WO2022139537A2 - 뮤신 1에 특이적인 폴리펩티드 및 이의 이용 - Google Patents

뮤신 1에 특이적인 폴리펩티드 및 이의 이용 Download PDF

Info

Publication number
WO2022139537A2
WO2022139537A2 PCT/KR2021/019790 KR2021019790W WO2022139537A2 WO 2022139537 A2 WO2022139537 A2 WO 2022139537A2 KR 2021019790 W KR2021019790 W KR 2021019790W WO 2022139537 A2 WO2022139537 A2 WO 2022139537A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
region
amino acid
cells
acid sequence
Prior art date
Application number
PCT/KR2021/019790
Other languages
English (en)
French (fr)
Other versions
WO2022139537A3 (ko
WO2022139537A4 (ko
WO2022139537A9 (ko
Inventor
이지현
이해연
최윤아
이대관
최정원
박아름
정샘
송유림
나규봉
박민정
전은지
최규홍
이효주
양희정
장성웅
Original Assignee
주식회사 엘지화학
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN202180086168.7A priority Critical patent/CN116670162A/zh
Application filed by 주식회사 엘지화학 filed Critical 주식회사 엘지화학
Priority to PE2023001953A priority patent/PE20240117A1/es
Priority to EP21911602.7A priority patent/EP4265640A2/en
Priority to CA3203067A priority patent/CA3203067A1/en
Priority to AU2021410416A priority patent/AU2021410416A1/en
Priority to MX2023007665A priority patent/MX2023007665A/es
Priority to IL303902A priority patent/IL303902A/en
Priority to JP2023539197A priority patent/JP2024503803A/ja
Publication of WO2022139537A2 publication Critical patent/WO2022139537A2/ko
Publication of WO2022139537A3 publication Critical patent/WO2022139537A3/ko
Publication of WO2022139537A4 publication Critical patent/WO2022139537A4/ko
Publication of WO2022139537A9 publication Critical patent/WO2022139537A9/ko
Priority to CONC2023/0009764A priority patent/CO2023009764A2/es

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • C07K16/3092Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/461Cellular immunotherapy characterised by the cell type used
    • A61K39/4611T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/463Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631Chimeric Antigen Receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/464Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643Vertebrate antigens
    • A61K39/4644Cancer antigens
    • A61K39/464469Tumor associated carbohydrates
    • A61K39/46447Mucins, e.g. MUC-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70517CD8
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/49Breast
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
    • A61K2239/54Pancreas
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • a polypeptide that binds to Mucin1 an isolated polynucleotide encoding the same, a vector comprising the polynucleotide, and a cell comprising the vector.
  • a chimeric antigen receptor comprising a polypeptide that binds to mucin1
  • an isolated polynucleotide encoding the chimeric antigen receptor an isolated polynucleotide encoding the chimeric antigen receptor
  • a vector comprising the polynucleotide, an immune cell expressing the chimeric antigen receptor, and cancer comprising the same It relates to therapeutic compositions and methods of treatment.
  • Mucin1 is a membrane-bound glycoprotein present in epithelial cells of almost all organs in the body.
  • Mucin1 is a heterodimeric protein formed from the non-covalent interaction of an N-terminal subunit (MUC1-N) and a C-terminal subunit (MUC1-C).
  • MUC1-C forms the extracellular domain, transmembrane domain and cytoplasmic tail, and MUC1-N repeatedly contains tandem repeats (TRs) containing 20 amino acids (HGVTSAPDTRPAPGSTAPPA), including glycosylation sites, , interacts with the extracellular domain of MUC1-C and remains associated with MUC1-C.
  • TRs tandem repeats
  • HGVTSAPDTRPAPGSTAPPA tandem repeats containing 20 amino acids
  • mucin 1 In normal epithelial cells, mucin 1 is expressed at a low level and is restricted to the apical membranes of the epithelium, but it is used in breast cancer, lung cancer, colorectal cancer, skin cancer, thyroid cancer, stomach cancer, pancreatic cancer, kidney cancer, ovarian cancer and cervical cancer. It is known to be overexpressed in solid cancer cells, randomly expressed on the entire cell surface, and abnormally glycosylated. Therefore, mucin1 is known to be useful as a target molecule for detecting cancer lesions or as a target molecule for treating cancer.
  • a polypeptide that binds to Mucin1 is provided.
  • Another example provides an isolated polynucleotide encoding the mucin1-binding polypeptide.
