sequence(s) or the modification, e.g., knockdown, of sequence(s) described herein may be mediated by guide RNAs in combination with an RNA-guided DNA binding agent, e.g., Cas nuclease.
  • an RNA-guided DNA binding agent e.g., Cas nuclease.
  • the insertion of sequence(s) or the knockdown of sequence(s) described herein may be mediated by another suitable gene editing system, e.g., zinc finger nuclease (ZFN) system or transcription activator-like effector nuclease (TALEN) system.
  • ZFN zinc finger nuclease
  • TALEN transcription activator-like effector nuclease
  • Figures 1A-1E are histograms of flow cytometry data showing intensity of fluorescence staining of CD3+CD4+ cells, either untransduced or transduced with the insertion of the indicated coding sequences; or in CD3+CD4+CD25+ nTregs.
  • Figure 1 A is a histogram of fluorescence intensity for CTLA expression in transduced T cells or the indicated controls.
  • Figure IB is a histogram of fluorescence intensity for IL 10 expression in transduced T cells or the indicated controls.
  • Figure 1C is a histogram of fluorescence intensity for Foxp3 expression in transduced T cells or the indicated controls.
  • Figure ID is a histogram of fluorescence intensity for Helios expression in transduced T cells or the indicated controls.
  • Figure IE is a histogram of fluorescence intensity for Eos expression in transduced T cells or the indicated controls.
  • Figures 2A and 2B are graphs showing results from a mouse model of GvHD.
  • Figure 2A is a survival curve showing days of survival following injection with CD3+CD4+ cells transduced with the insertion of the indicated coding sequences or the indicated controls; with CD4+CD25+ Tregs, PBMCs, or not injected with cells (irradiation only).
  • Figure 2B is a graph showing quantification of human lymphocytes isolated from spleens of mice at the time of sacrifice following injection with transduced CD3+CD4+ cells or controls as indicated.
  • Figures 3A-3E are graphs showing results from the in vitro cytokine profile analysis in stimulated CD3+CD4+ cells transduced with the insertion of the indicated coding sequences or the indicated controls.
  • Figure 3 A shows vitro IL6 production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 3B shows in vitro TNF-alpha production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 3C shows in vitro IL10 production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 3D shows vitro IL13 production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 3E shows in vitro IL2 production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 3F shows vitro IFN-gamma production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 4 is a graph showing percent suppression of cell proliferation by transduced T cells as measured by CTV dilution in a mixed lymphocyte reaction assay in which CTV labeled T cells and CD-3 depleted PBMC were mixed with the CD3+CD4+ cells transduced with the insertion of the indicated coding sequences or the indicated controls at the indicated ratios.
  • Figures 5A-5E are histograms of flow cytometry data showing intensity of fluorescence staining of CD3+CD4+ cells, either untransduced or transduced with the insertion of the coding sequences of IL 10 and CTLA4 alone (no edit) or in combination with a knockout (KO) of one or both of IFNG and TNFA; or in CD3+CD4+CD25+ nTregs.
  • Figure 5A is a histogram of fluorescence intensity for CTLA4 expression in transduced T cells or the indicated controls.
  • Figure 5B is a histogram of fluorescence intensity for IL 10 expression in transduced T cells or the indicated controls.
  • Figure 5C is a histogram of fluorescence intensity for FOXP3 expression in transduced T cells or the indicated controls.
  • Figure 5D is a histogram of fluorescence intensity for Helios expression in transduced T cells or the indicated controls.
  • Figure 5E is a histogram of fluorescence intensity for Eos expression in transduced T cells or the indicated controls.
  • Figures 6A and 6B are graphs showing results from a mouse model of GvHD.
  • Figure 6A is a survival curve showing days of survival following injection of mice with PBMC, CD3+CD4+ cells, untransduced or transduced with the insertion of the coding sequences of IL 10 and CTLA4 alone (no edit) or in combination with editing (KO) of one or both of IFNG and TNFA; CD3+CD4+CD25+ nTregs; or not injected with cells (irradiated only).
  • Figure 6B is a graph showing quantification of human lymphocytes isolated from spleens of mice at the time of sacrifice following injection with transduced CD3+CD4+ cells or control cells as indicated.
  • Figures 7A-7F are graphs showing results from the in vitro cytokine profile analysis in stimulated CD3+CD4+ cells either untransduced or transduced with the insertion of coding sequences of IL 10 and CTLA4 either alone (no edit) or in combination with editing (KO) of one or both of IFNG or TNFA; or CD4+CD25+ nTregs.
  • Figure 7A shows vitro IL6 production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 7B shows in vitro TNF-alpha production by transduced T cells or the indicated controls upon cell stimulation.
  • Figure 7C shows in vitro IL10 production by transduced T cells upon cell stimulation.
  • Figure 7D shows in vitro IL 13 production by transduced T cells upon cell stimulation.
  • Figure 7E shows in vitro IL2 production by transduced T cells upon cell stimulation.
  • Figure 7F shows in vitro IFN-gamma production by engineered cells upon cell stimulation.
  • Figure 8 is a graph showing percent suppression of cell proliferation by engineered T cells as measured by CTV dilution in a mixed lymphocyte reaction assay in which CTV labeled T cells and CD-3 depleted PBMC were mixed with the CD3+CD4+ cells transduced with the insertion of the indicated coding sequences or the indicated controls at the indicated ratios.
  • Figures 9A and 9B are graphs showing results from a mouse model of GvHD.
  • Figure 9A is a survival curve showing days of survival following injection of mice with PBMC, CD3+CD4+ cells, untransduced or transduced with the insertion of the coding sequences of IL 10 and CTLA4, either wild-type (wt) or high affinity (HA), as indicated, in combination with editing (KO) of both IFNG and TNFA; CD3+CD4+CD25+ nTregs; or not injected with cells (vehicle).
  • Figure 9B is a graph showing quantification of human lymphocytes isolated from spleens of mice at the time of sacrifice following injection with transduced CD3+CD4+ cells or control cells as indicated.
  • Figures 10A and 10B are graphs showing percent suppression of proliferation as measured by CTV dilution in a mixed lymphocyte assay.
  • Figure 10A show suppression of proliferation, with or without inflammatory preconditioning.
  • Figure 10B shows suppression of proliferation, with or without inflammatory preconditioning further in the presence of the inflammatory cytokines indicated.
  • the respective p values that are indicated are *p ⁇ 0.05, **p ⁇ 0.01, and ***p ⁇ 0.001.
  • the term “about” or “approximately” means an acceptable error for a particular value as determined by one of ordinary skill in the art, which depends in part on how the value is measured or determined.
  • the term “about” is used herein to mean within the typical ranges of tolerances in the art. For example, “about” can be understood as about 2 standard deviations from the mean. In certain embodiments, about means +10%. In certain embodiments, about means +5%.
  • the term “at least” prior to a number or series of numbers is understood to include the number adjacent to the term “at least”, and all subsequent numbers or integers that could logically be included, as clear from context.
  • the number of nucleotides in a nucleic acid molecule must be an integer.
  • “at least 17 nucleotides of a 20 nucleotide nucleic acid molecule” means that 17, 18, 19, or 20 nucleotides have the indicated property.
  • nucleotide base pairs As used herein, “no more than” or “less than” is understood as the value adjacent to the phrase and logical lower values or integers, as logical from context, to zero. For example, a duplex region of “no more than 2 nucleotide base pairs” has a 2, 1, or 0 nucleotide base pairs. When “no more than” or “less than” is present before a series of numbers or a range, it is understood that each of the numbers in the series or range is modified.
  • ranges include both the upper and lower limit.
  • 100% inhibition is understood as inhibition to a level below the level of detection of the assay, and 100% encapsulation is understood as no material intended for encapsulation can be detected outside the vesicles.
  • knockdown refers to a decrease in expression of a particular gene product (e.g., full-length or wild-type mRNA, protein, or both), e.g., in a cell, population of cells, tissue, or organ, by gene editing.
  • gene editing can be assessed by sequence, e.g., next generation sequencing (NGS).
  • NGS next generation sequencing
  • Expression may be decreased by at least 70%, 75%, 80%, 85%, 90%, 95%, or to below the level of detection of the assay as compared to a suitable control, e.g., wherein the gene sequence has not been modified.
  • Knockdown of a protein can be measured by detecting the amount of the protein from a tissue, cell population, or fluid of interest.
  • knockdown may refer to some loss of expression of a particular gene product, for example a decrease in the amount of full-length, wild-type mRNA transcribed or translated into full- length protein, or a decrease in the amount of protein expressed by a population of cells. It is well understood what changes in an mRNA sequence would result in decreased expression of a wild-type or full-length protein.
  • knockdown may refer to some loss of expression of a particular gene product, for example, an IFNG or TNFA gene product in a body fluid or tissue culture media.
  • a modification of an endogenous nucleic acid sequence, e.g., encoding IFNG or TNFA, may result in a knockdown.
  • T cell receptor refers to a receptor in a T cell.
  • a TCR is a heterodimer receptor molecule that contains two TCR polypeptide chains, a and p. a and P chain TCR polypeptides can complex with various CD3 molecules and elicit immune response(s), including inflammation and autoimmunity, after antigen binding.
  • a knockdown of TCR refers to a knockdown of any TCR gene in part or in whole, e.g., deletion of part of the TRBC1 gene, alone or in combination with knockdown of other TCR gene(s) in part or in whole.
  • TRAC is used to refer to the T cell receptor a chain.
  • a human wild-type TRAC sequence is available at NCBI Gene ID: 28755; Ensembl: ENSG00000277734.
  • T-cell receptor Alpha Constant, TCRA, IMD7, TRCA and TRA are gene synonyms for TRAC.
  • TRBC is used to refer to the T-cell receptor P-chain, e.g., TRBC1 and TRBC2.
  • TRBC1 and TRBC2 refer to two homologous genes encoding the T-cell receptor P-chain, which are the gene products of the TRBC1 or TRBC2 genes.
  • TRBC1 A human wild-type TRBC1 sequence is available at NCBI Gene ID: 28639; Ensembl: ENSG00000211751.
  • T-cell receptor Beta Constant, V segment Translation Product, BV05S1J2.2, TCRBC1, and TCRB are gene synonyms for TRBC1.
  • TRBC2 A human wild-type TRBC2 sequence is available at NCBI Gene ID: 28638; Ensembl: ENSG00000211772.
  • T-cell receptor Beta Constant, V segment Translation Product, and TCRBC2 are gene synonyms for TRBC2.
  • an “immune response” refers to one or more immune system reaction(s), e.g., increased production or activity of immune system cells, such as, but not limited to T cells, B cells, natural killer cells, monocytes, neutrophils, eosinophils, basophils, mast cells, erythrocytes, dendritic cells, antigen presenting cells, macrophages, or phagocytes as compared to an unstimulated control immune system.
  • immune system reaction(s) e.g., increased production or activity of immune system cells, such as, but not limited to T cells, B cells, natural killer cells, monocytes, neutrophils, eosinophils, basophils, mast cells, erythrocytes, dendritic cells, antigen presenting cells, macrophages, or phagocytes as compared to an unstimulated control immune system.
  • an antigen e.g., a foreign or self-antigen such as but not limited to a pathogen (microorganism, virus, prion, fungus, etc.), an allergen (dust, pollen, dust mite, etc.), a toxin (chemical, drug, etc.), or physiological changes (hypercholesterolemia, obesity, organ transplant, etc.), may cause an immune response.
  • An immune response can also include a response in which donor cells mediate an immune attack of host tissues following hematopoietic stem cell transplantation in GvHD.
  • the immune response may result in inflammation.
  • the immune response may target, attack, remove, or neutralize the antigen, e.g., foreign or self.
  • the immune response may or may not be desirable.
  • the immune response may be acute or chronic.
  • the immune response may damage the cell, tissue, or organ against which the immune response is mounted.
  • an “autoimmune response” refers to one or more immune system reaction(s) to a self-antigen, e.g., produced by a subject’s own cells, tissues, or organs.
  • the autoimmune response may result in increased production or activity of immune system cells, such as, but not limited to T cells, B cells, natural killer cells, monocytes, neutrophils, eosinophils, basophils, mast cells, erythrocytes, dendritic cells, antigen presenting cells, macrophages, or phagocytes as compared to a suitable control, e.g., a healthy control.
  • the autoimmune response may result in inflammation, e.g., prolonged inflammation, or lead to an autoimmune disease.
  • the autoimmune response may target, attack, remove, or neutralize the self-antigen produced by the subject’s own cells, tissues, or organs, which may lead to an autoimmune disease.
  • “suppressing” an immune response(s) refers to decreasing or inhibiting the level of one or more immune system reaction(s), e.g., the production or activity of the immune system cells compared to a suitable control, e.g., not treated with or prior to treatment with the engineered T cell described herein. “Suppressing” an immune response(s) may refer to decreased production or activity of the immune system cells compared to a suitable control, e.g., not treated with or prior to treatment with the engineered T cell described herein. “Suppressing” an immune response may refer to increasing immune tolerance.
  • production or activity of the immune system cells may be measured by cell count, e.g., lymphocyte count or spleen cell count; cell activity, e.g., T cell assay; or gene or protein expression, e.g., biomarker expression; wherein the production or activity is decreased by 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or below the level of detection of the assay compared to a suitable control, e.g., not treated with or prior to treatment with the engineered T cell described herein.
  • cell count e.g., lymphocyte count or spleen cell count
  • cell activity e.g., T cell assay
  • gene or protein expression e.g., biomarker expression
  • an “autoimmune disease” or “autoimmune disorder” refers to a condition characterized by pathological immune responses to a subject’s own antigens, cells, tissues, or organs.
  • autoimmune diseases and disorders include, but are not limited to: ulcerative colitis, Crohn’s disease, rheumatoid arthritis, psoriasis, multiple sclerosis, systemic lupus erythematosus, and type 1 diabetes.
  • the engineered T cells have autologous or allogenic use.
  • an “immune disorder” is understood as a disease or condition characterized by a pathological or undesired immune response in a subject.
  • an immune disorder is an autoimmune disease.
  • an immune disorder is GvHD.
  • a subject with an immune disorder is in need of suppression of an immune response.
  • a subject with an immune disorder is in need of an increase in immune tolerance.
  • T cell plays a central role in the immune response following exposure to an antigen.
  • T cells can be naturally occurring or non-natural, e.g., when T cells are formed by engineering, e.g., from a stem cell or by transdifferentiation, e.g., reprogramming a somatic cell.
  • T cells can be distinguished from other lymphocytes by the presence of a T cell receptor on the cell surface.
  • conventional adaptive T cells which include helper CD4+ T cells, cytotoxic CD8+ T cells, memory T cells, and regulatory CD4+ T cells, and innate-like T cells including natural killer T cells, mucosal associated invariant T cells, and gamma delta T cells.
  • T cells are CD4+.
  • T cells are CD3+/CD4+.
  • a “regulatory T cell” or “Treg” refers to a specialized T cell that plays a central role in self-tolerance by suppressing excessive immune response(s), including inflammation and autoimmunity.
  • Tregs can be naturally occurring or non-natural, e.g., when Tregs are formed by engineering, e.g., by modifications, e.g., knockdowns, of endogenous nucleic acid sequences encoding IFNG and TNFA and insertion of at least one sequence(s) encoding a regulatory T cell promoting molecule.
  • a naturally occurring Treg or natural Treg or nTreg is a specialized T cell that typically develops in the thymus gland and functions to promote self-tolerance by suppressing excessive immune response(s).
  • a cell such as a conventional T cell or population of conventional T cells, e.g., a population of T cells not enriched for the presence of nTreg cells, may be engineered by modifying endogenous nucleic sequences encoding TNFA and IFNG, e.g., knocking down nucleic sequences encoding TNFA and IFNG, and insertion of sequence(s) encoding a regulatory T cell promoting molecule into the cell to exhibit the phenotypic characteristics and suppressive functions of a regulatory T cell, and these may be referred to as transduced or “engineered” T cells.
  • an engineered T cell comprises a modification of an endogenous nucleic acid sequence encoding an IFNG and a modification of an endogenous nucleic acid sequence encoding a TNFA, and insertion of a heterologous regulatory T cell promoting molecule such as IL10 or CTLA4.
  • the modification of an endogenous nucleic acid sequence e.g., a modification knocks down expression of an endogenous gene, may comprise or consist of one or more indel or substitution mutations in the genomic sequence.
  • regulatory T cell promoting molecules refer to molecules that promote the conversion of conventional T cells to regulatory T cells including immunosuppressive molecules and Treg transcription factors. Further, regulatory T cell promoting molecules refer also to molecules that endow conventional T cells with regulatory activity, including Treg-associated immunosuppressive molecules and transcription factors.
  • immunosuppressive molecules may include, but are not limited to, interleukin- 10 (IL10), cytotoxic T-lymphocyte associated protein 4 (CTLA4), transforming growth factor beta 1 (TGFB1), indoleamine 2,3-dioxygenase 1 (IDO1), ectonucleoside triphosphate diphosphohydrolase 1 (ENTPD1), 5 '-nucleotidase ecto (NT5E), interleukin-22 (IL22), amphiregulin (AREG), interleukin-35 (IL35), leucine rich repeat containing 32 (GARP), CD274 molecule (CD274), forkhead box P3 (FOXP3), IKAROS family zinc finger 2 (IKZF2), eosinophilia familial (EOS), interferon regulatory factor 4 (IRF4), lymphoid enhancer binding factor 1 (LEF1), and BTB domain and CNC homolog 2 (BACH2).
  • IL-10 interleukin
  • regulatory T cell promoting molecules may be used in specific combinations, e.g., IL10 and CTLA4, ENTPD1 and NT5E, and IL22 and AREG.
  • IL10 and CTLA4 combination is provided herein.
  • the expression of immunosuppressive molecules may be promoted by the expression of transcription factors such as FoxP3, Helios, Eos, IRF4, Lefl, or BACH2.
  • a conventional T cell may be engineered to modify, insert, or delete sequences in the genome, and the “engineered” T cell exhibits one or more phenotypic characteristics and suppressive functions of a natural regulatory T cell.
  • the “engineered” T cell exhibits suppressive activity in a mixed lymphocyte reaction assay as provided in Examples 2 and 3 below, or preferably is capable of inhibiting graft versus host disease in the mouse model presented in Examples 2 and 3 below, preferably in a statistically significant manner (see also, e.g., Parmar et al., Ex vivo fucosylation of third-party human regulatory T cells enhances anti-graft-versus-host disease potency in vivo, Blood 125(9) (2015)).
  • the “engineered” T cell is a conventional T cell that that has been modified with the insertion of coding sequences for regulatory T cell promoting molecules, and with modification, e.g., knockdown, of expression of pro-inflammatory cytokines, e.g., both IFNG and TNFA.
  • the starting T cell population for engineering is not enriched for the presence of natural Tregs, e.g., the starting T cell population has less than 20% natural Tregs.
  • a “pro-inflammatory” molecule e.g., cytokine
  • pro-inflammatory molecules include, but are not limited to, IFNG, TNFA, IL 17 A, IL6, IL2, perforin 1 (PRF1), granzyme A (GZMA), granzyme B (GZMB).
  • targeting receptor refers to a receptor present on the surface of a cell, e.g., a T cell, to permit binding of the cell to a target site, e.g., a specific cell or tissue in an organism.
  • Targeting receptors include, but are not limited to a chimeric antigen receptor (CAR), a T-cell receptor (TCR), and a receptor for a cell surface molecule operably linked through at least a transmembrane domain in an internal signaling domain capable of activating a T cell upon binding of the extracellular receptor portion of a protein, e.g., mucosal addressin cell adhesion molecule-1 (MadCAM-1), TNFA, CEA cell adhesion molecule 6 (CEACAM6), vascular cell adhesion molecule 1 (VCAM1), citrullinated vimentin, myelin basic protein (MBP), MOG (myelin oligodendrocyte glycoprotein), proteolipid protein 1 (PLP1), CD 19 molecule (CD 19), CD20 molecule (CD20), TNF receptor superfamily member 17 (TNFRSF17), solute carrier family 2 member 2 (SCL2A2), glutamate decarboxylase (GAD2), demoglein 3 (DSG3),
  • a “chimeric antigen receptor” refers to an extracellular antigen recognition domain, e.g., an scFv, VHH, nanobody; operably linked to an intracellular signaling domain, which activates the T cell when an antigen is bound.
  • CARs are composed of four regions: an antigen recognition domain, an extracellular hinge region, a transmembrane domain, and an intracellular T-cell signaling domain.
  • Such receptors are well known in the art (see, e.g., W02020092057, WO2019191114, WO2019147805, WO2018208837, the corresponding portions of the contents of each of which are incorporated herein by reference).
  • a reversed universal CAR that promotes binding of an immune cell to a target cell through an adaptor molecule is also contemplated.
  • CARs can be targeted to any antigen to which an antibody can be developed and are typically directed to molecules displayed on the surface of a cell or tissue to be targeted.
  • the CAR is capable of targeting engineered T cells to the gastrointestinal tract, e.g., the CAR targets MAdCAM-1.
  • the CAR is capable of targeting engineered T cells to tissues comprising endothelial cells, e.g., the CAR targets VCAM-1, e.g., for suppressing immune responses in disorders such as Crohn’s disease and multiple sclerosis.
  • the CAR is capable of targeting engineered T cells to endothelial cells, e.g., the CAR targets CEACAM6, e.g., for suppressing immune responses in disorders such as Crohn’s disease.
  • the CAR is capable of targeting engineered T cells to pre-B cells, e.g., the CAR targets CD19, e.g., for suppressing immune responses in disorders such as multiple sclerosis and systemic lupus erythematosus.
  • the CAR is capable of targeting engineered T cells to B lymphocytes, e.g., the CAR targets CD20, e.g., for suppressing immune responses in disorders such as multiple sclerosis and systemic lupus erythematosus.
  • the CAR is capable of targeting engineered T cells to an inflammatory tissue, e.g., the CAR targets TNFA, e.g., for suppressing immune responses in disorders such as rheumatoid arthritis, inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the CAR is capable of targeting engineered T cells to an inflammatory tissue, e.g., the CAR targets TGF-bl e.g., for suppressing immune responses in disorders such as inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the CAR is capable of targeting engineered T cells to a neurological tissue, e.g., the CAR targets MBP, MOG, or PLP1 e.g., for suppressing immune responses in disorders such as multiple sclerosis.
  • the CAR is capable of targeting engineered T cells to tissues comprising mature B lymphocytes, e.g., the CAR targets TNFRSF17, e.g., for suppressing immune responses in disorders such as systemic lupus erythematosus.
  • the CAR is capable of targeting engineered T cells to synovial tissue, e.g., the CAR targets citrullinated vimentin e.g., for suppressing immune responses in disorders such as rheumatoid arthritis.
  • the CAR targets dipeptidyl peptidase like 6 (DPP6), solute carrier family 2 member 2 ( SCL2A2), glutamate decarboxylase (GAD2), demoglein 3 (DSG3), or MHC class I HLA-A (HLA-A*02).
  • DPP6 dipeptidyl peptidase like 6
  • SCL2A2A2 solute carrier family 2 member 2
  • GAD2A2 glutamate decarboxylase
  • DSG3 demoglein 3
  • MHC class I HLA-A HLA-A*02
  • Additional CAR targets e.g., inflammatory antigens, are known in the art. See, e.g., W02020092057A1, the contents of which are incorporated here
  • treatment refers to any administration or application of a therapeutic for disease or disorder in a subject, and includes inhibiting the disease, arresting its development, relieving one or more symptoms of the disease, curing the disease, preventing one or more symptoms of the disease, or preventing reoccurrence of one or more symptoms of the disease.
  • Treating an autoimmune or inflammatory response or disorder may comprise alleviating the inflammation associated with the specific disorder resulting in the alleviation of disease-specific symptoms.
  • Treatment with the engineered T cells described herein may be used before, after, or in combination with additional therapeutic agents, e.g., anti-inflammatory agents, immunosuppressive agents, or biologies for treatment of autoimmune disorders, e.g., Remicade, Humira.
  • a “promoter” refers to a regulatory region that controls the expression of a gene to which the regulatory region is linked.
  • nucleic acid and “nucleic acid” are used herein to refer to a multimeric compound comprising nucleosides or nucleoside analogs which have nitrogenous heterocyclic bases or base analogs linked together along a backbone, including conventional RNA, DNA, mixed RNA-DNA, and polymers that are analogs thereof.
  • a nucleic acid “backbone” can be made up of a variety of linkages, including one or more of sugarphosphodiester linkages, peptide-nucleic acid bonds (“peptide nucleic acids” or PNA; PCT No. WO 95/32305), phosphorothioate linkages, methylphosphonate linkages, or combinations thereof.