  • Another example provides a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
  • Another example provides a cell comprising a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
  • Another example provides a chimeric antigen receptor comprising the mucin1-binding polypeptide.
  • Another example provides an isolated polynucleotide encoding the chimeric antigen receptor.
  • Another example provides a vector comprising a polynucleotide encoding the chimeric antigen receptor.
  • Another example provides an immune cell expressing the chimeric antigen receptor or comprising a polynucleotide encoding the chimeric antigen receptor.
  • mucin1-binding polypeptide examples include the mucin1-binding polypeptide; an isolated polynucleotide encoding said mucin1-binding polypeptide; a vector comprising a polynucleotide encoding said mucin1-binding polypeptide; a cell comprising a polynucleotide encoding said mucin1-binding polypeptide; a chimeric antigen receptor comprising said mucin1-binding polypeptide; an isolated polynucleotide encoding said chimeric antigen receptor; a vector comprising a polynucleotide encoding the chimeric antigen receptor; Or comprising a polynucleotide encoding the chimeric antigen receptor or comprising an immune cell expressing the chimeric antigen receptor, it provides a composition for the treatment of cancer.
  • cytokine 1 is a cytokine that evaluates the reactivity to MUC1-positive tumor cells (T47D, HEK293T-V1) of CAR-T cells according to an embodiment of the present application prepared using donor 03 and donor 04-derived T cells. secretion analysis results.
  • FIG. 2 is a cytokine secretion analysis result for evaluating the reactivity of the CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells to MUC1-positive tumor cells (T47D).
  • FIG 3 is a cytokine secretion analysis result of evaluating the reactivity of CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells to mucin 1 non-expressing cells (HEK293T).
  • CAR-T cells is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 03-derived T cells, against T47D, a human breast cancer cell line.
  • CAR-T cells prepared using donor 04-derived T cells, which is a human breast cancer cell line, T47D.
  • CAR-T cells prepared using donor 03-derived T cells against HEK293T, a human embryonic kidney cell.
  • CAR-T cells prepared using donor 04-derived T cells against HEK293T, a human embryonic kidney cell.
  • CAR-T cells prepared using donor 04-derived T cells against HEK293T-V1 in which MUC1-C was exogenously expressed in a human embryonic kidney cell line.
  • CAR-T cells 9 is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 05-derived T cells, against T47D, a human breast cancer cell line.
  • CAR-T cells 10 is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells, against T47D, a human breast cancer cell line.
  • CAR-T cells are a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 07-derived T cells, against HEK293T, a human embryonic kidney cell.
  • CAR-T cells is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 08-derived T cells against HCC70, a human breast cancer cell line. #2: 2447_2H08; #3: 2447_3A01; #4: 2447_3A08; #5: 2447_3A09; #6: 2447_3A12; #7: 2447_3B07; #8: 2447_3C08; #9: 2447_3H02; #10: 2447_3H08.
  • FIG. 13 is a CAR-T cell according to an embodiment of the present application at a ratio of effector cells (E) to target cells (T) of 0.3:1 against a human breast cancer cell line (HCC70) and a human normal breast cell line (MCF10A). Phosphorus cytotoxicity results are shown. #2: 2447_2H08.
  • CAR-T cell is a CAR-T cell according to an embodiment of the present disclosure at a ratio of effector cells (E) to target cells (T) of 0.1:1 against a human breast cancer cell line (HCC70) and a human normal breast cell line (MCF10A). Phosphorus cytotoxicity results are shown. #2: 2447_2H08.
  • PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
  • human immune cells in blood 14 days and 28 days after administration of CAR-T cells according to an embodiment of the present application This is the result of confirming the number of (hCD45+ cells).
  • FIG. 17 is a cancer animal model injected with PANC1-v1 cells (PANC1 pancreatic cancer cells expressing MUC1), the results of confirming tumor growth inhibition after administration of two doses of CAR-T cells according to an embodiment of the present application .
  • PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
  • HCC1954 cells naturally expressed breast cancer cells
  • human immune cells hCD45+ cells
  • a polypeptide that binds to Mucin1 there is provided a polypeptide that binds to Mucin1.
  • the polypeptide binding to mucin 1 herein may be an antibody or antigen-binding fragment thereof.