  • Sugar moieties of a nucleic acid can be ribose, deoxyribose, or similar compounds with substitutions, e.g., 2’ methoxy or 2’ halide substitutions.
  • Nitrogenous bases can be conventional bases (A, G, C, T, U), analogs thereof (e.g., modified uridines such as 5- methoxyuridine, pseudouridine, or N1 -methylpseudouridine, or others); inosine; derivatives of purines or pyrimidines (e.g., N 4 -methyl deoxy guanosine, deaza- or aza-purines, deaza- or aza-pyrimidines, pyrimidine bases with substituent groups at the 5 or 6 position (e.g., 5- methylcytosine), purine bases with a substituent at the 2, 6, or 8 positions, 2-amino-6- methylaminopurine, O 6 -methylguanine, 4-thio-pyrimidines, 4-amin
  • Nucleic acids can include one or more “abasic” residues where the backbone includes no nitrogenous base for position(s) of the polymer (US Pat. No. 5,585,481).
  • a nucleic acid can comprise only conventional RNA or DNA sugars, bases and linkages, or can include both conventional components and substitutions (e.g., conventional bases with 2’ methoxy linkages, or polymers containing both conventional bases and one or more base analogs).
  • Nucleic acid includes “locked nucleic acid” (LNA), an analogue containing one or more LNA nucleotide monomers with a bicyclic furanose unit locked in an RNA mimicking sugar conformation, which enhance hybridization affinity toward complementary RNA and DNA sequences (Vester and Wengel, 2004, Biochemistry 43(42): 13233-41).
  • LNA locked nucleic acid
  • RNA and DNA can have different sugar moieties and can differ by the presence of uracil or analogs thereof in RNA and thymine or analogs thereof in DNA.
  • RNA refers to either a guide that comprises a guide sequence, e.g., crRNA (also known as CRISPR RNA), or the combination of a crRNA and a trRNA (also known as tracrRNA).
  • the crRNA and trRNA may be associated as a single RNA molecule (single guide RNA, sgRNA) or, for example, in two separate RNA molecules (dual guide RNA, dgRNA).
  • sgRNA single guide RNA
  • dgRNA dual guide RNA
  • “Guide RNA” or “gRNA” refers to each type.
  • the trRNA may be a naturally-occurring sequence, or a trRNA sequence with modifications or variations compared to naturally-occurring sequences.
  • Guide RNAs such as sgRNAs or dgRNAs, can include modified RNAs as described herein.
  • a “guide sequence” refers to a sequence within a guide RNA that is complementary to a target sequence and functions to direct a guide RNA to a target sequence for binding or modification (e.g., cleavage) by an RNA-guided DNA binding agent.
  • a “guide sequence” may also be referred to as a “targeting sequence,” or a “spacer sequence.”
  • a guide sequence can be 20 base pairs in length, e.g., in the case of Streptococcus pyogenes (i.e., Spy Cas9) and related Cas9 homologs/orthologs.
  • the guide sequence comprises at least 15, 16, 17, 18, 19, or 20 contiguous nucleotides of a sequence that is complementary to a target.
  • the target sequence is in a gene or on a chromosome, for example, and is complementary to the guide sequence.
  • the degree of complementarity or identity between a guide sequence and its corresponding target sequence may be about 75%, 80%, 85%, 90%, 95%, or 100%.
  • the guide sequence comprises a sequence with about 75%, 80%, 85%, 90%, 95%, or 100% identity to at least 15, 16, 17, 18, 19, or 20 contiguous nucleotides of a sequence.
  • the guide sequence and the target region may be 100% complementary or identical.
  • the guide sequence and the target region may contain at least one mismatch.
  • the guide sequence and the target sequence may contain 1, 2, 3, or 4 mismatches, where the total length of the target sequence is at least 17, 18, 19, 20 or more base pairs.
  • the guide sequence and the target region may contain 1-4 mismatches, or they may be fully complementary, where the guide sequence comprises at least 17, 18, 19, 20 or more nucleotides.
  • the guide sequence and the target region may contain 1, 2, 3, or 4 mismatches where the guide sequence comprises 20 nucleotides.
  • Target sequences for RNA-guided DNA binding agents include both the positive and negative strands of genomic DNA (i.e., the sequence given and the sequence’s reverse complement), as a nucleic acid substrate for an RNA-guided DNA-binding agent is a double stranded nucleic acid. Accordingly, where a guide sequence is said to be “complementary to a target sequence”, it is to be understood that the guide sequence may direct a guide RNA to bind to the reverse complement of a target sequence.
  • the guide sequence binds the reverse complement of a target sequence
  • the guide sequence is identical to certain nucleotides of the target sequence (e.g., the target sequence not including the PAM) except for the substitution of U for T in the guide sequence.
  • RNA-guided DNA-binding agent means a polypeptide or complex of polypeptides having RNA and DNA binding activity, or a DNA-binding subunit of such a complex, wherein the DNA binding activity is sequence-specific and depends on the sequence of the RNA.
  • RNA-guided DNA-binding agent also includes nucleic acids encoding such polypeptides.
  • Exemplary RNA-guided DNA-binding agents include Cas cleavases/nickases.
  • RNA-guided DNA-binding agents may include inactivated forms thereof (“dCas DNA-binding agents”), e.g., if those agents are modified to permit DNA cleavage, e.g., via fusion with a FokI cleavase domain.
  • Cas nuclease encompasses Cas cleavases and Cas nickases.
  • Cas cleavases and Cas nickases include a Csm or Cmr complex of a type III CRISPR system, the Cas 10, Csml, or Cmr2 subunit thereof, a Cascade complex of a type I CRISPR system, the Cas3 subunit thereof, and Class 2 Cas nucleases.
  • Class 2 Cas nuclease is a single-chain polypeptide with RNA- guided DNA binding activity.
  • Class 2 Cas nucleases include Class 2 Cas cleavases/nickases (e.g., H840A, D10A, or N863 A variants), which further have RNA-guided DNA cleavases or nickase activity, and Class 2 dCas DNA-binding agents, in which cleavase/nickase activity is inactivated), for example if those agents are modified to permit DNA cleavage, or with a C to T deaminase or A to G deaminase activity.
  • the RNA-guided DNA- binding agent comprises a deaminase region and an RNA-guided DNA nickase, such as a Cas9 nickase.
  • Class 2 Cas nucleases include, for example, Cas9, Cpfl, C2cl, C2c2, C2c3, HF Cas9 (e.g., N497A, R661A, Q695A, Q926A variants), HypaCas9 (e.g., N692A, M694A, Q695A, H698A variants), eSPCas9(1.0) (e.g, K810A, K1003A, R1060A variants), and eSPCas9(l.
  • Cas9, Cpfl, C2cl, C2c2, C2c3, HF Cas9 e.g., N497A, R661A, Q695A, Q926A variants
  • Cpfl protein Zetsche et al., Cell, 163: 1-13 (2015), also contains a RuvC-like nuclease domain.
  • Cpfl sequences of Zetsche are incorporated by reference in their entirety. See, e.g., Zetsche, Tables SI and S3. See, e.g., Makarova et al., Nat Rev Microbiol, 13(11): 722-36 (2015); Shmakov et al., Molecular Cell, 60:385-397 (2015).
  • RNA-guided DNA-binding agent e.g., a Cas nuclease, a Cas9 nuclease, or an S. pyogenes Cas9 nuclease
  • delivery of the polypeptide or mRNA includes delivery of the polypeptide or mRNA.
  • Exemplary nucleotide and polypeptide sequences of Cas9 molecules are provided below. Methods for identifying alternate nucleotide sequences encoding Cas9 polypeptide sequences, including alternate naturally occurring variants, are known in the art. Sequences with at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any of the Cas9 nucleic acid sequences, amino acid sequences, or nucleic acid sequences encoding the amino acid sequences provided herein are also contemplated.
  • V (SEQ ID NO: 115)
  • ribonucleoprotein or “RNP complex” refers to a guide RNA together with an RNA-guided DNA binding agent, such as a Cas nuclease, e.g., a Cas cleavase, Cas nickase, or dCas DNA binding agent (e.g., Cas9).
  • a Cas nuclease e.g., a Cas cleavase, Cas nickase, or dCas DNA binding agent (e.g., Cas9).
  • the guide RNA guides the RNA-guided DNA-binding agent such as Cas9 to a target sequence, and the guide RNA hybridizes with and the agent binds to the target sequence; in cases where the agent is a cleavase or nickase, binding can be followed by double-stranded DNA cleavage or single-stranded DNA cleavage.
  • a first sequence is considered to “comprise a sequence with at least X% identity to” a second sequence if an alignment of the first sequence to the second sequence shows that X% or more of the positions of the second sequence in its entirety are matched by the first sequence.
  • the sequence AAGA comprises a sequence with 100% identity to the sequence AAG because an alignment would give 100% identity in that there are matches to all three positions of the second sequence.
  • RNA and DNA generally the exchange of uridine for thymidine or vice versa
  • nucleoside analogs such as modified uridines
  • adenosine for all of thymidine, uridine, or modified uridine another example is cytosine and 5-methylcytosine, both of which have guanosine or modified guanosine as a complement.
  • sequence 5’-AXG where X is any modified uridine, such as pseudouridine, Nl-methyl pseudouridine, or 5-methoxyuridine, is considered 100% identical to AUG in that both are perfectly complementary to the same sequence (5’-CAU).
  • exemplary alignment algorithms are the Smith -Waterman and Needleman-Wunsch algorithms, which are well-known in the art.
  • Needleman- Wunsch algorithm with default settings of the Needleman-Wunsch algorithm interface provided by the EBI at the www.ebi.ac.uk web server is generally appropriate.
  • a first sequence is considered to be “X% complementary to” a second sequence if X% of the bases of the first sequence base pairs with the second sequence.
  • a first sequence 5’AAGA3’ is 100% complementary to a second sequence 3’TTCT5’
  • the second sequence is 100% complementary to the first sequence.
  • a first sequence 5’AAGA3’ is 100% complementary to a second sequence 3’TTCTGTGA5’
  • the second sequence is 50% complementary to the first sequence.
  • mRNA is used herein to refer to a polynucleotide that is entirely or predominantly RNA or modified RNA and comprises an open reading frame that can be translated into a polypeptide (i.e., can serve as a substrate for translation by a ribosome and amino-acylated tRNAs).
  • mRNA can comprise a phosphate-sugar backbone including ribose residues or analogs thereof, e.g., 2’ -methoxy ribose residues.
  • the sugars of an mRNA phosphate-sugar backbone consist essentially of ribose residues, 2’ -methoxy ribose residues, or a combination thereof.
  • “indel” refers to insertion/deletion mutations consisting of a number of nucleotides that are either inserted or deleted at the site of a double-stranded break (DSB) in a target nucleic acid.
  • a “target sequence” refers to a sequence of nucleic acid in a target gene that has complementarity to the guide sequence of the gRNA. The interaction of the target sequence and the guide sequence directs an RNA-guided DNA-binding agent to bind, and potentially nick or cleave (depending on the activity of the agent), within the target sequence.
  • polypeptide refers to a wild-type or variant protein (e.g., mutant, fragment, fusion, or combinations thereof).
  • a variant polypeptide may possess at least or about 5%, 10%, 15%, 20%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% functional activity of the wild-type polypeptide.
  • the variant is at least 70%, 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of the wild-type polypeptide.
  • a variant polypeptide may be a hyperactive variant. In certain instances, the variant possesses between about 80% and about 120%, 140%, 160%, 180%, 200%, 300%, 400%, 500%, or more of a functional activity of the wild-type polypeptide.
  • a “heterologous gene” refers to a gene that has been introduced as an exogenous source within a cell (e.g., inserted at a genomic locus such as a safe harbor locus including a TCR gene locus). That is, the introduced gene is heterologous with respect to its insertion site.
  • a polypeptide expressed from such heterologous gene is referred to as a “heterologous polypeptide.”
  • the heterologous gene can be naturally- occurring or engineered, and can be wild-type or a variant.
  • the heterologous gene may include nucleotide sequences other than the sequence that encodes the heterologous polypeptide (e.g., an internal ribosomal entry site).
  • the heterologous gene can be a gene that occurs naturally in the genome, as a wild-type or a variant (e.g., mutant).
  • the cell contains the gene of interest (as a wild-type or as a variant), the same gene or variant thereof can be introduced as an exogenous source for, e.g., expression at a locus that is highly expressed.
  • the heterologous gene can also be a gene that is not naturally occurring in the genome, or that expresses a heterologous polypeptide that does not naturally occur in the genome. “Heterologous gene”, “exogenous gene”, and “transgene” are used interchangeably.
  • the heterologous gene or transgene includes an exogenous nucleic acid sequence, e.g., a nucleic acid sequence is not endogenous to the recipient cell. In some embodiments, the heterologous gene or transgene includes an exogenous nucleic acid sequence, e.g., a nucleic acid sequence that does not naturally occur in the recipient cell. For example, a heterologous gene a heterologous gene may be heterologous with respect to its insertion site and with respect to its recipient cell.
  • a “safe harbor” locus is a locus within the genome wherein a gene may be inserted without significant deleterious effects on the cell.
  • Non-limiting examples of safe harbor loci that are targeted by nuclease(s) for use herein include AAVS1 (PPP1 R12C), TCR, B2M, and any of the loci targeted for knockdown described herein, e.g., TNFA, IFNG, IL 17 A, and IL6 genomic loci.
  • insertions at a locus or loci targeted for knockdown such as a TRC gene, e.g., TRAC gene, is advantageous for allogenic cells.
  • Other suitable safe harbor loci are known in the art.
  • T cells and populations of T cells engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under the control of a promoter sequence, as well as compositions and uses thereof.
  • the regulatory T cell promoting molecule is selected from IL 10, CTLA4, TGFB1, IDO1, ENTPD1, NT5E, IL22, AREG, IL35, GARP, CD274, FOXP3, IKZF2, EOS, IRF4, LEF1, and BACH2.
  • the T cells or population of T cells is engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequences encoding two or more regulatory T cell promoting molecules each under the control of a promoter sequence.
  • a modification e.g., knockdown
  • the engineered T cell comprises a first heterologous sequence encoding a first regulatory T cell promoting molecule that is under the control of a first promoter and a second heterologous sequence encoding a second regulatory T cell promoting molecule that is under the control of a second promoter.
  • the first promoter and the second promoter may be the same promoter or different promoters.
  • the T cells or population of T cells is engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding IL10 that is under the control of a promoter.
  • a modification e.g., knockdown
  • the T cell is engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding CTLA4 that is under the control of a promoter.
  • a modification e.g., knockdown
  • the T cell is engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion into the cell of heterologous sequence(s) encoding IL10 that is under the control of a promoter, and insertion into the cell of heterologous sequence(s) encoding CTLA4 that is under the control of a promoter.
  • a modification e.g., knockdown
  • an endogenous nucleic acid sequence encoding an IFNG e.g., a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA
  • insertion into the cell of heterologous sequence(s) encoding IL10 that is under the control of a promoter
  • insertion into the cell of heterologous sequence(s) encoding CTLA4 that is
  • the T cells or population of T cells is engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule that is under the control of a promoter, and exhibits at least one suppressive activity of a naturally occurring regulatory T cell (nTreg), e.g., suppression of an immune response or biomarker in an in vitro or in vivo assay, e.g., an animal model of GvHD.
  • nTreg naturally occurring regulatory T cell
  • the heterologous sequence(s) encoding the regulatory T cell promoting molecule is incorporated into an expression construct.
  • heterologous sequences encoding two or more regulatory T cell promoting molecules may be incorporated into two or more separate expression constructs.
  • a first heterologous sequence encoding a first regulatory T cell promoting molecule is provided in a first expression construct
  • a second heterologous sequence encoding a second regulatory T cell promoting molecule is provided in a second, separate expression construct.
  • the expression construct is an episomal expression construct.
  • the heterologous sequence(s) encoding the regulatory T cell promoting molecule is inserted into the genome, e.g., a targeted or an untargeted insertion.
  • the sequence(s) encoding the regulatory T cell promoting molecule may be inserted into a site selected from a TCR gene locus, e.g., TRAC locus; a TNF gene locus, an IFNG gene locus, a IL17A locus, a IL6 locus, an IL2 locus, or an adeno-associated virus integration site 1 (AAVS1) locus.
  • a TCR gene locus e.g., TRAC locus
  • TNF gene locus e.g., an IFNG gene locus
  • IL17A locus e.g., IL17A locus
  • IL6 locus e.g., IL17A locus
  • IL2 locus e.g., IL2 locus
  • AAVS1 locus e.g., adeno-associated virus integration site 1
  • the population of engineered T cell comprises a modification, e.g., knockdown, in a TNFA sequence by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion, deletion, or substitution in the endogenous TNFA sequence.
  • the expression of TNFA is decreased by at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, 95%, or to below the limit of detection of the assay as compared to a suitable control, e.g., wherein the TNFA gene has not been modified as determined, e.g., by ELISA or flow cytometry.
  • Assays for TNFA protein and mRNA expression e.g., in the population of T cells, are known in the art and provided herein (see Examples 2 and 3).
  • knockdown of TNFA results in a TNFA level of 2500 pg/ml or less by the method provided in Examples 2 and 3.
  • the population of engineered T cell comprises a modification, e.g., knockdown, in an IFNG sequence by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion, deletion, or substitution in the endogenous IFNG sequence.
  • the expression of IFNG (full-length, wild-type protein or mRNA) is decreased by at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, 95%, or to below the limit of detection of the assay as compared to a suitable control, e.g., wherein the IFNG gene has not been modified as determined, e.g., by ELISA or flow cytometry.
  • Assays for IFNG protein and mRNA expression e.g., in the population of T cells, are known in the art and provided herein (see Examples 2 and 3).
  • knockdown of IFNG results in an IFNG level of 300,000 pg/ml or less by the method provided in Examples 2 and 3.
  • the modification that knocks down expression of a gene is one or more of an insertion, a deletion, or a substitution.
  • the engineered T cells or population of T cells comprise an insertion of sequence(s) encoding a regulatory T cell promoting molecule, e.g., by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion of a sequence encoding a regulatory T cell promoting molecule.
  • the inserted regulatory T cell promoting molecule results in statistically significantly increased expression of protein or mRNA as compared to a suitable control, e.g., wherein the regulatory T cell promoting molecule gene has not been inserted as determined, e.g., by ELISA or flow cytometry.
  • the engineered T cells comprise an insertion of sequence(s) encoding IL10 by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion or a sequence encoding IL10.
  • the inserted sequence(s) encoding IL10 results in statistically significantly increased expression of protein or mRNA as compared to a suitable control, e.g., wherein the regulatory T cell promoting molecule.
  • the level of IL10 is at least 300 pg/ml as determined by the method in Examples 2 and 3.
  • the engineered T cells or population of T cells comprises an insertion of sequence(s) encoding CTLA4 e.g., by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion or a sequence encoding CTLA4.
  • the inserted sequence(s) encoding CTLA4 results in statistically significantly increased expression of protein or mRNA as compared to a suitable control, e.g., wherein the regulatory T cell promoting molecule.
  • Assays for CTLA4 protein and mRNA expression e.g., in the population of T cells, are described herein and known in the art, e.g., ELISA and flow cytometry.
  • a population of T cells comprises T cells that are engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion of sequences encoding a regulatory T cell promoting molecule.
  • At least 40%, 45%, preferably at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% (e.g., within the detection limits of the assay used) of the T cells in the population of T cells are engineered to comprise a heterologous regulatory T cell promoting molecule, e.g., as assessed by sequencing, e.g., NGS.
  • At least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, preferably at least 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise a modification, e.g., knockdown, of sequence(s) encoding TNFA, e.g., as assessed by sequencing, e.g., NGS.
  • At least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise a modification, e.g., knockdown, of sequence(s) encoding IFNG, e.g., as assessed by sequencing, e.g., NGS.
  • At least 40%, 45%, preferably at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise insertion of sequences encoding a regulatory T cell promoting molecule, e.g., as assessed by sequencing, e.g., NGS.
  • At least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise insertion of sequence(s) encoding IL10, e.g., as assessed by sequencing, e.g., NGS.
  • At least 30%, 35%, preferably at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise insertion of sequence(s) encoding CTLA4, e.g., as assessed by sequencing, e.g., NGS.
  • the engineered T cells or population of T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, further comprise a modification of an endogenous nucleic acid sequence encoding an interleukin 17A (IL 17 A), an interleukin 6 (IL6), interleukin 2 (IL2), a perforin 1 (PRF1), a granzyme A (GZMA), or a granzyme B (GZMB), wherein the modification knocks down expression of the IL 17 A, the IL6, the IL2, the PRF1, the GZMA, or the GZMB, respectively.
  • IL 17 A interleukin 17A
  • IL6 interleukin 6
  • the T cells or population of T cells are engineered using a gene editing system, e.g., using an RNA-guided DNA binding agent.
  • the T cells are engineered using a CRISPR/Cas gene editing system.
  • the T cells are engineered using a CRISPR/Cas type II gene editing system, e.g., using Cpfl.
  • the T cells are engineered using a CRISPR/Cas9 gene editing system, e.g., using SpyCas9. Exemplary Cas9 sequences are provided herein.
  • the T cells or population of T cells are engineered using guide RNAs that specifically target sites within the IFNG and TNFA genes to provide knockdown of the of IFNG and TNFA genes.
  • guide RNAs that specifically target sites within the IFNG and TNFA genes to provide knockdown of the of IFNG and TNFA genes.
  • Exemplary sequences are provided in Tables 1 and 2, as are genomic coordinates of the target of each listed guide sequence.
  • the engineered T cells or population of T cells comprise IFNG and TNFA genes that are knocked down using a guide RNA disclosed herein with an RNA-guided DNA binding agent.
  • T cells engineered by inducing a break e.g., double-stranded break (DSB) or single-stranded break (nick)) within the IFNG and TNFA genes of a T cell e.g., using a guide RNA disclosed herein with an RNA-guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • the methods may be used in vitro or ex vivo, e.g., in the manufacture of cell products for suppressing immune response(s), including inflammation and autoimmunity.
  • the guide RNAs disclosed herein mediate a target-specific cutting by an RNA-guided DNA- binding agent (e.g., Cas nuclease) at a site described herein within an IFNG gene.
  • the guide RNAs disclosed herein mediate a target-specific cutting by an RNA- guided DNA-binding agent (e.g., Cas nuclease) at a site described herein within a TNFA gene.
  • the guide RNAs comprise guide sequences that bind to, or are capable of binding to, said regions.
  • Engineered T cells or population of T cells comprising a genetic modification at genomic coordinates chosen from those listed in Table 1 are provided, e.g., cells comprising an indel or substitution mutation within any of the listed genomic ranges within IFNG.
  • Engineered T cells comprising a genetic modification at genomic coordinates chosen from those listed in Table 2 are also provided, e.g., cells comprising an indel or substitution mutation within any of the listed genomic ranges within TNFA.
  • the engineered T cell will comprise a modification within a genomic coordinate region chosen from Table 1 and a modification with a genomic coordinate region chosen from Table 2.
  • the guide RNAs disclosed herein comprise a guide sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 1 or Table 2. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 1 or Table 2.
  • the guide RNAs disclosed herein comprise a guide sequence having at least 15, 16, 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group consisting of a sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 1. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence at least 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group of sequences in Table 1. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 1.
  • the guide RNAs disclosed herein comprise a guide sequence that is 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group of sequences in Table 1. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is selected from the group of sequences in Table 1. [0093] In some embodiments, the guide RNAs disclosed herein comprise a guide sequence having at least 15, 16, 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group consisting of a sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 2.
  • the guide RNAs disclosed herein comprise a guide sequence at least 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group of sequences in Table 2. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is 95%, 90%, 85%, 80%, or 75% identical to a sequence selected from the group of sequences in Table 2. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is 17, 18, 19, or 20 contiguous nucleotides of a sequence selected from the group of sequences in Table 2. In some embodiments, the guide RNAs disclosed herein comprise a guide sequence that is selected from the group of sequences in Table 2.
  • Genomic coordinates throughout are according to human reference genome hg38 unless otherwise noted.
  • a guide RNA comprising a guide sequence targeting IFNG and a guide RNA comprising a guide sequence targeting TNFA are included.
  • Table 1 Human guide sequences and chromosomal coordinates for knockdown of IFNG
  • Table 2 Human guide sequences and chromosomal coordinates for knockdown of
  • a non-limiting modified guide sequence for knockdown of TNFA is shown below (hg38 coordinates chrl2:68158001-68158021): mC*mC*mA*GAGCAUCCAAAAGAGUGGUUUUAGAmGmCmUmAmGmAmAmU mAmGmCAAGUUAAAAUAAGGCUAGUCCGUUAUCAmAmCmUmUmGmAmAmAm AmAmGmUmGmGmCmAmCmGmAmGmUmCmGmGmUmGmGmCmU*mU*mU*mU (SEQ ID NO: 119), wherein m is a 2’-OMe modified nucleotide/ nucleoside residue, * is indicative of a phosphorothioate linkage between the residues, a capital letter indicates a residue, preferably comprising a ribose sugar.
  • a non-limiting modified guide sequence for knockdown of IFNG is shown below (hg38 coordinates chr6:31576805-31576825): mA*mG*mA*GCUCUUACCUACAACAUGUUUUAGAmGmCmUmAmGmAmAmAmU mAmGmCAAGUUAAAAUAAGGCUAGUCCGUUAUCAmAmCmUmUmGmAmAmAm AmAmGmUmGmGmCmAmCmGmAmGmUmCmGmGmUmGmGmCmU*mU*mU*mU*mU (SEQ ID NO: 120).
  • T cells engineered by introducing or inserting a heterologous IL 10 nucleic acid within a genomic locus of a T cell or a population of T cells using a guide RNA with an RNA-guided DNA binding agent, and a construct (e.g., donor construct or template) comprising a heterologous IL 10 nucleic acid, e.g., to make an engineered T cell.
  • a construct e.g., donor construct or template
  • T cells engineered by expressing a heterologous IL 10 from a genomic locus of a T cell or a population of T cells e.g., using a guide RNA with an RNA-guided DNA-binding agent and a construct (e.g., donor) comprising a heterologous IL10 nucleic acid.
  • T cells engineered by inducing a break (e.g., double-stranded break (DSB) or single-stranded break (nick)) within the genome of a T cell or a population of T cells for inserting the IL10 gene, e.g., using a guide RNA with an RNA-guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • a break e.g., double-stranded break (DSB) or single-stranded break (nick)
  • a break e.g., double-stranded break (DSB) or single-stranded break (nick)
  • a break e.g., double-stranded break (DSB) or single-stranded break (nick)
  • a break e.g., double-stranded break (DSB) or single-stranded break (nick)
  • a guide RNA with an RNA-guided DNA-binding agent e.g., a
  • T cells engineered by introducing or inserting a heterologous CTLA4 nucleic acid within a genomic locus of a T cell or a population of T cells using a guide RNA with an RNA-guided DNA binding agent, and a construct (e.g., donor construct or template) comprising a heterologous CTLA4 nucleic acid, e.g., to make an engineered T cell.
  • a construct e.g., donor construct or template
  • T cells engineered by expressing a heterologous CTLA4 from the genomic locus of a T cell or a population of T cells e.g., using a guide RNA with an RNA-guided DNA-binding agent and a construct (e.g., donor) comprising a heterologous CTLA4 nucleic acid.
  • T cells engineered by inducing a break (e.g., doublestranded break (DSB) or single-stranded break (nick)) within the genome of a T cell or a population of T cells for inserting the CTLA4 gene, e.g., using a guide RNA with an RNA- guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • a break e.g., doublestranded break (DSB) or single-stranded break (nick)
  • a guide RNA with an RNA- guided DNA-binding agent e.g., a CRISPR/Cas system.
  • T cells engineered by introducing or inserting a heterologous CTLA4 nucleic acid and a heterologous IL 10 nucleic acid within a genomic locus of a T cell or a population of T cells using a guide RNA with an RNA- guided DNA binding agent, and one or more constructs (e.g., donor construct or template) comprising a heterologous CTLA4 nucleic acid and a heterologous IL 10 nucleic acid, e.g., to make an engineered T cell.
  • constructs e.g., donor construct or template
  • T cells engineered by expressing a heterologous CTLA4 and a heterologous IL 10 from the genomic locus of a T cell or a population of T cells e.g., using a guide RNA with an RNA-guided DNA-binding agent and one or more constructs (e.g., donor construct or template) comprising a heterologous CTLA4 nucleic acid and a heterologous IL 10 nucleic acid.
  • constructs e.g., donor construct or template
  • T cells engineered by inducing a break (e.g., doublestranded break (DSB) or single-stranded break (nick)) within the genome of a T cell or a population of T cells for inserting the CTLA4 gene and the IL 10 gene, e.g., using a guide RNA with an RNA-guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • a break e.g., doublestranded break (DSB) or single-stranded break (nick)
  • a guide RNA with an RNA-guided DNA-binding agent e.g., a CRISPR/Cas system.
  • the guide RNAs mediate a target-specific cutting by an RNA-guided DNA- binding agent (e.g, Cas nuclease) at a site described herein for insertion of sequence(s) encoding two or more regulatory T cell promoting molecule, e.g., IL10 and CTLA4.
  • an RNA-guided DNA- binding agent e.g, Cas nuclease
  • the guide RNAs comprise guide sequences that bind to, or are capable of binding to, said regions. Cells and cell populations made by the methods are also provided.
  • nucleotide and polypeptide sequences of regulatory T cell promoting molecules are provided below. Methods for identifying alternate nucleotide sequences encoding polypeptide sequences, including alternate naturally occurring variants and non-human homologues, are known in the art. Exemplary nucleic acid sequences encoding IL 10 and CTLA4 are provided below. Other suitable IL 10 and CTLA4 sequences are known in the art.
  • Sequences with at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any of the nucleic acid sequences, amino acid sequences, or nucleic acid sequences encoding the amino acid sequences described herein, e.g., due to mutations or truncations, are also contemplated.
  • a nucleic acid sequence encoding any of the amino acid sequences provided herein is also provided.
  • Non-limiting exemplary nucleic acid sequences encoding IL 10 are provided: Wild-type IL10: ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAGGGCCA GCCCAGGCCAGGGCACCCAGTCTGAGAACAGCTGCACCCACTTCCCAGGCAACC TGCCTAACATGCTTCGAGATCTCCGAGATGCCTTCAGCAGAGTGAAGACTTTCTT TCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAGTCCTTGCTGGAGGA CTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTG GAGGAGGTGATGCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTG AACTCCCTGGGGGAGAACCTGAAGACCCTCAGGCTGAGGCTACGGCGCTGTCAT CGATTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAGCAGGTGAAGAATGCC
  • Non-limiting exemplary amino acid sequences of IL10 are provided:
  • Non-limiting exemplary nucleic acid sequences encoding CTLA4 are provided:
  • CTLA4 (Binding domain: A29H): ATGGCCTGCTTGGGCTTCCAAAGGCATAAAGCCCAGCTTAATCTTGCTACTCGCA
  • Non-limiting exemplary amino acid sequences of CTLA4 are provided:
  • CTLA4 (belatacept; Binding domain: A29Y, L104E): MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFV CEYASPGKYTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVN LTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQIYVIDPEPCPDSDFLLWILAAVSS GLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (SEQ ID NO: 131)
  • CTLA4 (Binding domain: A29H): MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFV CEYASPGKHTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVN LTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSS GLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (SEQ ID NO: 132)
  • CTLA4 (Binding domain: K28H, A29H): MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFV CEYASPGHHTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVN LTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSS GLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN (SEQ ID NO: 133)
  • the engineered T cells or population of T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, exhibits at least one suppressive activity of a naturally occurring regulatory T cell (nTreg), e.g., suppression of an immune response(s) or biomarker in an in vitro or in vivo assay, e.g., an animal model of GvHD.
  • nTreg naturally occurring regulatory T cell
  • the engineered T cells or population of T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, exhibits improved suppressive activity as compared to a nTreg, e.g., increased suppression of an immune response or biomarker in an in vitro or in vivo assay, e.g., an animal model of GvHD.
  • mice receiving the engineered T cell comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA , and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence exhibit improved survival compared to a control, e.g., mice receiving PBMC.
  • the engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, further comprise insertion into the cell of heterologous sequence(s) encoding a targeting receptor.
  • the sequence(s) encoding the targeting receptor is under the control of a promoter sequence, e.g., an endogenous promoter or a heterologous promoter.
  • the targeting receptor is a chimeric antigen receptor (CAR), a T-cell receptor (TCR), or a receptor for a cell surface molecule operably linked through at least a transmembrane domain in an internal signaling domain capable of activating a T cell upon binding of the extracellular receptor portion.
  • the targeting receptor may be a receptor present on the surface of a cell, e.g., a T cell, to permit binding of the cell to a target site, e.g., a specific cell or tissue in an organism.
  • the targeting receptor need not be an antigen receptor, e.g., the targeting receptor may be an RGD peptide that is capable of targeting an integrin.
  • the targeting receptor targets a molecule selected from the group consisting of MAdCAM-1, TNFA, CEACAM6, VCAM-1, citrullinated vimentin, myelin basic protein (MBP), MOG (myelin oligodendrocyte glycoprotein), proteolipid protein 1 (PLP1), CD 19 molecule (CD 19), CD20 molecule (CD20), TNFRSF17, dipeptidyl peptidase like 6 (DPP6), solute carrier family 2 member 2 (SCL2A2), glutamate decarboxylase (GAD2), demoglein 3 (DSG3), and MHC class I HLA- A (HLA-A*02).
  • the engineered T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule selected from IL 10, CTLA4, TGFB1, IDO1, ENTPD1, NT5E, IL22, AREG, IL35, GARP, CD274, FOXP3, IKZF2, EOS, IRF4, LEF1, and BACH2, and insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • a targeting receptor e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • the engineered T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding IL 10, and insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • a targeting receptor e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • the engineered T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding CTLA4, and insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • a targeting receptor e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • the engineered T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding IL 10, insertion of sequence(s) encoding CTLA4, and insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • a targeting receptor e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • the sequence(s) encoding the targeting receptor is incorporated into an expression construct.
  • the expression construct comprising the sequence(s) encoding the targeting receptor further comprises sequence(s) encoding a regulatory T cell promoting molecule, e.g., the sequence(s) encoding the targeting receptor and the sequence(s) encoding the regulatory T cell promoting molecule are incorporated into the same expression construct.
  • the expression construct comprising the sequence(s) encoding the targeting receptor does not further comprise sequence(s) encoding a regulatory T cell promoting molecule, e.g., the sequence(s) encoding the regulatory T cell promoting molecule are incorporated into a separate expression construct.
  • the expression construct comprising the sequence(s) encoding the targeting receptor is an episomal expression construct.
  • the sequence(s) encoding the targeting receptor is inserted into the genome, e.g., a targeted or an untargeted insertion.
  • the sequence(s) encoding the targeting receptor may be inserted into a site selected from a TCR gene locus, e.g., TRAC locus, a TNF gene locus, an IFNG gene locus, IL17A locus, a IL6 locus, an IL2 locus, or an adeno-associated virus integration site 1 (AAVS1) locus.
  • a TCR gene locus e.g., TRAC locus, a TNF gene locus, an IFNG gene locus, IL17A locus, a IL6 locus, an IL2 locus, or an adeno-associated virus integration site 1 (AAVS1) locus.
  • the engineered T cells comprise an insertion of sequence(s) encoding a targeting receptor by gene editing, e.g., as assessed by sequencing, e.g., NGS.
  • a population of T cells comprises T cells that are engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNF A, insertion of sequences encoding a regulatory T cell promoting molecule, and insertion of sequence(s) encoding a targeting receptor, e.g., a CAR.
  • At least 40%, 45%, preferably at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise insertion of sequence(s) encoding the targeting receptor, e.g., as assessed by sequencing, e.g., NGS. It is understood that a T cell population can be enriched for a population of cells having a targeting receptor using selection methods known in the art.
  • a targeting receptor e.g., a CAR
  • nucleic acid e.g., to make an engineered T cell.
  • T cells engineered by expressing a targeting receptor, e.g., a CAR, from the genomic locus of a T cell or a population of T cells e.g., using a guide RNA with an RNA-guided DNA-binding agent and a construct (e.g., donor) comprising a targeting receptor, e.g., a CAR, nucleic acid.
  • a targeting receptor e.g., a CAR
  • T cells engineered by inducing a break (e.g., double-stranded break (DSB) or single-stranded break (nick)) within the genome of a T cell or a population of T cells for inserting the targeting receptor, e.g., a CAR, e.g., using a guide RNA with an RNA-guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • a break e.g., double-stranded break (DSB) or single-stranded break (nick)
  • a CAR e.g., a CAR
  • a guide RNA with an RNA-guided DNA-binding agent e.g., a CRISPR/Cas system
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of conferring target specificity to the engineered T cell comprising the targeting receptor, e.g., a CAR, e.g., to particular cells, tissues, or organs.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to the gastrointestinal system, e.g., the targeting receptor is a CAR targeting MAdCAM-1, e.g., for suppressing immune responses in disorders such as inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to an inflammatory tissue, e.g., the targeting receptor is a CAR targeting TNFA, e.g., for suppressing immune responses in disorders such as inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to endothelial cells, e.g., the targeting receptor is a CAR targeting CEACAM6, e.g., for suppressing immune response(s), including inflammation, in disorders such as Crohn’s disease.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to tissues comprising endothelial cells, e.g., the targeting receptor is a CAR targeting VCAM-1, e.g., for suppressing immune responses in disorders such as Crohn’s disease and multiple sclerosis.
  • the CAR is capable of targeting engineered T cells to synovial tissue, e.g., the targeting receptor is a CAR targeting citrullinated vimentin e.g., for suppressing immune responses in disorders such as rheumatoid arthritis.
  • the targeting receptor e.g., a CAR
  • a CAR is capable of targeting engineered T cells to a neurological tissue, e.g., the targeting receptor is a CAR targeting MBP, MOG, or PLP1, e.g., for suppressing immune responses in disorders such as multiple sclerosis.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to B cells, e.g., the targeting receptor is a CAR targeting CD 19, e.g., for suppressing immune responses in disorders such as multiple sclerosis and systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to B cells
  • the targeting receptor is a CAR targeting CD20, e.g., for suppressing immune responses in disorders such as multiple sclerosis and systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to tissues comprising mature B lymphocytes, e.g., the targeting receptor is a CAR targeting TNFRSF17, e.g., for suppressing immune responses in disorders such as systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • SCL2A2 targets DPP6.
  • the targeting receptor e.g., a CAR
  • GAD2 targets GAD2.
  • the targeting receptor e.g., a CAR
  • DSG3 targets MHC class I HLA-A (HLA-A*02).
  • CAR targets e.g., inflammatory antigens
  • W02020092057A1 the contents of which are incorporated herein in their entirety.
  • the insertion can be assessed by detecting the amount of protein or mRNA in an engineered T cell, population of engineered T cells, tissue, body fluid of interest, or tissue culture media comprising the engineered T cells.
  • the insertion by gene editing can be assessed by sequence, e.g., next generation sequencing (NGS).
  • NGS next generation sequencing
  • Assays for protein and mRNA expression of the targeting receptor, e.g., a CAR are described herein and known in the art.
  • the engineered T cells or population of T cells do not include a heterologous targeting receptor.
  • TCR T Cell Receptor
  • the engineered T cells or population of T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, further comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding TCR gene sequence(s).
  • the engineered T cells or population of T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence, insertion into the cell of heterologous sequence(s) encoding a targeting receptor, further comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding TCR gene sequence(s).
  • a TCR is a heterodimer receptor molecule that contains two TCR polypeptide chains, a and p. Suitable a and P genomic sequences or loci to target for knockdown are known in the art.
  • the engineered T cells comprise a modification, e.g., knockdown, of a TCR a-chain gene sequence, e.g., TRAC. See, e.g., NCBI Gene ID: 28755; Ensembl: ENSG00000277734 (T-cell receptor Alpha Constant), US 2018/0362975, and W02020081613.
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule selected from IL10, CTLA4, TGFB1, IDO1, ENTPD1, NT5E, IL22, AREG, IL35, GARP, CD274, FOXP3, IKZF2, EOS, IRF4, LEF1, and BACH2, and a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding TCR gene sequence(s).
  • a modification e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG
  • a modification e.g., knockdown, of an endogenous nucleic acid sequence encoding a TN
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding IL10 or CTLA4, and a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding TCR gene sequence(s).
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, and a modification, e.g., knockdown, of an endogenous TCR gene sequence, e.g., TRAC gene sequence.
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA,
  • IL10 CTLA4, TGFB1, IDO1, ENTPD1, NT5E, IL22, AREG, IL35, GARP, CD274, FOXP3, IKZF2, EOS, IRF4, LEF1, and BACH2, and a modification, e.g., knockdown, of an endogenous TCR gene, e.g., a TRAC gene sequence.
  • a modification e.g., knockdown, of an endogenous TCR gene, e.g., a TRAC gene sequence.
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding IL10 or CTLA4, and a modification, e.g., knockdown, of a TCR gene, e.g., a TRAC gene sequence.
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, and a modification, e.g., knockdown, of an endogenous TCR gene, e.g., a TRAC gene sequence.
  • the engineered T cells or population of T cells may further comprise insertion of sequence(s) encoding a targeting receptor as described herein, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • a targeting receptor as described herein, e.g., a CAR, e.g., a CAR targeting MAdCAM-1.
  • the engineered T cells or population of T cells comprise a modification, e.g., knockdown, of a TRC gene sequence by gene editing, e.g., as assessed by sequencing, e.g., NGS, wherein at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, or 95% of cells comprise an insertion, deletion, or substitution in the endogenous TRC gene sequence.
  • TRC is decreased by at least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, 95%, or to below the limit of detection of the assay as compared to a suitable control, e.g., wherein the TRC gene has not been modified.
  • Assays for TRC protein and mRNA expression are known in the art.
  • the engineered T cells or population of T cells comprise an insertion of sequence(s) encoding a targeting receptor by gene editing, e.g., as assessed by sequencing, e.g., NGS.
  • a population of T cells comprises T cells that are engineered to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequences encoding a regulatory T cell promoting molecule, and a modification, e.g., knockdown, of at least one TCR gene sequence.
  • a modification e.g., knockdown
  • At least 50%, 55%, 60%, 65%, preferably at least 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered to comprise a modification, e.g., knockdown, of at least one TCR gene sequence, e.g., as assessed by sequencing, e.g., NGS.
  • guide RNAs that specifically target sites within the TCR genes e.g., TRAC gene, are used to provide a modification, e.g., knockdown, of the TCR genes.
  • the TCR gene is modified, e.g., knocked down, in a T cell using a guide RNA with an RNA-guided DNA binding agent.
  • T cells engineered by inducing a break (e.g., double-stranded break (DSB) or single-stranded break (nick)) within the TCR genes of a T cell, e.g., using a guide RNA with an RNA-guided DNA-binding agent (e.g., a CRISPR/Cas system).
  • the methods may be used in vitro or ex vivo, e.g., in the manufacture of cell products for suppressing immune response.
  • the guide RNAs mediate a target-specific cutting by an RNA-guided DNA-binding agent (e.g., Cas nuclease) at a site described herein within a TCR gene.
  • an RNA-guided DNA-binding agent e.g., Cas nuclease
  • the guide RNAs comprise guide sequences that bind to, or are capable of binding to, said regions.
  • the guide RNA may further comprise a trRNA.
  • the crRNA and trRNA may be associated as a single RNA (sgRNA) or may be on separate RNAs (dgRNA).
  • the crRNA and trRNA components may be covalently linked, e.g., via a phosphodiester bond or other covalent bond.
  • the sgRNA comprises one or more linkages between nucleotides that is not a phosphodiester linkage.
  • the guide RNA may comprise two RNA molecules as a “dual guide RNA” or “dgRNA.”
  • the dgRNA comprises a first RNA molecule comprising a crRNA comprising, e.g., a guide sequence shown herein, and a second RNA molecule comprising a trRNA.
  • the first and second RNA molecules may not be covalently linked, but may form an RNA duplex via the base pairing between portions of the crRNA and the trRNA.
  • the guide RNA may comprise a single RNA molecule as a “single guide RNA” or “sgRNA.”
  • the sgRNA may comprise a crRNA (or a portion thereof) comprising a guide sequence shown herein covalently linked to a trRNA.
  • the sgRNA may comprise 15, 16, 17, 18, 19, or 20 contiguous nucleotides of a guide sequence shown herein.
  • the crRNA and the trRNA are covalently linked via a linker.
  • the sgRNA forms a stem-loop structure via the base pairing between portions of the crRNA and the trRNA.
  • the crRNA and the trRNA are covalently linked via one or more bonds that are not a phosphodiester bond.
  • the trRNA may comprise all or a portion of a trRNA sequence derived from a naturally-occurring CRISPR/Cas system.
  • the trRNA comprises a truncated or modified wild-type trRNA.
  • the length of the trRNA depends on the CRISPR/Cas system used.
  • the trRNA comprises or consists of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, or more than 100 nucleotides.
  • the trRNA may comprise certain secondary structures, such as, for example, one or more hairpin or stem-loop structures, or one or more bulge structures.
  • the target sequence or region may be complementary to the guide sequence of the guide RNA.
  • the degree of complementarity or identity between a guide sequence of a guide RNA and its corresponding target sequence may be 75%, 80%, 85%, 90%, 95%, or 100%.
  • the target sequence and the guide sequence of the gRNA may be 100% complementary or identical.
  • the target sequence and the guide sequence of the gRNA may contain one mismatch.
  • the target sequence and the guide sequence of the gRNA may contain 1, 2, 3, 4, or 5 mismatches, where the total length of the guide sequence is about 20, or 20.
  • the target sequence and the guide sequence of the gRNA may contain 1-4 mismatches where the guide sequence is about 20, or 20 nucleotides.
  • each of the guide sequences herein may further comprise additional nucleotides to form a crRNA or guide RNA, e.g., with the following exemplary nucleotide sequence following the guide sequence at its 3’ end: GUUUUAGAGCUAUGCUGUUUUG (SEQ ID NO: 134) in 5’ to 3’ orientation.
  • the above guide sequences may further comprise additional nucleotides to form a sgRNA, e.g., with the following exemplary nucleotide sequence following the 3’ end of the guide sequence: GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUU GAAAAAGUGGCACCGAGUCGGUGCUUUU (SEQ ID NO: 135) or GUUUUAGAGCUAGAAAUAGCAAGUUAAAAUAAGGCUAGUCCGUUAUCAACUU GAAAAAAAGUGGCACCGAGUCGGUGC (SEQ ID NO: 136).
  • the guide RNAs disclosed herein bind to a region upstream of a propospacer adjacent motif (PAM).
  • PAM propospacer adjacent motif
  • the PAM sequence occurs on the strand opposite to the strand that contains the target sequence and varies with the CRISPR/Cas system. That is, the PAM sequence is on the complement strand of the target strand (the strand that contains the target sequence to which the guide RNA binds).
  • the PAM is selected from the group consisting of NGG, NNGRRT, NNGRR(N), NNAGAAW, NNNNG(A/C)TT, and NNNNRYAC.
  • the guide RNA sequences provided herein are complementary to a sequence adjacent to a PAM sequence.
  • the guide RNA sequence comprises a sequence that is complementary to a sequence within a genomic region selected from the tables herein according to coordinates in human reference genome hg38. In some embodiments, the guide RNA sequence comprises a sequence that is complementary to a sequence that comprises 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 consecutive nucleotides from within a genomic region selected from the tables herein. In some embodiments, the guide RNA sequence comprises a sequence that is complementary to a sequence that comprises 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 consecutive nucleotides spanning a genomic region selected from the tables herein.