  • a polypeptide that binds to Mucin1 comprising a pair of a heavy chain variable (VH) region and a light chain variable (VL) region selected from the group consisting of:
  • VH region comprising complementarity determining regions (CDRs) 1, 2 and 3 described by the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, respectively, and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, respectively a VL region comprising CDRs 1, 2 and 3 described in amino acid sequence;
  • CDRs complementarity determining regions
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13, respectively, and amino acid sequences of SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID NO: 23, respectively, and amino acid sequences of SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 31, SEQ ID NO: 32 and SEQ ID NO: 33, respectively, and amino acid sequences of SEQ ID NO: 44, SEQ ID NO: 45 and SEQ ID NO: 46, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 51, SEQ ID NO: 52 and SEQ ID NO: 53, respectively, and amino acid sequences of SEQ ID NO: 54, SEQ ID NO: 55 and SEQ ID NO: 56, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 61, SEQ ID NO: 62 and SEQ ID NO: 63, respectively, and amino acid sequences of SEQ ID NO: 64, SEQ ID NO: 65 and SEQ ID NO: 66, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 71, SEQ ID NO: 72 and SEQ ID NO: 73, respectively, and amino acid sequences of SEQ ID NO: 74, SEQ ID NO: 75 and SEQ ID NO: 76, respectively a VL region comprising CDRs 1, 2 and 3;
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 81, SEQ ID NO: 82 and SEQ ID NO: 83, respectively, and amino acid sequences of SEQ ID NO: 84, SEQ ID NO: 85 and SEQ ID NO: 86, respectively a VL region comprising CDRs 1, 2 and 3; and
  • VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 91, SEQ ID NO: 92 and SEQ ID NO: 93, respectively, and amino acid sequences of SEQ ID NO: 94, SEQ ID NO: 95 and SEQ ID NO: 96, respectively VL region comprising CDRs 1, 2 and 3.
  • a polypeptide that binds to Mucin1 comprising a pair of a heavy chain variable (VH) region and a light chain variable (VL) region selected from the group consisting of: - comprising the amino acid sequence of SEQ ID NO:7 a VH region and a VL region comprising the amino acid sequence of SEQ ID NO: 8; a VH region comprising the amino acid sequence of SEQ ID NO: 17 and a VL region comprising the amino acid sequence of SEQ ID NO: 18;
  • VH region comprising the amino acid sequence of SEQ ID NO: 27 and a VL region comprising the amino acid sequence of SEQ ID NO: 28;
  • VH region comprising the amino acid sequence of SEQ ID NO: 37 and a VL region comprising the amino acid sequence of SEQ ID NO: 38;
  • VH region comprising the amino acid sequence of SEQ ID NO: 47 and a VL region comprising the amino acid sequence of SEQ ID NO: 48;
  • VH region comprising the amino acid sequence of SEQ ID NO: 57 and a VL region comprising the amino acid sequence of SEQ ID NO: 58;
  • VH region comprising the amino acid sequence of SEQ ID NO: 67 and a VL region comprising the amino acid sequence of SEQ ID NO: 68;
  • VH region comprising the amino acid sequence of SEQ ID NO: 77 and a VL region comprising the amino acid sequence of SEQ ID NO: 78;
  • VH region comprising the amino acid sequence of SEQ ID NO: 87 and a VL region comprising the amino acid sequence of SEQ ID NO: 88;
  • VH region comprising the amino acid sequence of SEQ ID NO: 97 and a VL region comprising the amino acid sequence of SEQ ID NO: 98.
  • antibody is used in the broadest sense as a generic term for a protein that specifically binds to a specific antigen, and a protein produced by stimulation of an antigen in the immune system or a chemically synthesized or recombinantly prepared protein. may be, and the type is not particularly limited. Specifically, a monoclonal antibody (including a full-length monoclonal antibody), a polyclonal antibody, a multispecific antibody (eg, a bispecific antibody), a synthetic antibody (also called an antibody mimic), a chimeric antibody, a humanized antibody, as long as it exhibits the desired biological activity It encompasses antibodies, human antibodies, or antibody fusion proteins (also called antibody conjugates).
  • a complete antibody (eg, type IgG) is a structure having two full length light chains and two full length heavy chains, each light chain being It is connected to the heavy chain by disulfide bonds.
  • the constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has a gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) or epsilon ( ⁇ ) type, subclass gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), gamma 3 ( ⁇ 3), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) or alpha 2 ( ⁇ 2).
  • the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
  • antigen-binding fragment refers to a portion of an antibody that lacks at least some of the amino acids present in its full-length chain but is still capable of specifically binding an antigen. Such fragments are biologically active in that they bind to the target antigen and are able to compete with other antigen binding molecules, including intact antibodies, for binding to a given epitope.
  • the antigen binding fragment may not comprise the constant heavy chain domains of the Fc region of an intact antibody (ie, depending on the antibody isotype ie CH2, CH3 and CH4).
  • antigen-binding fragments include single chain variable fragment (scFv) (eg, scFv, (scFv) 2 , etc.), fragment antigen binding (Fab) (eg, Fab, Fab', F(ab') 2 , etc.) ), domain antibodies, peptibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies or single-chain antibodies, and the like.
  • scFv single chain variable fragment
  • Fab fragment antigen binding
  • domain antibodies peptibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies or single-chain antibodies, and the like.
  • Antigen-binding fragments also include scFvs, or fusion polypeptides (scFv-Fc) wherein the scFv is fused to the Fc region of an immunoglobulin (eg, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, etc.) Or it may be a fusion polypeptide (scFv-Ck (kappa constant region) or scFv-C ⁇ (lambda constant region)) fused to the constant region (eg, kappa or lambda) of the light chain, but is not limited thereto.
  • an immunoglobulin eg, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, etc.
  • scFv-Ck kappa constant region
  • scFv-C ⁇ lacambd
  • variable chain refers to a variable region domain V H comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen and three constant region domains C H1 , C H2 and C H3 and a hinge ( hinge) is interpreted as meaning including all the full-length heavy chains and fragments thereof.
  • light chain refers to both a full-length light chain comprising a variable region domain VL and a constant region domain CL comprising an amino acid sequence having a sufficient variable region sequence to confer specificity to an antigen, and fragments thereof. interpreted as including
  • CDR complementarity-determining regions
  • Framework region refers to the non-CDR portions of the variable regions of heavy and light chains, generally comprising four FRs (FR-H1, FR-H2, FR-H3 and FR- H4), and there are four FRs (FR-L1, FR-L2, FR-L3 and FR-L4) in the light chain variable region.
  • the exact amino acid sequence boundaries of a given CDR or FR are determined by a number of well-known systems, including the Kabat numbering system, Chothia numbering system, Contact numbering system, IMGT numbering system, Aho numbering system, AbM numbering system, etc. It can be easily determined using any one of them.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding an antibody to an antigen.
  • the heavy chain variable (VH) and light chain variable (VL) regions generally have a similar structure, each domain comprising four conserved framework regions (FR) and three CDRs.
  • the mucin 1-binding polypeptide of the present application is a single chain variable fragment (scFv), peptibody, fragment antigen binding (Fab), monoclonal antibody, bispecific antibody, minibody, domain antibody, synthetic antibody, chimeric antibody , a humanized antibody, a human antibody, or an antibody fusion protein, but is not limited thereto.
  • the mucin 1-binding polypeptide of the present application may be a single chain variable fragment (scFv).
  • scFv single chain variable fragment
  • VH heavy chain variable
  • VL light chain variable
  • the linker may be a water-soluble and/or flexible linker.
  • the N-terminus of VH and the C-terminus of VL may be connected by a linker, or the C-terminus of VH and N-terminus of VL may be connected.
  • the linker may be a peptide linker, for example 10 to 30 amino acids in length, 10 to 25 amino acids in length, 10 to 20 amino acids in length, 10 to 15 amino acids in length, 15 to 30 amino acids in length, 15 to 25 amino acids in length, 15 to 20 amino acids in length.
  • amino acid length specifically 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid length may be, but is not limited thereto.
  • the linker may be rich in glycine (Gly) for flexibility, and may include serine (Ser), asparagine (Asn), alanine (Ala) or threonine (Thr) for solubility.
  • the linker may be composed of a total of 1 to 100, 2 to 50, or 5 to 25 of one or more selected from the group consisting of Gly, Asn, Ser, Thr, and Ala.
  • the amino acid sequence of the linker may be a sequence in which GGGS or GGGGS has a variable number of repeats, such as 2, 3, 4 and 5 repeats.
  • the linker can be, but is not limited to, GGGGSGGGGSGGGGS, GGGGSGGGGSGGGGGGSGGGGS, or GGGGSGGGGSGGGAS.
  • the scFv retains the antigenic specificity of the parent antibody despite the absence of a constant region and the introduction of a linker.