  • the guide RNAs disclosed herein mediate a target-specific cutting resulting in a double-stranded break (DSB).
  • the guide RNAs disclosed herein mediate a target-specific cutting resulting in a single-stranded break (SSB or nick).
  • the gRNA may be chemically modified.
  • a gRNA comprising one or more modified nucleosides or nucleotides is called a “modified” gRNA or “chemically modified” gRNA, to describe the presence of one or more non- naturally or naturally occurring components or configurations that are used instead of or in addition to the canonical A, G, C, and U residues.
  • a modified gRNA is synthesized with a non-canonical nucleoside or nucleotide, is here called “modified.”
  • Modified nucleosides and nucleotides can include one or more of: (i) alteration, e.g., replacement, of one or both of the non-linking phosphate oxygens or of one or more of the linking phosphate oxygens in the phosphodiester backbone linkage (an exemplary backbone modification); (ii) alteration, e.g., replacement, of a constituent of the ribose sugar, e.g., of the 2' hydroxyl on the ribose sugar (an exemplary sugar modification); (iii) wholesale replacement of the phosphate moiety with “dephospho” linkers (an exemplary backbone modification); (iv) modification or replacement of a naturally occurring nucleobase, including with a non-canonical nucleobase (an exemplary base modification); (v) replacement or modification of the ribos
  • modified gRNAs comprising nucleosides and nucleotides (collectively “residues”) that can have two, three, four, or more modifications.
  • a modified residue can have a modified sugar and a modified nucleobase.
  • every base of a gRNA is modified, e.g., all bases have a modified phosphate group, such as a phosphor othioate group.
  • all, or substantially all, of the phosphate groups of an gRNA molecule are replaced with phosphorothioate groups.
  • modified gRNAs comprise at least one modified residue at or near the 5' end of the RNA.
  • modified gRNAs comprise at least one modified residue at or near the 3' end of the RNA.
  • Certain gRNAs comprise at least one modified residue at or near the 5' end and 3' end of the RNA.
  • the guide RNAs disclosed herein comprise one of the modification patterns disclosed in W02018/107028 the contents of which are hereby incorporated by reference in relevant part.
  • the guide RNAs disclosed herein comprise one of the structures/modification patterns disclosed in US20170114334, which are hereby incorporated by reference.
  • the guide RNAs disclosed herein comprise one of the structures/modification patterns disclosed in WO2017/136794, W02017004279, US2018187186, US2019048338, which are hereby incorporated by reference.
  • a cell or method comprises an mRNA comprising an open reading frame (ORF) encoding an RNA-guided DNA-binding agent, such as a Cas nuclease as described herein.
  • Cas9 ORFs are provided herein and are known in the art.
  • the Cas9 ORF can be codon optimized, such that coding sequence includes one or more alternative codons for one or more amino acids.
  • An “alternative codon” as used herein refers to variations in codon usage for a given amino acid, and may or may not be a preferred or optimized codon (codon optimized) for a given expression system.
  • the modified ORF may comprise a modified uridine at least at one, a plurality of, or all uridine positions.
  • the modified uridine is a uridine modified at the 5 position, e.g., with a halogen, methyl, or ethyl.
  • the modified uridine is a pseudouridine modified at the 1 position, e.g., with a halogen, methyl, or ethyl.
  • the modified uridine can be, for example, pseudouridine, Nl- methyl-pseudouridine, 5-methoxyuridine, 5-iodouridine, or a combination thereof.
  • the modified uridine is 5-methoxyuridine. In some embodiments, the modified uridine is 5-iodouridine. In some embodiments, the modified uridine is pseudouridine. In some embodiments, the modified uridine is Nl-methyl-pseudouridine. In some embodiments, the modified uridine is a combination of pseudouridine and Nl-methyl-pseudouridine. In some embodiments, the modified uridine is a combination of pseudouridine and 5- methoxyuridine. In some embodiments, the modified uridine is a combination of Nl-methyl pseudouridine and 5-methoxyuridine.
  • the modified uridine is a combination of 5-iodouridine and Nl-methyl-pseudouridine. In some embodiments, the modified uridine is a combination of pseudouridine and 5-iodouridine. In some embodiments, the modified uridine is a combination of 5-iodouridine and 5-methoxyuridine.
  • an mRNA disclosed herein comprises a 5’ cap, such as a CapO, Capl, or Cap2.
  • a 5’ cap is generally a 7-methylguanine ribonucleotide (which may be further modified, for example, ARCA (anti-reverse cap analog; Thermo Fisher Scientific Cat. No.
  • AM8045 is a cap analog comprising a 7-methylguanine 3 ’-methoxy-5’ -triphosphate linked to the 5’ position of a guanine ribonucleotide) linked through a 5 ’-triphosphate to the 5’ position of the first nucleotide of the 5’-to-3’ chain of the mRNA, /. ⁇ ., the first cap- proximal nucleotide.
  • the riboses of the first and second cap-proximal nucleotides of the mRNA both comprise a 2’-hydroxyl.
  • the riboses of the first and second transcribed nucleotides of the mRNA comprise a 2’ -methoxy and a 2’ -hydroxyl, respectively. See, e.g., CleanCapTM AG (m7G(5')ppp(5')(2'OMeA)pG; TriLink Biotechnologies Cat. No. N-7113) or CleanCapTM GG (m7G(5')ppp(5')(2'OMeG)pG; TriLink Biotechnologies Cat. No. N-7133).
  • the riboses of the first and second cap-proximal nucleotides of the mRNA both comprise a 2’-methoxy.
  • the mRNA further comprises a poly-adenylated (poly- A) tail.
  • the poly-A tail comprises 20, 30, 40, 50, 60, 70, 80, 90, or 100 adenines (SEQ ID NO: 147), optionally up to 300 adenines (SEQ ID NO: 148).
  • the poly-A tail comprises 95, 96, 97, 98, 99, or 100 adenine nucleotides (SEQ ID NO: 149).
  • the engineered cells provided herein are prepared from a population of cells enriched for CD4+ T cells. Such cells can be readily obtained from fresh leukopak samples, commercially available from various sources including, e.g., StemCell Technologies. CD4+ T cells can be isolated using commercially available kits using routine methods, e.g., by negative selection using the human CD4+ T cell isolation kit. However, methods of preparation of CD4+ T cells from other sources are also known in the art.
  • multipotent cells such as hematopoietic stem cell (HSCs such as those isolated from bone marrow or cord blood), hematopoietic progenitor cells (e.g., lymphoid progenitor cell), or mesenchymal stem cells (MSC) can be used to obtain CD4+ T cells.
  • HSCs hematopoietic stem cell
  • hematopoietic progenitor cells e.g., lymphoid progenitor cell
  • MSC mesenchymal stem cells
  • Multipotent cells are capable of developing into more than one cell type, but are more limited than pluripotent cells in breadth of differentiation.
  • the multipotent cells may be derived from established cell lines or isolated from human bone marrow or umbilical cords.
  • the HSCs may be isolated from a patient or a healthy donor following G-CSF-induced mobilization, plerixafor- induced mobilization, or a combination thereof.
  • the cells in the blood or bone marrow may be panned by antibodies that bind unwanted cells, such as antibodies to CD4 and CD8 (T cells), CD45 (B cells), GR-I (granulocytes), and lad (differentiated antigen-presenting cells) (see, e.g.., Inaba, et al. (1992) J Exp Med. 176: 1693-1702).
  • T cells CD4 and CD8
  • B cells CD45
  • GR-I granulocytes
  • lad differentiated into CD4+ T cells
  • the guide RNA, RNA-guided DNA binding agents (e.g., Cas nuclease), and nucleic acid sequences disclosed herein can be delivered to a cell or population of cells, in vitro or ex vivo, for the production of engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10, CTLA4; and optionally further comprising insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, and optionally further comprising a modification, e.g., knockdown, of TCR sequence(s), using various known and suitable methods available in the art.
  • Non-viral vector delivery systems nucleic acids such as non-viral vectors, plasmid vectors, and, e.g., naked nucleic acid, and nucleic acid complexed with a delivery vehicle such as a liposome, lipid nanoparticle (LNP), or poloxamer.
  • Viral vector delivery systems include DNA and RNA viruses.
  • Methods and compositions for non-viral delivery of nucleic acids include electroporation, lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, LNPs, polycation or lipidmucleic acid conjugates, naked nucleic acid (e.g., naked DNA/RNA), artificial virions, and agent-enhanced uptake of DNA. Sonoporation using, e.g., the Sonitron 2000 system (Rich-Mar) can also be used for delivery of nucleic acids.
  • RNA-guided DNA binding agent e.g., RNA-guided DNA binding agent, and donor construct, singly or in combination
  • RNA-guided DNA binding agent e.g., RNA-guided DNA binding agent, and donor construct, singly or in combination
  • Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood, fluid, or cells including, but not limited to, injection, infusion, topical application and electroporation. Suitable methods of administering such nucleic acids are available and well known to those of skill in the art.
  • the present disclosure provides DNA or RNA vectors encoding any of the compositions disclosed herein e.g., guide RNAs comprising any one or more of the guide sequences described herein, e.g., for modifying (e.g., knocking down) IFNG and TNFA or a donor construct comprising sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL 10, or a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR.
  • the vector also comprises a sequence encoding an RNA-guided DNA binding agent.
  • the invention comprises DNA or RNA vectors encoding any one or more of the compositions described herein, or in any combination.
  • the vectors further comprise, e.g., promoters, enhancers, and regulatory sequences.
  • the vector that comprises a guide RNA comprising any one or more of the guide sequences described herein also comprises one or more nucleotide sequence(s) encoding a crRNA, a trRNA, or a crRNA and trRNA, as disclosed herein.
  • the present disclosure provides DNA or RNA vectors encoding a regulatory T cell promoting molecules and a targeting receptor.
  • Such vectors allow for selection of cells based on the presence of the receptor for cells that also contain a coding sequence for the regulatory T cell promoting molecule. Positive and negative selection methods based on the presence of cell surface molecules are known in the art.
  • the vector comprises a nucleotide sequence encoding a guide RNA described herein.
  • the vector comprises one copy of the guide RNA.
  • the vector comprises more than one copy of the guide RNA.
  • the guide RNAs may be non-identical such that they target different target sequences, or may be identical in that they target the same target sequence.
  • each guide RNA may have other different properties, such as activity or stability within a complex with an RNA-guided DNA nuclease, such as a Cas RNP complex.
  • the nucleotide sequence encoding the guide RNA may be operably linked to at least one transcriptional or translational control sequence, such as a promoter, a 3' UTR, or a 5' UTR.
  • the promoter may be a tRNA promoter, e.g., tRNA Lys3 , or a tRNA chimera. See Mefferd et al., RNA. 2015 21 : 1683-9; Scherer et al., Nucleic Acids Res. 2007 35: 2620-2628.
  • the promoter may be recognized by RNA polymerase III (Pol III).
  • Non-limiting examples of Pol III promoters include U6 and Hl promoters.
  • the nucleotide sequence encoding the guide RNA may be operably linked to a mouse or human U6 promoter. In other embodiments, the nucleotide sequence encoding the guide RNA may be operably linked to a mouse or human Hl promoter. In embodiments with more than one guide RNA, the promoters used to drive expression may be the same or different. In some embodiments, the nucleotide encoding the crRNA of the guide RNA and the nucleotide encoding the trRNA of the guide RNA may be provided on the same vector. In some embodiments, the nucleotide encoding the crRNA and the nucleotide encoding the trRNA may be driven by the same promoter.
  • the crRNA and trRNA may be transcribed into a single transcript.
  • the crRNA and trRNA may be processed from the single transcript to form a double-molecule guide RNA.
  • the crRNA and trRNA may be transcribed into a single-molecule guide RNA (sgRNA).
  • the crRNA and the trRNA may be driven by their corresponding promoters on the same vector.
  • the crRNA and the trRNA may be encoded by different vectors.
  • the nucleotide sequence encoding the guide RNA may be located on the same vector comprising the nucleotide sequence encoding an RNA-guided DNA-binding agent such as a Cas protein.
  • expression of the guide RNA and of the RNA-guided DNA-binding agent such as a Cas protein may be driven by their own corresponding promoters.
  • expression of the guide RNA may be driven by the same promoter that drives expression of the RNA-guided DNA-binding agent such as a Cas protein.
  • the guide RNA and the RNA-guided DNA-binding agent such as a Cas protein transcript may be contained within a single transcript.
  • the guide RNA may be within an untranslated region (UTR) of the RNA-guided DNA-binding agent such as a Cas protein transcript.
  • the guide RNA may be within the 5' UTR of the transcript.
  • the guide RNA may be within the 3' UTR of the transcript.
  • the intracellular half-life of the transcript may be reduced by containing the guide RNA within its 3' UTR and thereby shortening the length of its 3' UTR.
  • the guide RNA may be within an intron of the transcript.
  • suitable splice sites may be added at the intron within which the guide RNA is located such that the guide RNA is properly spliced out of the transcript.
  • expression of the RNA-guided DNA-binding agent such as a Cas protein and the guide RNA from the same vector in close temporal proximity may facilitate more efficient formation of the CRISPR RNP complex.
  • the nucleotide sequence encoding the guide RNA or RNA-guided DNA-binding agent may be located on the same vector comprising the construct that comprises the sequence encoding the regulatory T cell promoting molecule, e.g., IL 10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR.
  • the regulatory T cell promoting molecule e.g., IL 10, CTLA4
  • targeting receptor e.g., a CAR, e.g., a MAdCAM-1 CAR.
  • proximity of the construct comprising the sequence encoding the regulatory T cell promoting molecule, e.g., IL10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR and the guide RNA (or the RNA-guided DNA binding agent) on the same vector may facilitate more efficient insertion of the construct into a site of insertion created by the guide RNA/RNA-guided DNA binding agent.
  • DNA and RNA vectors can include more than one open reading frame for expression under a single promoter, either present in the vector or at the genomic insertion site.
  • a coding sequence for a self-cleaving peptide can be included between the open reading frames.
  • the self-cleaving peptide may be, for example, a 2A peptide, for example, a P2A peptide, an E2A peptide, a F2A peptide, or a T2A peptide.
  • the vector comprises one or more nucleotide sequence(s) encoding a sgRNA and an mRNA encoding an RNA-guided DNA binding agent, which can be a Cas protein, such as Cas9 or Cpf 1.
  • the vector comprises one or more nucleotide sequence(s) encoding a crRNA, a trRNA, and an mRNA encoding an RNA-guided DNA binding agent, which can be a Cas protein, such as, Cas9 or Cpfl.
  • the Cas9 is from Streptococcus pyogenes (i.e., Spy Cas9).
  • the nucleotide sequence encoding the crRNA, trRNA, or crRNA and trRNA (which may be a sgRNA) comprises or consists of a guide sequence flanked by all or a portion of a repeat sequence from a naturally-occurring CRISPR/Cas system.
  • the nucleic acid comprising or consisting of the crRNA, trRNA, or crRNA and trRNA may further comprise a vector sequence wherein the vector sequence comprises or consists of nucleic acids that are not naturally found together with the crRNA, trRNA, or crRNA and trRNA.
  • the crRNA and the trRNA are encoded by noncontiguous nucleic acids within one vector. In other embodiments, the crRNA and the trRNA may be encoded by a contiguous nucleic acid. In some embodiments, the crRNA and the trRNA are encoded by opposite strands of a single nucleic acid. In other embodiments, the crRNA and the trRNA are encoded by the same strand of a single nucleic acid.
  • the vector comprises a donor construct comprising a sequence that encodes the regulatory T cell promoting molecule, e.g., IL 10, or targeting receptor, e.g., a CAR, e.g., MAdCAM-1, as disclosed herein.
  • the vector may further comprise nucleic acids that encode the guide RNAs described herein or nucleic acid encoding an RNA-guided DNA-binding agent e.g., a Cas nuclease such as Cas9).
  • a nucleic acid encoding an RNA-guided DNA-binding agent are each or both on a separate vector from a vector that comprises the donor construct disclosed herein.
  • the vector may include other sequences that include, but are not limited to, promoters, enhancers, regulatory sequences, as described herein.
  • the promoter does not drive the expression of the regulatory T cell promoting molecule, e.g., IL 10, or targeting receptor, e.g., a CAR, e.g., MAdCAM-1, of the donor construct.
  • the vector comprises one or more nucleotide sequence(s) encoding a crRNA, a trRNA, or a crRNA and trRNA. In some embodiments, the vector comprises one or more nucleotide sequence(s) encoding a sgRNA and an mRNA encoding an RNA-guided DNA nuclease, which can be a Cas nuclease (e.g., Cas9).
  • a Cas nuclease e.g., Cas9
  • the vector comprises one or more nucleotide sequence(s) encoding a crRNA, a trRNA, and an mRNA encoding an RNA-guided DNA nuclease, which can be a Cas nuclease, such as, Cas9.
  • the Cas9 is from Streptococcus pyogenes (i.e., Spy Cas9).
  • the nucleotide sequence encoding the crRNA, trRNA, or crRNA and trRNA (which may be a sgRNA) comprises or consists of a guide sequence flanked by all or a portion of a repeat sequence from a naturally-occurring CRISPR/Cas system.
  • the nucleic acid comprising or consisting of the crRNA, trRNA, or crRNA and trRNA may further comprise a vector sequence wherein the vector sequence comprises or consists of nucleic acids that are not naturally found together with the crRNA, trRNA, or crRNA and trRNA.
  • the vector may be circular. In other embodiments, the vector may be linear. In some embodiments, the vector may be enclosed in a lipid nanoparticle, liposome, non-lipid nanoparticle, or viral capsid.
  • Non-limiting exemplary vectors include plasmids, phagemids, cosmids, artificial chromosomes, minichromosomes, transposons, viral vectors, and expression vectors.
  • the vector may be a viral vector.
  • the viral vector may be genetically modified from its wild-type counterpart.
  • the viral vector may comprise an insertion, deletion, or substitution of one or more nucleotides to facilitate cloning or such that one or more properties of the vector is changed.
  • properties may include packaging capacity, transduction efficiency, immunogenicity, genome integration, replication, transcription, and translation.
  • a portion of the viral genome may be deleted such that the virus is capable of packaging exogenous sequences having a larger size.
  • the viral vector may have an enhanced transduction efficiency.
  • the immune response induced by the virus in a may be reduced.
  • viral genes that promote integration of the viral sequence into a genome may be mutated such that the virus becomes non-integrating.
  • the viral vector may be replication defective.
  • the viral vector may comprise exogenous transcriptional or translational control sequences to drive expression of coding sequences on the vector.
  • the virus may be helper-dependent. For example, the virus may need one or more helper virus to supply viral components (such as, e.g, viral proteins) required to amplify and package the vectors into viral particles.
  • helper components including one or more vectors encoding the viral components
  • the virus may be helper-free.
  • the virus may be capable of amplifying and packaging the vectors without a helper virus.
  • the vector system described herein may also encode the viral components required for virus amplification and packaging.
  • Non-limiting exemplary viral vectors include adeno-associated virus (AAV) vector, lentivirus vectors, adenovirus vectors, helper dependent adenoviral vectors (HD Ad), herpes simplex virus (HSV-1) vectors, bacteriophage T4, baculovirus vectors, and retrovirus vectors.
  • AAV adeno-associated virus
  • lentivirus vectors lentivirus vectors
  • adenovirus vectors lentivirus vectors
  • adenovirus vectors lentivirus vectors
  • adenovirus vectors adenovirus vectors
  • helper dependent adenoviral vectors HD Ad
  • HSV-1 herpes simplex virus
  • bacteriophage T4 bacteriophage T4
  • baculovirus vectors baculovirus vectors
  • retrovirus vectors retrovirus vectors.
  • the viral vector may be an AAV vector.
  • the viral vector may a lentivirus vector.
  • AAV refers all serotypes, subtypes, and naturally- occurring AAV as well as recombinant AAV.
  • AAV may be used to refer to the virus itself or a derivative thereof.
  • the term “AAV” includes AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAVrh.64Rl, AAVhu.37, AAVrh.8, AAVrh.32.33, AAV8, AAV9, AAV-DJ, AAV2/8, AAVrhlO, AAVLK03, AV10, AAV11, AAV12, rhlO, and hybrids thereof, avian AAV, bovine AAV, canine AAV, equine AAV, primate AAV, nonprimate AAV, and ovine AAV.
  • a “AAV vector” as used herein refers to an AAV vector comprising a heterologous sequence not of AAV origin (/. ⁇ ., a nucleic acid sequence heterologous to AAV), typically comprising a sequence encoding a heterologous polypeptide of interest.
  • the construct may comprise an AAV1, AAV2, AAV3, AAV3B, AAV4, AAV5, AAV6, AAV6.2, AAV7, AAVrh.64Rl, AAVhu.37, AAVrh.8, AAVrh.32.33, AAV8, AAV9, AAV-DJ, AAV2/8, AAVrhlO, AAVLK03, AV10, AAV11, AAV12, rhlO, and hybrids thereof, avian AAV, bovine AAV, canine AAV, equine AAV, primate AAV, nonprimate AAV, and ovine AAV capsid sequence.
  • heterologous nucleic acid sequence (the transgene) is flanked by at least one, and generally by two, AAV inverted terminal repeat sequences (ITRs).
  • An AAV vector may either be single-stranded (ssAAV) or self-complementary (sc AAV).
  • the lentivirus may be integrating. In some embodiments, the lentivirus may be non-integrating.
  • the viral vector may be an adenovirus vector.
  • the adenovirus may be a high-cloning capacity or “gutless” adenovirus, where all coding viral regions apart from the 5' and 3' inverted terminal repeats (ITRs) and the packaging signal (T) are deleted from the virus to increase its packaging capacity.
  • the viral vector may be an HSV-1 vector. In some embodiments, the HSV-1 -based vector is helper dependent, and in other embodiments it is helper independent.
  • the viral vector may be bacteriophage T4.
  • the bacteriophage T4 may be able to package any linear or circular DNA or RNA molecules when the head of the virus is emptied.
  • the viral vector may be a baculovirus vector.
  • the viral vector may be a retrovirus vector.
  • one AAV vector may contain sequences encoding an RNA-guided DNA-binding agent such as a Cas protein (e.g., Cas9), while a second AAV vector may contain one or more guide sequences.
  • a Cas protein e.g., Cas9
  • the vector system may be capable of driving expression of one or more nuclease components in a cell.
  • the vector does not comprise a promoter that drives expression of one or more coding sequences once it is integrated in a cell (e.g., uses the cell’s endogenous promoter such as when inserted at specific genomic loci of the cell, as exemplified herein).
  • Suitable promoters to drive expression in different types of cells, e.g., CD4+ T cells are known in the art.
  • the promoter may be wild-type.
  • the promoter may be modified for more efficient or efficacious expression.
  • the promoter may be truncated yet retain its function.
  • the promoter may have a normal size or a reduced size that is suitable for proper packaging of the vector into a virus.
  • the vector may comprise a nucleotide sequence encoding an RNA-guided DNA-binding agent such as a Cas protein (e.g, Cas9) described herein.
  • the nuclease encoded by the vector may be a Cas protein.
  • the vector system may comprise one copy of the nucleotide sequence encoding the nuclease. In other embodiments, the vector system may comprise more than one copy of the nucleotide sequence encoding the nuclease.
  • the nucleotide sequence encoding the nuclease may be operably linked to at least one transcriptional or translational control sequence.
  • the nucleotide sequence encoding the nuclease may be operably linked to at least one promoter.
  • the vector may comprise any one or more of the constructs comprising a sequence encoding the regulatory T cell promoting molecule, e.g., IL10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, as described herein.
  • the sequence of the regulatory T cell promoting molecule, e.g., IL10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR may be operably linked to at least one transcriptional or translational control sequence.
  • the sequence of the regulatory T cell promoting molecule, e.g., IL10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR may be operably linked to at least one promoter.
  • the sequence of the regulatory T cell promoting molecule, e.g., IL 10, CTLA4; or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, is not linked to a promoter that drives the expression of the heterologous gene.
  • the promoter may be constitutive, inducible, or tissuespecific. In some embodiments, the promoter may be a constitutive promoter.
  • Non-limiting exemplary constitutive promoters include cytomegalovirus immediate early promoter (CMV), simian virus (SV40) promoter, adenovirus major late (MLP) promoter, Rous sarcoma virus (RS V) promoter, mouse mammary tumor virus (MMTV) promoter, phosphoglycerate kinase (PGK) promoter, elongation factor-alpha (EFla) promoter, ubiquitin promoters, actin promoters, tubulin promoters, immunoglobulin promoters, a functional fragment thereof, or a combination of any of the foregoing.
  • CMV cytomegalovirus immediate early promoter
  • MLP adenovirus major late
  • RS V Rous sarcoma virus
  • MMTV mouse mammary tumor virus
  • PGK phosphoglycerate
  • the promoter may be a CMV promoter. In some embodiments, the promoter may be a truncated CMV promoter. In other embodiments, the promoter may be an EFla promoter. In some embodiments, the promoter may be an inducible promoter. Non-limiting exemplary inducible promoters include those inducible by heat shock, light, chemicals, peptides, metals, steroids, antibiotics, or alcohol. In some embodiments, the inducible promoter may be one that has a low basal (non-induced) expression level, such as, e.g., the Tet-On® promoter (Clontech).
  • the promoter may be a tissue-specific promoter, e.g., a promoter specific for expression in a T cell.
  • the compositions comprise a vector system.
  • the vector system may comprise one single vector.
  • the vector system may comprise two vectors.
  • the vector system may comprise three vectors.
  • the vector system may comprise inducible promoters to start expression only after it is delivered to a target cell.
  • Non-limiting exemplary inducible promoters include those inducible by heat shock, light, chemicals, peptides, metals, steroids, antibiotics, or alcohol.
  • the inducible promoter may be one that has a low basal (non-induced) expression level, such as, e.g., the Tet-On® promoter (Clontech).
  • the vector system may comprise tissue-specific promoters.
  • Non-limiting exemplary viral vector sequences are provided below: CTLA4 lentiviral insert (nucleotide sequence) ATGGCCTGCTTGGGCTTCCAAAGGCATAAAGCCCAGCTTAATCTTGCTACTCGCA CGTGGCCCTGCACATTGCTCTTTTTCCTCCTGTTCATTCCCGTGTTTTGCAAGGCG ATGCATGTGGCACAACCTGCCGTCGTTCTGGCATCATCAAGAGGTATTGCTAGCT TCGTTTGTGAGTACGCCTCCCCTGGAAAAGCGACGGAGGTGCGCGTCACTGTATT GCGGCAAGCCGACAGCCAAGTTACTGAAGTCTGCGCGGCAACGTATATGATGGG CAATGAGCTGACATTCCTTGACGATTCAATCTGCACGGGAACAAGTAGTGGTAAC CAGGTGAATCTCACTATTCAAGGTCTGAAATCACTATTCAAGGTCTGAAAAATCACTATTCTGCACGGGAACAAGTAGTGGTAAC CAGGTGAATCTCACTATTCAAGGTCTGAAATCACTATTCAAGGTCTGAAAAA
  • CTLA4 lentiviral insert (amino acid sequence)
  • IL 10 lentiviral insert (nucleotide sequence) ATGCACAGCTCAGCACTGCTCTGTTGCCTGGTCCTCCTGACTGGGGTGAGGGCCA GCCCAGGCCAGGGCACCCAGTCTGAGAACAGCTGCACCCACTTCCCAGGCAACC TGCCTAACATGCTTCGAGATCTCCGAGATGCCTTCAGCAGAGTGAAGACTTTCTT TCAAATGAAGGATCAGCTGGACAACTTGTTGTTAAAGGAGTCCTTGCTGGAGGA CTTTAAGGGTTACCTGGGTTGCCAAGCCTTGTCTGAGATGATCCAGTTTTACCTG GAGGAGGTGATGCCCCAAGCTGAGAACCAAGACCCAGACATCAAGGCGCATGTG AACTCCCTGGGGGAGAACCTGAAGACCCTCAGGCTGAGGCTACGGCGCTGTCAT CGATTTCTTCCCTGTGAAAACAAGAGCAAGGCCGTGGAGCAGGTGAAGAATGCC TTTAATAAGCTCCAAGAAAGGCATCTACAAAGCCATGAGTGAGT
  • FOXP3 lentiviral insert (nucleotide sequence)
  • the vector comprising: a guide RNA, RNA-binding DNA binding agent, or donor construct comprising a sequence encoding the regulatory T cell promoting molecule, e.g., IL 10, CTLA4; or targeting receptor, e.g., a CAR, individually or in any combination, may be delivered by liposome, a nanoparticle, an exosome, or a microvesicle.
  • the vector may also be delivered by a lipid nanoparticle (LNP).
  • LNP lipid nanoparticle
  • One or more guide RNA, RNA-binding DNA binding agent (e.g., mRNA), or donor construct comprising a sequence encoding a heterologous protein, individually or in any combination, may be delivered by LNP, liposome, a nanoparticle, an exosome, or a microvesicle.
  • One or more guide RNA, RNA- binding DNA binding agent (e.g., mRNA), or donor construct comprising a sequence encoding a heterologous protein, individually or in any combination may be delivered by LNP.
  • one or more guide RNA and an RNA-guided DNA-binding agent (e.g., mRNA) are delivered by LNP.
  • a donor construct may be delivered by viral vector.
  • Lipid nanoparticles are a well-known means for delivery of nucleotide and protein cargo, and may be used for delivery of any of the guide RNAs, RNA-guided DNA binding agent, or donor construct disclosed herein.
  • lipid nanoparticle refers to a particle that comprises a plurality of (i.e., more than one) lipid molecules physically associated with each other by interm olecular forces.
  • the LNPs may be, e.g., microspheres (including unilamellar and multilamellar vesicles, e.g., “liposomes” — lamellar phase lipid bilayers that, in some embodiments, are substantially spherical and, in more particular embodiments, can comprise an aqueous core, e.g., comprising a substantial portion of RNA molecules), a dispersed phase in an emulsion, micelles, or an internal phase in a suspension (see, e.g., WO2017173054, the contents of which are hereby incorporated by reference in their entirety). Any LNP known to those of skill in the art to be capable of delivering nucleotides to subjects may be utilized.
  • RNA- guided DNA-binding agent e.g, Cas9 or a sequence encoding Cas9
  • composition comprising any of the guide RNAs described herein or donor construct disclosed herein, alone or in combination, with an LNP.
  • the composition further comprises an RNA-guided DNA-binding agent (e.g, Cas9 or a sequence encoding Cas9).
  • the LNPs comprise cationic lipids.
  • the LNPs comprise (9Z,12Z)-3-((4,4-bis(octyloxy)butanoyl)oxy)-2-((((3- (diethylamino)propoxy)carbonyl)oxy)methyl)propyl octadeca-9,12-di enoate, also called 3- ((4,4-bis(octyloxy)butanoyl)oxy)-2-(((3-(diethylamino)propoxy)carbonyl)oxy)methyl)propyl (9Z,12Z)-octadeca-9,12-di enoate) or another ionizable lipid.
  • the LNPs comprise molar ratios of a cationic lipid amine to RNA phosphate (N:P) of about 4.5, 5.0, 5.5, 6.0, or 6.5.
  • N:P RNA phosphate
  • the term cationic and ionizable in the context of LNP lipids is interchangeable, e.g., wherein ionizable lipids are cationic depending on the pH.
  • LNPs associated with the construct disclosed herein are for use in preparing a cell -based medicament for suppressing immune response.
  • Methods for preparation of cell-based therapeutics and reagents for use in cell based therapeutics are known in the art.
  • any of the guide RNAs described herein, RNA-guided DNA binding agents, or donor construct disclosed herein, alone or in combination, whether naked or as part of a vector, is formulated in or administered via a lipid nanoparticle; see e.g., WO2019/067992 or WO2017/173054 the contents of which are hereby incorporated by reference in their entirety.
  • an LNP composition comprising: an RNA component and a lipid component, wherein the lipid component comprises an amine lipid such as a biodegradable, ionizable lipid.
  • the lipid component comprises biodegradable, ionizable lipid, cholesterol, DSPC, and PEG-DMG.
  • the lipid nucleic acid assemblies contained ionizable Lipid A ((9Z,12Z)-3- ((4,4-bis(octyloxy)butanoyl)oxy)-2-((((3- (diethylamino)propoxy)carbonyl)oxy)methyl)propyl octadeca-9,12-di enoate, also called 3- ((4,4-bis(octyloxy)butanoyl)oxy)-2-(((3-(diethylamino)propoxy)carbonyl)oxy)methyl)propyl (9Z,12Z)-octadeca-9,12-di enoate), cholesterol, DSPC, and PEG2k-DMG.
  • Lipid A ((9Z,12Z)-3- ((4,4-bis(octyloxy)butanoyl)oxy)-2-(((3- (diethylamino)propoxy)carbonyl)oxy)methyl)prop
  • the components are present in a 50:38:9:3 molar ratio, respectively.
  • the lipid nucleic acid assemblies may be formulated with a lipid amine to RNA phosphate (N:P) molar ratio of about 6, and a ratio of gRNA to mRNA of 2: 1, 1 : 1, or 1 :2 by weight.
  • RNA-guided DNA-binding agent e.g., Cas nuclease or a nucleic acid encoding a Cas nuclease
  • a donor construct comprising a sequence encoding the regulatory T cell promoting molecule, e.g., IL10, or targeting receptor, e.g., a CAR
  • the guide RNA, Cas nuclease, and construct can be carried by the same vector (e.g, AAV).
  • the Cas nuclease (as a protein or mRNA) or gRNA can be carried by a plasmid or LNP, while the donor construct can be carried by a vector such as AAV.
  • the donor construct, guide RNA, and Cas nuclease can be delivered simultaneously, e.g., in one vector, two vectors, individual vectors, one LNP, two LNPs, individual LNPs, or a combination thereof.
  • the donor construct can be delivered as a vector or associated with a LNP, prior to (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or more days) delivering the guide RNA or Cas nuclease, as a vector or associated with a LNP singly or together or as a ribonucleoprotein (RNP).
  • RNP ribonucleoprotein
  • the guide RNA and Cas nuclease as a vector or associated with a LNP singly or together or as a ribonucleoprotein (RNP), can be delivered prior to (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or more days) delivering the construct, as a vector or associated with a LNP.
  • RNP ribonucleoprotein
  • the disclosure provides methods of engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence.
  • the disclosure provides methods of engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding IL10 under control of a promoter sequence.
  • the disclosure provides methods of engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding CTLA4 under control of a promoter sequence.
  • the disclosure provides methods of engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequences encoding IL 10 and CTLA4, each under control of a promoter sequence.
  • the methods comprise engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, and further comprise a modification, e.g., knockdown, of TCR sequence(s).
  • the methods comprise engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, and further comprise insertion into the cell of heterologous sequence(s) encoding a targeting receptor, e.g., a CAR.
  • a modification e.g., knockdown
  • a modification e.g., knockdown of an endogenous nucleic acid sequence encoding an IFNG
  • a modification e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA
  • insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule e.g.,
  • the methods comprise engineering T cells to comprise a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, a modification, e.g., knockdown, of TCR sequence(s), and insertion into the cell of heterologous sequence(s) encoding a targeting receptor, e.g., a CAR.
  • the modification e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG
  • the modification e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA
  • optional knockdown of a TCR gene and optional insertion into the cell of a targeting receptor e.g., a CAR
  • a targeting receptor e.g., a CAR
  • the regulatory T cell promoting molecule to be inserted may be provided via a donor construct.
  • the regulatory T cell promoting molecule provided via a donor construct may be selected from IL10, CTLA4, TGFB1, IDO1, ENTPD1, NT5E, IL22, AREG, IL35, GARP, CD274, FOXP3, IKZF2, EOS, IRF4, LEF1, and BACH2, and a modification, e.g., knockdown, of TCR gene sequence(s).
  • the targeting receptor to be inserted may be provided via a donor construct.
  • the targeting receptor may be a chimeric antigen receptor (CAR), a T-cell receptor (TCR), or a receptor for a cell surface molecule operably linked through at least a transmembrane domain in an internal signaling domain capable of activating a T cell upon binding of the extracellular receptor portion.
  • the targeting receptor may be a receptor present on the surface of a cell, e.g., a T cell, to permit binding of the cell to a target site, e.g., a specific cell or tissue in an organism.
  • the targeting receptor is a CAR capable of targeting MAdCAM-1.
  • Suitable gene editing systems for engineering the T cells to comprise insertions and modifications, e.g., knockdowns, are disclosed herein and known in the art.
  • the gene editing systems include but are not limited to the CRISPR/Cas system; zinc finger nuclease (ZFN) system; transcription activator-like effector nuclease (TALEN) system.
  • ZFN zinc finger nuclease
  • TALEN transcription activator-like effector nuclease
  • the gene editing systems involve the use of engineered cleavage systems to induce a double strand break (DSB) or a nick (e.g., a single strand break, or SSB) in a target DNA sequence.
  • DSB double strand break
  • SSB single strand break
  • Cleavage or nicking can occur through the use of specific nucleases such as engineered ZFN, TALENs, or using the CRISPR/Cas system with an engineered guide RNA to guide specific cleavage or nicking of a target DNA sequence, such as a CRISPR/Cas9 system.
  • targeted nucleases are being developed based on the Argonaute system (e.g., from T. thermophilus, known as ‘TtAgo’, see Swarts et al (2014) Nature 507(7491): 258-261), which also may have the potential for uses in genome editing and gene therapy.
  • Transcription activator-like effector nucleases are restriction enzymes that can be engineered to cut specific sequences of DNA. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain (a nuclease which cuts DNA strands). Transcription activator-like effectors (TALEs) can be engineered to bind to a desired DNA sequence, to promote DNA cleavage at specific locations (see, e.g., Boch, TALEs of genome targeting Nature Biotech. 29: 135-136 (2011)).
  • the restriction enzymes can be introduced into cells, for use in gene editing or for genome editing in situ, a technique known as genome editing with engineered nucleases. Such methods and compositions for use therein are known in the art. See, e.g., WO2019147805, W02014040370, WO2018073393, the contents of which are hereby incorporated in their entireties.
  • Zinc-finger nucleases are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain.
  • Zinc finger domains can be engineered to target specific desired DNA sequences to enables zinc-finger nucleases to target unique sequences within complex genomes.
  • the non-specific cleavage domain from the type Ils restriction endonuclease FokI is typically used as the cleavage domain in ZFNs. Cleavage is repaired by endogenous DNA repair machinery, allowing ZFN to precisely alter the genomes of higher organisms.
  • Such methods and compositions for use therein are known in the art.
  • RNA interference is a biological process in which RNA molecules inhibit gene expression or translation, by neutralizing targeted mRNA molecules.
  • Small interfering RNAs are central to RNA interference.
  • RNAs are the direct products of genes, and these small RNAs (typically each strand being 19-23 nucleotides in length forming a duplex of 19-21 nucleotides) can direct the RNA induced silencing (RISC) complex to degrade messenger RNA (mRNA) molecules and thus decrease their activity by preventing translation, via post-transcriptional gene silencing.
  • RISC RNA induced silencing
  • Short hairpin RNAs are siRNAs that are a single RNA strand wherein the strands forming the duplex region have a hairpin structure, often generated by transcription from an expression vector.
  • RNAi can also be accomplished by longer RNA duplex structures referred to as Dicer substrate molecules, which are cleaved by the enzyme Dicer before being loaded into RISC to promote target mRNA cleavage.
  • Dicer substrate molecules RNA duplex structures
  • Dicer substrate molecules which are cleaved by the enzyme Dicer before being loaded into RISC to promote target mRNA cleavage.
  • the RNA molecule to promote RNA interference is provided as an expression vector for durability, see, e.g., WO2018208837, the contents of which are hereby incorporated in their entireties.
  • RNAi is used with an expression vector.
  • the present disclosure contemplates methods of insertion performed with or without the guide RNAs disclosed herein (e.g., using a ZFN system to cause a break in a target DNA sequence, creating a site for insertion of the construct).
  • the methods include the use of the CRISPR/Cas system to modify, e.g., knockdown, a nucleic acid sequence encoding TNFA, IFNG, or TCR.
  • the present disclosure contemplates methods of modifying, e.g., knocking down, TNFA, IFNG, or TCR, which can be performed without the guide RNAs disclosed herein (e.g., using a ZFN system to cause a break in a target DNA sequence, creating a site for insertion of the construct).
  • the donor construct comprising the sequence for insertion e.g., a sequence encoding IL 10 or CTLA4, is inserted at a genomic locus for a sequence that is targeted for modification, e.g., knockdown, e.g., a TCR gene.
  • a CRISPR/Cas system e.g., a guide RNA and RNA- guided DNA binding agent
  • a CRISPR/Cas system can be used to create a site of insertion at a desired locus within a genome, at which site a donor construct comprising a sequence encoding IL 10, CTLA4, or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, disclosed herein can be inserted to express IL10, CTLA4, or a CAR, e.g., a MAdCAM-1 CAR.
  • the targeting receptor e.g., a CAR, e.g., a MAdCAM-1 CAR, IL 10, or CTLA4 may be heterologous with respect to its insertion site or locus, for example a safe harbor locus or a TCR locus from which IL 10, CTLA4, or targeting receptor, e.g., a CAR, e.g., MAdCAM-1 CAR, is not normally expressed, as described herein.
  • a guide RNA described herein can be used according to the present methods with an RNA-guided DNA-binding agent e.g., Cas nuclease) to create a site of insertion, at which site a donor construct comprising a sequence encoding IL10, CTLA4, or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR can be inserted to express IL 10, CTLA4, or a CAR, e.g., a MAdCAM-1 CAR.
  • the guide RNAs for insertion of IL10, CTLA4, or targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, into specific genomic loci are exemplified and described herein.
  • CD4+ T cells are engineered by transduction (e.g., using viral or non-viral delivery) with a gRNA (e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown), an RNA-guided DNA-binding agent (e.g., Cas nuclease), a donor construct.
  • a gRNA e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown
  • an RNA-guided DNA-binding agent e.g., Cas nuclease
  • the engineered T cells are: 1) transduced with a gRNA targeting a nucleic acid sequence encoding a pro-inflammatory cytokine, e.g., IFNG or TNFA, an RNA guided DNA binding agent (e.g., Cas nuclease), and 2) transduced with a donor construct comprising nucleic acid sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, and a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR.
  • the engineered cells are selected for expression of the targeting receptor.
  • CD4+ T cells are engineered by transduction with a gRNA (e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown), an RNA-guided DNA- binding agent (e.g., Cas nuclease) and a donor construct.
  • a gRNA e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown
  • an RNA-guided DNA- binding agent e.g., Cas nuclease
  • the engineered T cells are: 1) transduced with a donor construct comprising nucleic acid sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL 10 or CTLA4, and a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, and 2) transduced with a gRNA targeting a nucleic acid sequence encoding a pro-inflammatory cytokine, e.g., IFNG or TNFA, an RNA guided DNA binding agent (e.g., Cas nuclease).
  • the engineered cells are selected for expression of the targeting receptor.
  • CD4+ T cells are engineered by transduction with a gRNA (e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown), an RNA-guided DNA- binding agent (e.g., Cas nuclease), a donor construct.
  • a gRNA e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown
  • an RNA-guided DNA- binding agent e.g., Cas nuclease
  • the engineered T cells are: 1) transduced with a donor construct comprising nucleic acid sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, and a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, and 2) transduced with a gRNA targeting a nucleic acid sequence encoding a pro-inflammatory cytokine, e.g., IFNG or TNFA, an RNA guided DNA binding agent (e.g., Cas nuclease).
  • a donor construct comprising nucleic acid sequence(s) encoding a regulatory T cell promoting molecule, e.g., IL10 or CTLA4, and a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR
  • a gRNA targeting a nucleic acid sequence encoding a pro-inflammatory cytokine e.
  • the donor construct comprising a sequence encoding IL10, CTLA4, or a targeting receptor e.g., a CAR, guide RNA (e.g., gRNA targeting IFNG, TNFA, or TCR for knockdown), and RNA-guided DNA-binding agent can be delivered using any suitable delivery system and method known in the art.
  • the guide RNA and Cas nuclease are associated with an LNP and delivered to the cell or the population of cells prior to delivering the donor construction comprising a sequence encoding IL10, CTLA4, or a targeting receptor, e.g., a CAR.
  • the guide RNA and Cas nuclease are associated with an LNP and delivered to the cell or the population of cells after delivering the donor construction comprising a sequence encoding IL10, CTLA4, or a targeting receptor, e.g., a CAR.
  • administration of the gRNAs, donor construct, and RNA-guided DNA binding agents described herein to a naturally occurring T cell is capable of converting the naturally occurring T cell, e.g., a CD4+ T cell, to a cell that exhibits the characteristics, e.g., immune response suppressive characteristics, of a regulatory T cell.
  • gRNAs, donor constructs, and RNA-guided DNA binding agents for modifying, e.g., knocking down, IFNG, TNFA, or TCR gene expression or inserting a sequence encoding IL10, CTLA4, or a targeting receptor, e.g., a CAR, e.g., a MAdCAM-1 CAR, may be introduced to a conventional T cell or population of conventional T cells to generate the engineered T cells or population of T cells described herein.
  • RNA-guided DNA-binding agents e.g., a nuclease, such as a Cas nuclease, e.g., Cas9
  • a nuclease such as a Cas nuclease, e.g., Cas9
  • CRISPR/Cas system e.g., CRISPR/Cas system
  • suitable variations to the system can also be used.
  • the RNA- guided DNA-binding agent can be provided as a nucleic acid (e.g., DNA or mRNA), such as the mRNAs encoding an RNA-guided DNA-binding agent provided above, or as a protein.
  • the present method can be practiced in a cell that already comprises or expresses an RNA-guided DNA-binding agent.
  • the RNA-guided DNA-binding agent such as a Cas9 nuclease
  • has cleavase activity which can also be referred to as double-strand endonuclease activity.
  • the RNA-guided DNA-binding agent such as a Cas9 nuclease
  • has nickase activity which can also be referred to as single-strand endonuclease activity.
  • the RNA-guided DNA-binding agent comprises a Cas nuclease.
  • Cas nucleases include those of the type II CRISPR systems of S. pyogenes, S.
  • aureus, and other prokaryotes see, e.g., the list in the next paragraph
  • variant or mutant e.g., engineered, non-naturally occurring, naturally occurring, or other variant
  • Non-limiting exemplary species that the Cas nuclease can be derived from include Streptococcus pyogenes, Streptococcus therm ophilus, Streptococcus sp., Staphylococcus aureus, Listeria innocua, Lactobacillus gasseri, Francisella novicida, Wolinella succinogenes, Sutterella wadsworthensis, Gammaproteobacterium, Neisseria meningitidis, Campylobacter jejuni, Pasteurella multocida, Fibrobacter succinogene, Rhodospirillum rubrum, Nocardiopsis rougevillei, Streptomyces pristinaespiralis, Streptomyces viridochromogenes, Streptomyces viridochromogenes, Streptosporangium roseum, Streptosporangium roseum, Alicyclobacillus acidocaldarius, Bacill
  • the Cas nuclease is the Cas9 nuclease from Streptococcus pyogenes. In some embodiments, the Cas nuclease is the Cas9 nuclease from Streptococcus thermophilus. In some embodiments, the Cas nuclease is the Cas9 nuclease from Neisseria meningitidis. In some embodiments, the Cas nuclease is the Cas9 nuclease is from Staphylococcus aureus. In some embodiments, the Cas nuclease is the Cpfl nuclease from Francisella novicida.
  • the Cas nuclease is the Cpfl nuclease from Acidaminococcus sp. In some embodiments, the Cas nuclease is the Cpfl nuclease from Lachnospiraceae bacterium ND2006.
  • the Cas nuclease is the Cpfl nuclease from Francisella tularensis, Lachnospiraceae bacterium, Butyrivibrio proteoclasticus, Peregrinibacteria bacterium, Parcubacteria bacterium, Smithella, Acidaminococcus, Candidatus Methanoplasma termitum, Eubacterium eligens, Moraxella bovoculi, Leptospira inadai, Porphyromonas crevioricanis, Prevotella disiens, or Porphyromonas macacae.
  • the Cas nuclease is a Cpfl nuclease from an Acidaminococcus or Lachnospiraceae .
  • the gRNA together with an RNA-guided DNA-binding agent is called a ribonucleoprotein complex (RNP).
  • the RNA-guided DNA-binding agent is a Cas nuclease.
  • the gRNA together with a Cas nuclease is called a Cas RNP.
  • the RNP comprises Type-I, Type-II, or Type-III components.
  • the Cas nuclease is the Cas9 protein from the Type-II CRISPR/Cas system.
  • the gRNA together with Cas9 is called a Cas9 RNP.
  • Wild-type Cas9 has two nuclease domains: RuvC and HNH.
  • the RuvC domain cleaves the non-target DNA strand
  • the HNH domain cleaves the target strand of DNA.
  • the Cas9 protein comprises more than one RuvC domain or more than one HNH domain.
  • the Cas9 protein is a wild-type Cas9. In each of the composition, use, and method embodiments, the Cas induces a double strand break in target DNA.
  • chimeric Cas nucleases are used, where one domain or region of the protein is replaced by a portion of a different protein.
  • a Cas nuclease domain may be replaced with a domain from a different nuclease such as Fokl.
  • a Cas nuclease may be a modified nuclease.
  • the Cas nuclease may be from a Type-I CRISPR/Cas system. In some embodiments, the Cas nuclease may be a component of the Cascade complex of a Type-I CRISPR/Cas system. In some embodiments, the Cas nuclease may be a Cas3 protein. In some embodiments, the Cas nuclease may be from a Type-III CRISPR/Cas system. In some embodiments, the Cas nuclease may have an RNA cleavage activity.
  • the RNA-guided DNA-binding agent has single-strand nickase activity, i.e., can cut one DNA strand to produce a single-strand break, also known as a “nick.”
  • the RNA-guided DNA-binding agent comprises a Cas nickase.
  • a nickase is an enzyme that creates a nick in dsDNA, i.e., cuts one strand but not the other of the DNA double helix.
  • a Cas nickase is a version of a Cas nuclease (e.g., a Cas nuclease discussed above) in which an endonucleolytic active site is inactivated, e.g., by one or more alterations (e.g., point mutations) in a catalytic domain. See, e.g., US Pat. No. 8,889,356 for discussion of Cas nickases and exemplary catalytic domain alterations.
  • a Cas nickase such as a Cas9 nickase has an inactivated RuvC or HNH domain.
  • the RNA-guided DNA-binding agent is modified to contain only one functional nuclease domain.
  • the agent protein may be modified such that one of the nuclease domains is mutated or fully or partially deleted to reduce its nucleic acid cleavage activity.
  • a nickase is used having a RuvC domain with reduced activity.
  • a nickase is used having an inactive RuvC domain.
  • a nickase is used having an HNH domain with reduced activity.
  • a nickase is used having an inactive HNH domain.