  • the scFv may be expressed from a polynucleotide encoding a VH region and a VL region, but is not limited thereto.
  • SEQ ID NO: 9 selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 39, SEQ ID NO: 49, SEQ ID NO: 59, SEQ ID NO: 69, SEQ ID NO: 79, SEQ ID NO: 89 and SEQ ID NO: 99
  • SEQ ID NO: 9 selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 39, SEQ ID NO: 49, SEQ ID NO: 59, SEQ ID NO: 69, SEQ ID NO: 79, SEQ ID NO: 89 and SEQ ID NO: 99
  • An scFv polypeptide comprising an amino acid sequence is provided.
  • An antibody or antigen-binding fragment herein is a variant that possesses equivalent activity, e.g., about 80%, about 81%, about 82%, about 83%, about 84%, about 85% of the amino acid sequences described herein. , about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about Variants having 98% or greater than about 99% identity and equivalent biological activity may also be included in the scope of the present application.
  • an isolated polynucleotide encoding said mucin1-binding polypeptide.
  • the polynucleotide consists of SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 40, SEQ ID NO: 50, SEQ ID NO: 60, SEQ ID NO: 70, SEQ ID NO: 80, SEQ ID NO: 90 and SEQ ID NO: 100 It may include a nucleic acid sequence selected from the group.
  • the present invention also has about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% identity to the sequence. and may include an isolated polynucleotide encoding a polypeptide having equivalent activity.
  • polynucleotides may be codon optimized for expression in humans.
  • a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
  • the polynucleotide may be operably linked to a promoter.
  • operatively linked refers to a functional linkage between a nucleotide expression control sequence (eg, a promoter sequence) and another nucleotide sequence.
  • the regulatory sequences may be operably linked to regulate the transcription and/or translation of other nucleotide sequences.
  • Vectors can be constructed, typically as vectors for cloning or as vectors for expression.
  • the expression vector may be a conventional vector used to express a foreign protein in plants, animals or microorganisms in the art.
  • the vector can be constructed through various methods known in the art.
  • a vector can be constructed using a prokaryotic cell or a eukaryotic cell as a host.
  • a prokaryotic cell when the vector used is an expression vector and a prokaryotic cell is used as a host, a strong promoter capable of proceeding transcription (eg, pL ⁇ promoter, CMV promoter, trp promoter, lac promoter, tac promoter, T7) promoter, etc.), a ribosome binding site for initiation of translation, and transcription/translation termination sequences.
  • the replication origin operating in the eukaryotic cell contained in the vector includes the f1 origin of replication, the SV40 origin of replication, the pMB1 origin of replication, the adeno origin of replication, the AAV origin of replication and the BBV origin of replication. It is not limited.
  • a promoter derived from the genome of a mammalian cell eg, a metallotionine promoter
  • a promoter derived from a mammalian virus eg, adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter and tk promoter of HSV
  • it may further include an enhancer sequence, 5'-side and 3'-side untranslated regions, a secretion signal sequence, a splicing junction, a selection marker (eg, an antibiotic resistance gene), and the like.
  • a cell comprising a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
  • the cell may be obtained by introducing the vector into an appropriate host cell.
  • a host cell containing the vector may be useful for cloning or expression of a polynucleotide contained in the vector.
  • any host cell known in the art may be used as a cell capable of cloning or expressing the vector stably and continuously.
  • prokaryotic cells include, for example, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E.
  • yeast Saccharomyce cerevisiae
  • insect cells plant cells and animal cells
  • Sp2/0 Chinese hamster ovary (CHO) K1
  • CHO DG44 PER.C6, W138
  • BHK COS-7
  • COS-7 293, HepG2, Huh7 , 3T3, RIN, MDCK cell lines, etc.
  • Transport introduction of the polynucleotide or a vector containing the same into a host cell
  • a transport method well known in the art may be used.
  • the transport method for example, when the host cell is a prokaryotic cell, CaCl 2 method or electroporation method, etc. can be used, and when the host cell is a eukaryotic cell, microinjection method, calcium phosphate precipitation method, electroporation method, Liposome-mediated transfection and gene bombardment may be used, but are not limited thereto.
  • the method of selecting the transformed host cell can be easily performed according to a method well known in the art, using the phenotype expressed by the selection marker.
  • the selection marker is a specific antibiotic resistance gene
  • the transformant can be easily selected by culturing the transformant in a medium containing the antibiotic.