  • a conserved amino acid within a Cas protein nuclease domain is substituted to reduce or alter nuclease activity.
  • a Cas nuclease may comprise an amino acid substitution in the RuvC or RuvC-like nuclease domain.
  • Exemplary amino acid substitutions in the RuvC or RuvC-like nuclease domain include D10A (based on the . pyogenes Cas9 protein). See, e.g., Zetsche et al. (2015) Cell Oct 22: 163(3): 759-771.
  • the Cas nuclease may comprise an amino acid substitution in the HNH or HNH-like nuclease domain.
  • Exemplary amino acid substitutions in the HNH or HNH-like nuclease domain include E762A, H840A, N863 A, H983A, and D986A (based on the . pyogenes Cas9 protein). See, e.g., Zetsche et al. (2015). Further exemplary amino acid substitutions include D917A, E1006A, and D1255A (based on the Francisella novicida W l Cpfl (FnCpfl) sequence (UniProtKB - A0Q7Q2 (CPF1 FRATN)).
  • a nickase is provided in combination with a pair of guide RNAs that are complementary to the sense and antisense strands of the target sequence, respectively.
  • the guide RNAs direct the nickase to a target sequence and introduce a DSB by generating a nick on opposite strands of the target sequence (i.e., double nicking).
  • a nickase is used together with two separate guide RNAs targeting opposite strands of DNA to produce a double nick in the target DNA.
  • a nickase is used together with two separate guide RNAs that are selected to be in close proximity to produce a double nick in the target DNA.
  • the RNA-guided DNA-binding agent comprises one or more heterologous functional domains (e.g., is or comprises a fusion polypeptide).
  • the heterologous functional domain may facilitate transport of the RNA-guided DNA-binding agent into the nucleus of a cell.
  • the heterologous functional domain may be a nuclear localization signal (NLS).
  • the RNA-guided DNA-binding agent may be fused with 1-10 NLS(s).
  • the RNA-guided DNA-binding agent may be fused with 1-5 NLS(s).
  • the RNA-guided DNA-binding agent may be fused with one NLS.
  • the NLS may be linked at the N-terminus or the C-terminus of the RNA-guided DNA-binding agent sequence. It may also be inserted within the RNA-guided DNA-binding agent sequence. In other embodiments, the RNA-guided DNA-binding agent may be fused with more than one NLS. In some embodiments, the RNA-guided DNA-binding agent may be fused with 2, 3, 4, or 5 NLSs. In some embodiments, the RNA-guided DNA-binding agent may be fused with two NLSs. In certain circumstances, the two NLSs may be the same (e.g., two SV40 NLSs) or different.
  • the RNA-guided DNA-binding agent is fused to two SV40 NLS sequences linked at the carboxy terminus. In some embodiments, the RNA-guided DNA-binding agent may be fused with two NLSs, one linked at the N-terminus and one at the C-terminus. In some embodiments, the RNA-guided DNA-binding agent may be fused with 3 NLSs. In some embodiments, the RNA-guided DNA-binding agent may be fused with no NLS.
  • the NLS may be a monopartite sequence, such as, e.g., the SV40 NLS, PKKKRKV (SEQ ID NO: 143) or PKKKRRV (SEQ ID NO: 144).
  • the NLS may be a bipartite sequence, such as the NLS of nucleoplasmin, KRPAATKKAGQAKKKK (SEQ ID NO: 145).
  • a single PKKKRKV (SEQ ID NO: 143) NLS may be linked at the C-terminus of the RNA-guided DNA-binding agent. One or more linkers are optionally included at the fusion site.
  • the disclosure provides methods for suppressing an immune response in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for suppressing an immune response in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding IL 10 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for suppressing an immune response in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding CTLA4 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for suppressing an immune response in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequences encoding IL10 and CTLA4.
  • the disclosure provides methods for treating an autoimmune disorder in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating an autoimmune disorder in a subject, comprising administering engineered T cells a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding IL 10 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating an autoimmune disorder in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding CTLA4 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating an autoimmune disorder in a subject, comprising administering engineered T cells a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequences encoding IL 10 and CTLA4, each under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating GvHD in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding a regulatory T cell promoting molecule under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating GvHD in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding IL 10 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating GvHD in a subject, comprising administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequence(s) encoding CTLA4 under control of a promoter sequence.
  • a modification e.g., knockdown
  • the disclosure provides methods for treating GvHD in a subject, comprising administering engineered T cells a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, and insertion into the cell of heterologous sequences encoding IL10 and CTLA4, each under control of a promoter sequence.
  • a modification e.g., knockdown
  • the methods comprise administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, and further comprising a modification, e.g., knockdown, of TCR sequence(s).
  • a modification e.g., knockdown
  • the methods comprise administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, and further comprising insertion of sequence(s) encoding a targeting receptor, e.g., a CAR.
  • a modification e.g., knockdown
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to the gastrointestinal system, e.g., the targeting receptor is a CAR targeting MAdCAM-1, e.g., for suppressing immune responses, including inflammation, in disorders such as inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to tissues comprising endothelial cells, e.g., the targeting receptor is a CAR targeting VCAM-1, e.g., for suppressing immune responses, including inflammation, in disorders such as Crohn’s disease and multiple sclerosis.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to endothelial cells, e.g., the targeting receptor is a CAR targeting CEACAM6, e.g., for suppressing immune responses in disorders such as Crohn’s disease.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to B cells, e.g., the targeting receptor is a CAR targeting CD19, e.g., for suppressing immune responses in disorders such as in multiple sclerosis and systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to B cells
  • the targeting receptor is a CAR targeting CD20, e.g., for suppressing immune responses in disorders such as in multiple sclerosis and systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to an inflammatory tissue, e.g., the targeting receptor is a CAR targeting TNFA, e.g., for suppressing immune responses in disorders such as inflammatory bowel disease, ulcerative colitis, or Crohn’s disease.
  • the targeting receptor e.g., a CAR is capable of targeting engineered T cells to a neurological tissue, e.g., the targeting receptor is a CAR targeting MBP, MOG, or PLP, e.g., for suppressing immune responses in disorders such as multiple sclerosis.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to tissues comprising mature B lymphocytes, e.g., the targeting receptor is a CAR targeting TNFRSF17, e.g., for suppressing immune responses in disorders such as systemic lupus erythematosus.
  • the targeting receptor e.g., a CAR
  • the targeting receptor is capable of targeting engineered T cells to synovial tissue, e.g., the targeting receptor is a CAR targeting citrullinated vimentin e.g., for suppressing immune responses in disorders such as rheumatoid arthritis.
  • the targeting receptor is a CAR targeting DPP6, SCL2A2, glutamate decarboxylase (GAD2), demoglein 3 (DSG3), and MHC class I HLA-A (HLA-A*02).
  • the methods comprise administering engineered T cells comprising a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding an IFNG, a modification, e.g., knockdown, of an endogenous nucleic acid sequence encoding a TNFA, insertion of sequence(s) encoding a regulatory T cell promoting molecule, an insertion of sequence(s) encoding a targeting receptor, e.g., a CAR, and further comprising a modification, e.g., knockdown, of TCR sequence(s).
  • a modification e.g., knockdown
  • sequence(s) to be inserted are inserted into the sequence(s) to be modified, e.g., knocked down, e.g., a CAR sequence is inserted into a TNFA genomic sequence, thereby modifying, e.g., knocking down, the TNFA sequence.
  • the methods comprise administering a population of T cells comprising T cells that are engineered as described above.
  • at least 40%, 45%, preferably at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of the T cells in the population of T cells are engineered, e.g., as assessed by sequencing, e.g., NGS.
  • the autoimmune disorder is selected from ulcerative colitis, Crohn’s disease, rheumatoid arthritis, psoriasis, multiple sclerosis, systemic lupus erythematosus, type 1 diabetes, and graft versus host disease (GvHD).
  • the engineered T cells have autologous or allogenic use.
  • the effectiveness of treatment using the engineered T cell described above can be assessed in an animal model, e.g., mouse model, of graft versus host disease by measuring the animal’s weight or survival (wherein the animals are sacrificed after loss of a substantial portion of body weight, e.g., 20% of starting body weight) following administration of the engineered T cell.
  • effective treatment results in a statistically significant increase in survival rate as compared to a suitable control, e.g., an animal treated with PBMC.
  • RNA cargos e.g., Cas9 mRNA and sgRNA
  • the RNA cargos were dissolved in 25 mM citrate buffer, 100 mM NaCl, pH 5.0, resulting in a concentration of RNA cargo of approximately 0.45 mg/mL.
  • the lipid nucleic acid assemblies contained ionizable Lipid A ((9Z,12Z)-3-((4,4-bis(octyloxy)butanoyl)oxy)-2-((((3- (diethylamino)propoxy)carbonyl)oxy)methyl)propyl octadeca-9,12-di enoate, also called 3- ((4,4-bis(octyloxy)butanoyl)oxy)-2-(((3-(diethylamino)propoxy)carbonyl)oxy)methyl)propyl (9Z,12Z)-octadeca-9,12-di enoate), cholesterol, DSPC, and PEG2k-DMG in a 50:38.5: 10: 1.5 molar ratio, respectively.
  • the lipid nucleic acid assemblies were formulated with a lipid amine to RNA phosphate (N:P) molar ratio of about 6, and
  • LNPs were prepared using a cross-flow technique utilizing impinging jet mixing of the lipid in ethanol with two volumes of RNA solutions and one volume of water.
  • the lipids in ethanol were mixed through a mixing cross with the two volumes of RNA solution.
  • a fourth stream of water was mixed with the outlet stream of the cross through an inline tee (See WO2016010840 Fig. 2.).
  • the LNPs were held for 1 hour at room temperature, and further diluted with water (approximately 1 : 1 v/v).
  • LNPs were concentrated using tangential flow filtration on a flat sheet cartridge (Sartorius, lOOkD MWCO) and buffer exchanged using PD-10 desalting columns (GE) into 50 mM Tris, 45 mM NaCl, 5% (w/v) sucrose, pH 7.5 (TSS).
  • the LNPs were optionally concentrated using 100 kDa Amicon spin filter and buffer exchanged using PD-10 desalting columns (GE) into TSS. The resulting mixture was then filtered using a 0.2 pm sterile filter. The final LNP was stored at 4°C or -80°C until further use.
  • IVTT In vitro transcription
  • Capped and polyadenylated mRNA containing N1 -methyl pseudo-U was generated by in vitro transcription using a linearized plasmid DNA template and T7 RNA polymerase. Plasmid DNA containing a T7 promoter, a sequence for transcription, and a polyadenylation region was linearized by incubating at 37°C for 2 hours with Xbal with the following conditions: 200 ng/pL plasmid, 2 U/pL Xbal (NEB), and lx reaction buffer. The Xbal was inactivated by heating the reaction at 65°C for 20 min. The linearized plasmid was purified from enzyme and buffer salts.
  • the IVT reaction to generate modified mRNA was performed by incubating at 37°C for 1.5-4 hours in the following conditions: 50 ng/pL linearized plasmid; 2-5 mM each of GTP, ATP, CTP, and N1 -methyl pseudo-UTP (Trilink); 10-25 mM ARC A (Trilink); 5 U/pL T7 RNA polymerase (NEB); 1 U/pL Murine RNase inhibitor (NEB); 0.004 U/pL Inorganic E. coli pyrophosphatase (NEB); and lx reaction buffer.
  • TURBO DNase (ThermoFisher) was added to a final concentration of 0.01 U/pL, and the reaction was incubated for an additional 30 minutes to remove the DNA template.
  • the mRNA was purified using a MegaClear Transcription Clean-up kit (ThermoFisher) or a RNeasy Maxi kit (Qiagen) per the manufacturers’ protocols. Alternatively, the mRNA was purified through a precipitation protocol, which in some cases was followed by HPLC-based purification. Briefly, after the DNase digestion, mRNA is purified using LiCl precipitation, ammonium acetate precipitation and sodium acetate precipitation.
  • mRNA was purified by RP-IP HPLC (see, e.g., Kariko, et al. Nucleic Acids Research, 2011, Vol. 39, No. 21 el42). The fractions chosen for pooling were combined and desalted by sodium acetate/ethanol precipitation as described above.
  • mRNA was purified with a LiCl precipitation method followed by further purification by tangential flow filtration. RNA concentrations were determined by measuring the light absorbance at 260 nm (Nanodrop), and transcripts were analyzed by capillary electrophoresis by Bioanlayzer (Agilent).
  • Streptococcus pyogenes (“Spy”) Cas9 mRNA was generated from plasmid DNA encoding an open reading frame according to the nucleic acid sequences described herein. For the mRNA nucleic acid sequences below, it is understood that Ts should be replaced with Us (which were N1 -methyl pseudouridines as described above). Messenger RNAs used in the Examples include a 5’ cap and a 3’ poly- A tail, e.g, up to 100 nts (SEQ ID NO: 146). 1.3. Next-generation sequencing (“NGS”) and analysis for on-target editing efficiency
  • PCR primers were designed around the target site within the gene of interest (e.g., TRAC) and the genomic area of interest was amplified. Primer sequence design was done as is standard in the field.
  • Additional PCR was performed according to the manufacturer's protocols (Illumina) to add chemistry for sequencing.
  • the amplicons were sequenced on an Illumina MiSeq instrument.
  • the reads were aligned to the human reference genome (e.g., hg38) after eliminating those having low quality scores.
  • the resulting files containing the reads were mapped to the reference genome (BAM files), where reads that overlapped the target region of interest were selected and the number of wild type reads versus the number of reads which contain an indel was calculated.
  • the editing percentage e.g., the “editing efficiency” or “percent editing” or “percent indels” is defined as the total number of sequence reads with indels over the total number of sequence reads, including wild type.
  • CD3+CD4+ T cells were transduced to overexpress Treg-associated transcription factors Foxp3, Foxp3 with IL 10, IL 10, CTLA4, and IL 10 with CTLA4, and assayed for their ability to suppress inflammatory immune responses.
  • Human CD3+CD4+T cells were prepared internally from a fresh leukopak (StemCell Technologies, Donor # RG1953).
  • CD3+CD4+ T cells were isolated by negative selection using the human CD4+ T cell isolation kit (Miltenyi; Cat no. 130-096-533) following the manufacturer’s protocol.
  • the isolated CD3+CD4+ T cells were frozen in Cryostor CS10 freezing media (Cat No. 07930) until further use. On the day of activation, frozen CD3+CD4+ T cells were thawed using a 37°C water bath.
  • Thawed CD3+CD4+ T cells were plated at a density of IxlO 6 cells/mL in a total of 5ml of T cell RPMI media composed of RPMI 1640 (Corning; Cat No. 10-040-CV) containing 10% (v/v) of fetal bovine serum (Gibco; Cat No. A31605-01), lx Glutamax (Gibco; Cat. 35050-061), 50 pM of 2-Mercaptoethanol (Gibco; 31350-010), lx non-essential amino acids (Corning, Cat. 25-0250-CI), 1 mM sodium pyruvate (Corning; Cat No.
  • CD3+CD4+ T cells were transduced with lentiviral constructs, either individually or together. Forty-eight hours after activation, CD3+CD4+ T cells were harvested, washed and resuspended at a density of IxlO 6 cells/100 uL T cell RPMI media. 100 uL of concentrated viral supernatant was added to the CD3+CD4+ T cells and centrifuged at lOOOxg for 60 mins at 37°C.
  • the CD3+CD4+ T cells were resuspended in the cell/viral supernatant mixture and transferred to a single well of a 6-well G-rex (Wilson Wolf; Cat. 80240M) containing 20 mL T cell RPMI media supplemented with 500 U/mL IL-2, 5 ng/mL IL-7, and 5 ng/mL IL- 17.
  • the transduced CD3+CD4+ T cells were cultured for 4 to 6 days and sorted using a BD FACSAriaTM Fusion Cell Sorter (BD Biosciences) to isolate cells expressing the target of interest.
  • the CD3+CD4+ T cells were cultured in 6-well Grex plates with 20 mL T cell RPMI media containing components as mentioned in 2.1 and further supplemented with 500 U/mL IL-2, 5 ng/mL IL7, and 5 ng/mL IL 17, until day 25.
  • Natural regulatory T cells were prepared using methods known in the art. Briefly, autologous PBMCs were thawed and treated to isolate CD4+ T cells using a CD4+ T cell negative selection kit (Miltenyi, Cat.130-096-533) according to manufacturer’s instructions. CD3+CD4+ T cells were resuspended in FACS buffer at 1x10 7 cells/mL and stained with BV421 anti-CD4 (Biolegend, Cat. 300532), APC anti-CD25 (Biolegend, Cat. 302610) and PE-Cy7 anti-CD127 (Biolegend, Cat. 351320) for 30 mins at 4°C.
  • BV421 anti-CD4 Biolegend, Cat. 300532
  • APC anti-CD25 Biolegend, Cat. 302610
  • PE-Cy7 anti-CD127 Biolegend, Cat. 351320
  • the top 3-5% highest expressing CD25+ cells from the CD4+CD127- population were sorted by FACS into T cell RPMI media culture containing 50% fetal bovine serum.
  • the sorted CD3+CD4+CD25+CD127- nTregs were plated in a 6-well Grex containing 20mL T cell RPMI media supplemented with components as mentioned in Example 2.1 further supplemented with 500 U/mL IL-2 (Stemcell Technologies, Cat. 78036.1), 100 nM Rapamycin (Millipore Sigma, Cat. 553211) and 25 pl/mL anti-CD3/28/2 Immunocult T cell Activator (Stemcell Technologies, Cat. 10990).
  • IL-2 (Stemcell Technologies, Cat.
  • nTregs were harvested, washed and plated in 6-well Grex plate in T cell RPMI media supplemented with components as mentioned in A.l, 500 U/mL IL-2 (Stemcell Technologies, Cat. 78036.1) until the day of injection.
  • Target expression was verified by flow cytometry.
  • Five-hundred thousand transduced CD3+CD4+T cells were permeabilized with the FoxP3/Transcription Factor Staining Buffer Set (eBioscience Cat. 00-5523-00), according to manufacturer’s instructions.
  • the transduced CD3+CD4+ T cells were incubated with a panel of antibodies consisting of either (1) PerCP/Cy 5.5 anti-FoxP3 (BD Biosciences, Cat. 561493), eFluor660 anti-Eos (Invitrogen, Cat. 50-5758-80), Pacific blue anti-Helios (Biolegend, Cat.
  • Table 4 Mean fluorescent intensity for protein expression in CD3+CD4+ T cells following lentiviral transduction
  • Sorted CD3+CD4+ T cells for in vivo injections were harvested and processed with a dead cell removal kit (Miltenyi, Cat. 130-090-101) according to manufacturer’s instructions.
  • Autologous PBMCs were thawed as described above in the Examples. PBMCs were added to each assay population at a 1 : 1 ratio and cells resuspended in PBS to 6xl0 6 /150 pL. The PBMC only group was resuspended at 3xl0 6 /150 pL.
  • mice .C -Prkdc sc,d Il2r ⁇ mlSus IJ ⁇ cTac Taconic, Cat No. NOG-F were conditioned for cellular transplant by sublethal irradiation (200 rads) using X- rays (RS-2000 irradiator; Rad Source Technologies) one day before injection. Cohorts of irradiated NOG mice were injected intravenously with 150pL of each test cell population. Five irradiated mice were not injected and were used as the irradiation only control. Body weight was monitored daily. Upon 20% weight loss, mice were sacrificed and the cellular composition of their spleens was assessed. Survival was plotted to understand the survival rate of mice in each test group. Only T cells transduced with both IL- 10 and CTLA4 prolonged survival to levels similar to nTregs, as shown in Table 5 and Figure 2A.
  • the splenic composition was assessed. At the time of euthanasia, each animal’s spleen was collected in a gentleMACS C tube (Miltenyi, Cat. 130-096-334) containing PBS. The spleens were dissociated using a gentleMACS Octo Dissociator machine (Miltenyi, 130-095-937, program mSpleenOl Ol). The cell suspension was filtered through a 70-micron cell strainer (Corning, Cat. 08-771-2) and cells were counted using the Vi-CELL XR Cell Viability Analyzer (Beckman Coulter).
  • anti-human CD3 Alexa Fluor 488 (Biolegend, Cat. 317310 or PerCP/Cyanine 5.5 (Biolegend, Cat. 300327)
  • BV650 antihuman CD 19 Biolegend, Cat. 302238
  • APC anti-human CD45 BD Pharmigen, Cat. 561864
  • CD4 T cells were defined as Teri 19-CD45+CD19- CD3+CD4+.
  • CD8 T cells were defined as Terl l9-CD45+CD19-CD3+CD4-.
  • B cells were defined as Teri 19-CD45+CD19+CD3-. In order to determine the number of cells of individual populations, the percentage of each population was applied to the total number of splenocytes recovered.
  • Sorted transduced CD3+CD4+ T cells were stimulated to assess their cytokine profile.
  • Sorted transduced CD3+CD4+ T cells were plated at lxl0 A 5 T cells/well, in a U- bottom culture plate, in a total of 200 pL T cell RPMI media with or without 25 uL/mL ImmunoCult Human CD3/CD28/CD2 T cell Activator (Stemcell Technologies, Cat. 10990) and cultured at 37°C for 48 hours. Following 48 hours of culture, the culture plate was centrifuged, the supernatants collected and frozen for subsequent cytokine quantification using a custom U-PLEX Biomarker kit (Meso Scale Diagnostics, Cat.
  • IL10 Overexpression of IL10 also increased secretion of IL6, IFNG, and TNFA.
  • T cells transduced with a lentiviral expression vector with a sequence encoding FoxP3 displayed reduced expression of all quantified cytokines.
  • Natural Tregs also displayed reduced secretion of quantified cytokines, which is characteristic of highly pure and suppressive nTregs.
  • Table 7 In vitro cytokine production (pg/ml) of transduced cells upon cell stimulation
  • a mixed lymphocyte reaction was used to assay the suppressive function of sorted transduced CD3+CD4+ T cells.
  • the MLR is an inflammatory reaction caused by T cells recognizing allogenic leukocytes of another donor as foreign. Tregs are able to suppress this inflammatory reaction. Therefore, the MLR is a standard assay to assess the suppressive capacity of Tregs, including engineered Tregs. If a Treg is suppressive, there is less proliferation and production of inflammatory cytokines by the responding inflammatory T cells.
  • the MLR was conducted in a 96-well U-bottom plate using T cell RPMI media. Untransduced CD3+CD4+ T cells were labelled with CellTrace Violet (CTV) (Thermofisher Scientific; Cat No. C34557) according to manufacturer’s instructions and were used as the responding cells. CD3-depleted PBMC from an allogenic donor than used for the transduced T cells were processed using a Dead cell removal kit (Miltenyi; Cat No. 130-090- 101) according to manufacturer’s instructions.
  • CTV CellTrace Violet
  • Cultures were prepared by combining 50,000 CTV-labelled T cells, 50,000 CD3-depleted PBMC, and approximately 50,000 (1 to 1), 16,666 (4 to 1), 5,555 (16 to 1), 1,851 (64 to 1) or 617 (256 to 1) sorted transduced CD3+CD4+ T cells per well. Following 5 days of culture at 37°C, the culture plate was centrifuged, and culture supernatants were harvested for cytokine quantification. The cell pellet was resuspended in FACS buffer containing APC/Fire 750 anti-CD4 and placed at 4°C for 30 mins.
  • the cells were subsequently washed, processed on a CytoFlex flow cytometer (Beckman Coulter), and analyzed using the FlowJo software package. Cells were first gated by positive CD4 expression, followed by CTV expression and finally on the undiluted CTV population. Suppression of CTV-dilution was calculated using the following formula:
  • CD3+CD4+ T cells transduced with lentiviral vectors to promote overexpression of IL- 10 and CTLA-4 demonstrated an increase in the production of IFNG and TNFA
  • these cells were further engineered to disrupt the genes encoding IFNG and TNFA.
  • the suppressive ability of these cells was assessed in vitro and in vivo.
  • Human CD3+CD4+ T cells were isolated from a leukopak, activated, and transduced with lentivirus constructs to promote overexpression of IL 10 and CTLA4 as described in Example 2.2.
  • the transduced cells were engineered using Cas9 to disrupt the TNFA and IFNG genes.
  • LNPs containing Cas9 mRNA and a sgRNA targeting IFNG (G019753; IFNG guide sequence CCAGAGCAUCCAAAAGAGUG (SEQ ID NO: 14)) or TNFA (G019757; TNFA guide sequence AGAGCUCUUACCUACAACAU (SEQ ID NO: 58)) were formulated as described in Example 1.
  • G019757 mA*mG*mA*GCUCUUACCUACAACAUGUUUUAGAmGmCmUmAmGmAmAmAmU mAmGmCAAGUUAAAAUAAGGCUAGUCCGUUAUCAmAmCmUmUmGmAmAmAm AmAmGmUmGmGmCmAmCmCmGmAmGmUmCmGmGmUmGmCmU*mU*mU*mU*mU (SEQ ID NO: 120)
  • Each LNP preparation was incubated in OpTmizer base media including CTS OpTmizer T Cell Expansion SFM (Gibco, Cat. A3705001), 1% Penicillin-Streptomycin, IX Glutamax, 10 mM HEPES, 2.5% human AB serum (Gemini, Cat. 100-512), 200 U/mL recombinant human interleukin-2, 5 ng/ml recombinant human interleukin 7, and 5 ng/ml recombinant human interleukin- 15 supplemented with 10 ug/ml recombinant human ApoE3 (Peprotech, Cat. 350-02) for 15 minutes at 37°C.
  • CTS OpTmizer T Cell Expansion SFM Gibco, Cat. A3705001
  • Penicillin-Streptomycin IX Glutamax
  • 10 mM HEPES 2.5% human AB serum
  • human AB serum Gibco, Cat. 100-512
  • the transduced T cells were washed and suspended in OpTmizer base media with 200 U/mL recombinant human interleukin-2, 5 ng/ml recombinant human interleukin 7, and 5 ng/ml recombinant human interleukin- 15, along with 2.5% human AB serum (Gemini, Cat. 1 GO- 512).
  • Pre-incubated LNP mix was added to the each 15mL tube to yield a final concentration of 5 ug/ml total RNA, in groups with double knockout final concentration was 10 ug/ml of total RNA.
  • Media supplemented with ApoE3 was used as a vehicle control.
  • T cells were collected, washed, and cultured in T cell RPMI media with cytokines as described in Example 2, for expansion until day of injection (Day 15 post-activation).
  • Target expression was verified by flow cytometry as in Example 2. Data are shown in Table 9 and Figures 5A-5E. Table 9 - Mean fluorescent intensity of CD3+CD4+ cells following T cell engineering

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • Organic Chemistry (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Cell Biology (AREA)
  • Hematology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Microbiology (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Transplantation (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2021/065524 2020-12-30 2021-12-29 Engineered t cells Ceased WO2022147133A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP21848454.1A EP4271799A1 (en) 2020-12-30 2021-12-29 Engineered t cells
AU2021411521A AU2021411521A1 (en) 2020-12-30 2021-12-29 Engineered t cells
MX2023007801A MX2023007801A (es) 2020-12-30 2021-12-29 Células t diseñadas.
CA3206484A CA3206484A1 (en) 2020-12-30 2021-12-29 Engineered t cells
CN202180093689.5A CN116848235A (zh) 2020-12-30 2021-12-29 工程化t细胞
IL304069A IL304069A (en) 2020-12-30 2021-12-29 Engineered T cells
US18/270,261 US20240316100A1 (en) 2020-12-30 2021-12-29 Engineered t cells
KR1020237025734A KR20230153356A (ko) 2020-12-30 2021-12-29 조작된 t 세포
JP2023539978A JP2024502036A (ja) 2020-12-30 2021-12-29 操作されたt細胞

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063131987P 2020-12-30 2020-12-30
US63/131,987 2020-12-30

Publications (1)

Publication Number Publication Date
WO2022147133A1 true WO2022147133A1 (en) 2022-07-07

Family

ID=80050925

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/065524 Ceased WO2022147133A1 (en) 2020-12-30 2021-12-29 Engineered t cells

Country Status (11)

Country Link
US (1) US20240316100A1 (https=)
EP (1) EP4271799A1 (https=)
JP (1) JP2024502036A (https=)
KR (1) KR20230153356A (https=)
CN (1) CN116848235A (https=)
AU (1) AU2021411521A1 (https=)
CA (1) CA3206484A1 (https=)
IL (1) IL304069A (https=)
MX (1) MX2023007801A (https=)
TW (1) TW202235615A (https=)
WO (1) WO2022147133A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115873128A (zh) * 2022-10-14 2023-03-31 武汉波睿达生物科技有限公司 一种靶向表达dsg3表面抗原细胞的融合嵌合抗原受体修饰的t细胞及其应用
CN116042676A (zh) * 2023-01-04 2023-05-02 上海南方模式生物科技股份有限公司 一种基于CRISPR-Cas9构建TNF-α-HiBit动物模型的方法
WO2024006955A1 (en) * 2022-06-29 2024-01-04 Intellia Therapeutics, Inc. Engineered t cells
WO2025128871A2 (en) 2023-12-13 2025-06-19 Renagade Therapeutics Management Inc. Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents
WO2025137439A3 (en) * 2023-12-20 2025-08-07 Intellia Therapeutics, Inc. Engineered t cells
CN121558712A (zh) * 2026-01-26 2026-02-24 四川大学 基于荧光互补筛选细菌膜蛋白折叠机器靶向抑制剂的方法

Citations (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993013121A1 (en) 1991-12-24 1993-07-08 Isis Pharmaceuticals, Inc. Gapped 2' modified oligonucleotides
US5378825A (en) 1990-07-27 1995-01-03 Isis Pharmaceuticals, Inc. Backbone modified oligonucleotide analogs
WO1995032305A1 (en) 1994-05-19 1995-11-30 Dako A/S Pna probes for detection of neisseria gonorrhoeae and chlamydia trachomatis
US5585481A (en) 1987-09-21 1996-12-17 Gen-Probe Incorporated Linking reagents for nucleotide probes
WO2011091324A2 (en) 2010-01-22 2011-07-28 The Scripps Research Institute Methods of generating zinc finger nucleases having altered activity
WO2013176772A1 (en) 2012-05-25 2013-11-28 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2014040370A1 (en) 2012-09-12 2014-03-20 Shanghai Sidansai Biotechnology Co., Ltd Transcription Activator-Like Effector Assembly
WO2014065596A1 (en) 2012-10-23 2014-05-01 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
WO2014136086A1 (en) 2013-03-08 2014-09-12 Novartis Ag Lipids and lipid compositions for the delivery of active agents
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
WO2015095340A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2016010840A1 (en) 2014-07-16 2016-01-21 Novartis Ag Method of encapsulating a nucleic acid in a lipid nanoparticle host
WO2016106121A1 (en) 2014-12-23 2016-06-30 Syngenta Participations Ag Methods and compositions for identifying and enriching for cells comprising site specific genomic modifications
US20160312198A1 (en) 2015-03-03 2016-10-27 The General Hospital Corporation Engineered CRISPR-CAS9 NUCLEASES WITH ALTERED PAM SPECIFICITY
WO2017004279A2 (en) 2015-06-29 2017-01-05 Massachusetts Institute Of Technology Compositions comprising nucleic acids and methods of using the same
US20170114334A1 (en) 2014-06-25 2017-04-27 Caribou Biosciences, Inc. RNA Modification to Engineer Cas9 Activity
WO2017136794A1 (en) 2016-02-03 2017-08-10 Massachusetts Institute Of Technology Structure-guided chemical modification of guide rna and its applications
WO2017173054A1 (en) 2016-03-30 2017-10-05 Intellia Therapeutics, Inc. Lipid nanoparticle formulations for crispr/cas components
WO2018073393A2 (en) 2016-10-19 2018-04-26 Cellectis Tal-effector nuclease (talen) -modified allogenic cells suitable for therapy
WO2018107028A1 (en) 2016-12-08 2018-06-14 Intellia Therapeutics, Inc. Modified guide rnas
WO2018208837A1 (en) 2017-05-08 2018-11-15 Precision Biosciences, Inc. Nucleic acid molecules encoding an engineered antigen receptor and an inhibitory nucleic acid molecule and methods of use thereof
US20180362975A1 (en) 2015-12-04 2018-12-20 Novartis Ag Compositions and methods for immunooncology
WO2019067992A1 (en) 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Formulations
WO2019067910A1 (en) 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. POLYNUCLEOTIDES, COMPOSITIONS AND METHODS FOR GENOMIC EDITION
WO2019147805A2 (en) 2018-01-26 2019-08-01 The Board Of Trustees Of The Leland Stanford Junior University Regulatory t cells targeted with chimeric antigen receptors
WO2019178259A2 (en) * 2018-03-14 2019-09-19 Celledit Llc Modification of immune cells for reducing toxicity and uses thereof in adoptive cell therapy
WO2019191114A1 (en) 2018-03-27 2019-10-03 The Trustees Of The University Of Pennsylvania Modified immune cells having enhanced function and methods for screening for same
WO2019238722A1 (en) 2018-06-13 2019-12-19 Gemoab Monoclonals Gmbh Reversed universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
WO2020081613A1 (en) 2018-10-16 2020-04-23 Intellia Therapeutics, Inc. Compositions and methods for immunotherapy
WO2020092057A1 (en) 2018-10-30 2020-05-07 Yale University Compositions and methods for rapid and modular generation of chimeric antigen receptor t cells
WO2020247805A1 (en) * 2019-06-07 2020-12-10 The Board Of Trustees Of The Leland Stanford Junior University Foxp3 engineered cd4+ t cells for use in treg-based immunotherapy

Patent Citations (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5585481A (en) 1987-09-21 1996-12-17 Gen-Probe Incorporated Linking reagents for nucleotide probes
US5378825A (en) 1990-07-27 1995-01-03 Isis Pharmaceuticals, Inc. Backbone modified oligonucleotide analogs
WO1993013121A1 (en) 1991-12-24 1993-07-08 Isis Pharmaceuticals, Inc. Gapped 2' modified oligonucleotides
WO1995032305A1 (en) 1994-05-19 1995-11-30 Dako A/S Pna probes for detection of neisseria gonorrhoeae and chlamydia trachomatis
WO2011091324A2 (en) 2010-01-22 2011-07-28 The Scripps Research Institute Methods of generating zinc finger nucleases having altered activity
WO2013176772A1 (en) 2012-05-25 2013-11-28 The Regents Of The University Of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
WO2014040370A1 (en) 2012-09-12 2014-03-20 Shanghai Sidansai Biotechnology Co., Ltd Transcription Activator-Like Effector Assembly
WO2014065596A1 (en) 2012-10-23 2014-05-01 Toolgen Incorporated Composition for cleaving a target dna comprising a guide rna specific for the target dna and cas protein-encoding nucleic acid or cas protein, and use thereof
US8889356B2 (en) 2012-12-12 2014-11-18 The Broad Institute Inc. CRISPR-Cas nickase systems, methods and compositions for sequence manipulation in eukaryotes
WO2014136086A1 (en) 2013-03-08 2014-09-12 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2015095340A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
US20170114334A1 (en) 2014-06-25 2017-04-27 Caribou Biosciences, Inc. RNA Modification to Engineer Cas9 Activity
WO2016010840A1 (en) 2014-07-16 2016-01-21 Novartis Ag Method of encapsulating a nucleic acid in a lipid nanoparticle host
WO2016106121A1 (en) 2014-12-23 2016-06-30 Syngenta Participations Ag Methods and compositions for identifying and enriching for cells comprising site specific genomic modifications
US20160312198A1 (en) 2015-03-03 2016-10-27 The General Hospital Corporation Engineered CRISPR-CAS9 NUCLEASES WITH ALTERED PAM SPECIFICITY
US20160312199A1 (en) 2015-03-03 2016-10-27 The General Hospital Corporation Engineered CRISPR-CAS9 Nucleases with Altered PAM Specificity
WO2017004279A2 (en) 2015-06-29 2017-01-05 Massachusetts Institute Of Technology Compositions comprising nucleic acids and methods of using the same
US20180187186A1 (en) 2015-06-29 2018-07-05 Massachusetts Institute Of Technology Compositions comprising nucleic acids and methods of using the same
US20180362975A1 (en) 2015-12-04 2018-12-20 Novartis Ag Compositions and methods for immunooncology
US20190048338A1 (en) 2016-02-03 2019-02-14 Massachusetts Institute Of Technology Structure-guided chemical modification of guide rna and its applications
WO2017136794A1 (en) 2016-02-03 2017-08-10 Massachusetts Institute Of Technology Structure-guided chemical modification of guide rna and its applications
WO2017173054A1 (en) 2016-03-30 2017-10-05 Intellia Therapeutics, Inc. Lipid nanoparticle formulations for crispr/cas components
WO2018073393A2 (en) 2016-10-19 2018-04-26 Cellectis Tal-effector nuclease (talen) -modified allogenic cells suitable for therapy
WO2018107028A1 (en) 2016-12-08 2018-06-14 Intellia Therapeutics, Inc. Modified guide rnas
WO2018208837A1 (en) 2017-05-08 2018-11-15 Precision Biosciences, Inc. Nucleic acid molecules encoding an engineered antigen receptor and an inhibitory nucleic acid molecule and methods of use thereof
WO2019067992A1 (en) 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. Formulations
WO2019067910A1 (en) 2017-09-29 2019-04-04 Intellia Therapeutics, Inc. POLYNUCLEOTIDES, COMPOSITIONS AND METHODS FOR GENOMIC EDITION
WO2019147805A2 (en) 2018-01-26 2019-08-01 The Board Of Trustees Of The Leland Stanford Junior University Regulatory t cells targeted with chimeric antigen receptors
WO2019178259A2 (en) * 2018-03-14 2019-09-19 Celledit Llc Modification of immune cells for reducing toxicity and uses thereof in adoptive cell therapy
WO2019191114A1 (en) 2018-03-27 2019-10-03 The Trustees Of The University Of Pennsylvania Modified immune cells having enhanced function and methods for screening for same
WO2019238722A1 (en) 2018-06-13 2019-12-19 Gemoab Monoclonals Gmbh Reversed universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
WO2020081613A1 (en) 2018-10-16 2020-04-23 Intellia Therapeutics, Inc. Compositions and methods for immunotherapy
WO2020092057A1 (en) 2018-10-30 2020-05-07 Yale University Compositions and methods for rapid and modular generation of chimeric antigen receptor t cells
WO2020247805A1 (en) * 2019-06-07 2020-12-10 The Board Of Trustees Of The Leland Stanford Junior University Foxp3 engineered cd4+ t cells for use in treg-based immunotherapy

Non-Patent Citations (22)

* Cited by examiner, † Cited by third party
Title
ABBAS ET AL., PROC NATL ACAD SCI USA, vol. 114, no. 11, 2017, pages E2106 - E2115
ASSEMAN ET AL.: "An Essential Role for Interleukin 10 in the Function of Regulatory T Cells That Inhibit Intestinal Inflammation", J EXPT MED, vol. 190, no. 7, pages 995 - 1003, XP002241534, DOI: 10.1084/jem.190.7.995
BOCH, TALES OF GENOME TARGETING NATURE BIOTECH, vol. 29, 2011, pages 135 - 136
GORBY ET AL.: "Engineered IL-10 variants elicit potent immuno-modulatory activities at therapeutic low ligand doses", BIORXIV, 2020
GOTTEL ET AL.: "Low-Dose Interleukin-2 Ameliorates Colitis in a Preclinical Humanized Mouse Model", CELL MOL GASTROENTEROL HEPATOL, vol. 8, no. 2, 2019, pages 193 - 195
INABA ET AL., J EXP MED., vol. 176, 1992, pages 1693 - 1702
KARIKO ET AL., NUCLEIC ACIDS RESEARCH, vol. 39, no. 21, 2011, pages e142
KATIBAH ET AL., PROC NATL ACAD SCI USA, vol. 111, no. 33, 2014, pages 12025 - 30
LIQING KANG ET AL: "Interleukin-6-knockdown of chimeric antigen receptor-modified T cells significantly reduces IL-6 release from monocytes", EXPERIMENTAL HEMATOLOGY & ONCOLOGY, BIOMED CENTRAL LTD, LONDON, UK, vol. 9, no. 1, 8 June 2020 (2020-06-08), pages 1 - 13, XP021277581, DOI: 10.1186/S40164-020-00166-2 *
MAKAROVA ET AL., NAT REV MICROBIOL, vol. 13, no. 11, 2015, pages 722 - 36
MEFFERD ET AL., RNA, vol. 21, 2015, pages 1683 - 9
OWEN ET AL.: "Regulatory T Cell Development in the Thymus", J IMMUNOL, vol. 203, no. 8, 2019
PARMAR ET AL.: "Ex vivo fucosylation of third-party human regulatory T cells enhances anti-graft-versus-host disease potency in vivo", BLOOD, vol. 125, no. 9, 2015
PIERINI ET AL.: "T Cells Expressing Chimeric Antigen Receptor Promoter Immune Tolerance", JCI INSIGHT, vol. 2, no. 20, 2017
POWRID ET AL.: "Phenotypically distinct subsets of CD4+ T cells induce or protect from chronic intestinal inflammation in C.B-17 scid mice", INT. IMMUNOL., vol. 5, pages 1461 - 1471
SCHERER ET AL., NUCLEIC ACIDS RES, vol. 35, 2007, pages 2620 - 2628
SHMAKOV ET AL., MOLECULAR CELL, vol. 60, 2015, pages 385 - 397
SWARTS ET AL., NATURE, vol. 507, no. 7491, 2014, pages 258 - 261
THE BIOCHEMISTRY OF THE NUCLEIC ACIDS, 1992, pages 5 - 36
VESTERWENGEL, BIOCHEMISTRY, vol. 43, no. 42, 2004, pages 13233 - 41
XU ET AL.: "Affinity and cross-reactivity engineering of CTLA4-Ig to modulate T cell costimulation", J IMMUNOL, 2012
ZETSCHE ET AL., CELL, vol. 163, 2015, pages 1 - 13

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024006955A1 (en) * 2022-06-29 2024-01-04 Intellia Therapeutics, Inc. Engineered t cells
CN115873128A (zh) * 2022-10-14 2023-03-31 武汉波睿达生物科技有限公司 一种靶向表达dsg3表面抗原细胞的融合嵌合抗原受体修饰的t细胞及其应用
CN116042676A (zh) * 2023-01-04 2023-05-02 上海南方模式生物科技股份有限公司 一种基于CRISPR-Cas9构建TNF-α-HiBit动物模型的方法
WO2025128871A2 (en) 2023-12-13 2025-06-19 Renagade Therapeutics Management Inc. Lipid nanoparticles comprising coding rna molecules for use in gene editing and as vaccines and therapeutic agents
WO2025137439A3 (en) * 2023-12-20 2025-08-07 Intellia Therapeutics, Inc. Engineered t cells
CN121558712A (zh) * 2026-01-26 2026-02-24 四川大学 基于荧光互补筛选细菌膜蛋白折叠机器靶向抑制剂的方法

Also Published As

Publication number Publication date
TW202235615A (zh) 2022-09-16
JP2024502036A (ja) 2024-01-17
AU2021411521A9 (en) 2025-03-06
KR20230153356A (ko) 2023-11-06
AU2021411521A1 (en) 2023-08-03
CN116848235A (zh) 2023-10-03
CA3206484A1 (en) 2022-07-07
MX2023007801A (es) 2023-08-21
EP4271799A1 (en) 2023-11-08
US20240316100A1 (en) 2024-09-26
IL304069A (en) 2023-08-01

Similar Documents

Publication Publication Date Title
US20240316100A1 (en) Engineered t cells
CA3091688A1 (en) Expression of foxp3 in edited cd34+ cells
KR20220097985A (ko) Car-t 세포의 제조 방법
CN118389602A (zh) 经人工操纵的免疫细胞
US20230346836A1 (en) Genetically engineered t cells with disrupted casitas b-lineage lymphoma proto-oncogene-b (cblb) and uses thereof
US20250268940A1 (en) Chimeric antigen receptor compositions and uses
JP2024534720A (ja) 遺伝子改変細胞を作製するための方法
US20240327862A1 (en) Methods of Treating Rheumatoid Arthritis Using RNA-Guided Genome Editing of HLA Gene
US20240175013A1 (en) Biallelic knockout of trac
US20220168342A1 (en) Genome edited primary b cell and methods of making and using
AU2023299294A1 (en) Engineered t cells
KR20250037790A (ko) 세포에서 mhc 클래스 i를 감소시키기 위한 조성물 및 방법
WO2024023804A2 (en) Genetically engineered immune cells having disrupted transporter associated with antigen processing binding protein (tapbp) gene
WO2024023802A2 (en) Genetically engineered immune cells having disrupted transporter associated with antigen processing-2 (tap-2) gene
WO2025137439A2 (en) Engineered t cells
US20230128917A1 (en) Genetically engineered immune cells having a disrupted cd83 gene
WO2023081900A1 (en) Engineered t cells expressing a recombinant t cell receptor (tcr) and related systems and methods
AU2024240582A1 (en) Methods for creating regulatory t cells (tregs) using genome engineering
EP3818148A1 (en) Transduction of innate immunocompetent cells using aav6

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21848454

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3206484

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/007801

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2023539978

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021411521

Country of ref document: AU

Date of ref document: 20211229

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021848454

Country of ref document: EP

Effective date: 20230731

WWE Wipo information: entry into national phase

Ref document number: 202180093689.5

Country of ref document: CN