  • the transformed host cell can be cultured for a period sufficient for the expression or secretion of the polypeptide, and separation and purification methods used in conventional proteins, for example, salting out, solvent precipitation, etc.
  • Polypeptides can be separated and purified by a method using a difference in hydrophobicity, such as reverse phase high performance liquid chromatography, and a method using a difference in isoelectric point such as isoelectric point electrophoresis.
  • a chimeric antigen receptor comprising the mucin 1-binding polypeptide.
  • the mucin1-binding polypeptides are suitable for use in chimeric antigen receptors because they can be engineered to be expressed as part of a single chain along with other CAR components.
  • a chimeric antigen receptor typically comprises an extracellular domain comprising a mucin1-binding polypeptide; transmembrane domain; It may include an intracellular signaling domain or T cell activation domain.
  • the extracellular domain may further include a spacer region (or hinge region) between the polypeptide and the transmembrane domain.
  • the chimeric antigen receptor may further comprise one or more co-stimulatory domains, preferably the co-stimulatory domain is located between the transmembrane domain and the intracellular signaling domain.
  • the chimeric antigen receptor comprises an extracellular domain comprising a mucin1-binding polypeptide; hinge domain; transmembrane domain; one or more costimulatory domains; and an intracellular signal transduction domain.
  • Each domain may be heterogeneous. That is, it may consist of sequences derived from different protein chains.
  • Each domain may be joined by a short oligo- or polypeptide linker, for example a linker between 2 and 10 amino acids in length.
  • the chimeric antigen receptor may consist of one polypeptide chain to which each domain is linked.
  • the extracellular domain comprises a mucin1-binding polypeptide as described above, which recognizes mucin1 expressed on the surface of cancer cells.
  • the extracellular domain may further comprise a spacer region (or hinge region).
  • a spacer region may be positioned between the mucin1-binding polypeptide and the transmembrane domain.
  • the spacer region allows the mucin1-binding polypeptide to more flexibly recognize the target antigen at a certain distance from the cell membrane of the CAR-T cell.
  • the spacer region may typically be a polypeptide and may be at least 10 amino acids in length, for example 10 to 300 amino acids in length, 10 to 250 amino acids in length, 10 to 200 amino acids in length, 10 to 150 amino acids in length, 10 to 100 amino acids in length, It may have a length of 10 to 50 amino acids, but is not limited thereto.
  • the spacer region may exemplify the hinge region of CD8 ⁇ or CD28, or the constant region of immunoglobulin (IgG), and a mutation may be introduced to remove the off-target effect by these.
  • the immunoglobulin constant region may be derived from the IgG hinge alone, all or part of the CH2 and CH3 domains, eg an Fc region.
  • IgG may preferably be IgG2 or IgG4.
  • the spacer can be a chimeric polypeptide containing one or more of the hinge, CH2 and CH3 sequences derived from IgG2, IgG4, and/or IgG2 and IgG4.
  • the hinge domain may be represented by the sequence of SEQ ID NO: 112, but is not limited thereto.
  • the transmembrane domain serves to connect the cell membrane domain and the signaling domain inside the cell membrane, and may be derived from a natural or synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
  • the transmembrane domain may be the alpha, beta or zeta chain of a T cell receptor, CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, It may be a transmembrane domain of CD137 or CD154, but is not limited thereto.
  • the transmembrane domain may be a transmembrane domain of CD28 or CD8, but is not limited thereto.
  • the synthetic transmembrane domain may include hydrophobic residues such as leucine and valine, and may include phenylalanine, tryptophan, and valine at each end, but is not limited thereto.
  • the transmembrane domain may be represented by the sequence of SEQ ID NO: 113, but is not limited thereto.
  • the co-stimulatory domain is a site to which a co-stimulatory signal is transmitted, and is a site to transmit a signal to cause an immune response and self-proliferation of CAR-T cells. It can be selectively introduced to enhance the proliferation, cytotoxicity, sustained response, life extension of CAR-T cells, and the like.
  • the costimulatory domains are CD28, OX-40 (CD134), 4-1BB (CD137), CD2, CD7, CD27, CD30, CD40, PD-1, ICOS, LFA-1 (CD11a/CD18), CD3 gamma, CD3 delta , CD3 epsilon, CD247, CD276 (B7-H3), LIGHT, (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class 1 molecule, TNF receptor protein, immunoglobulin protein, cytoplasmic Cain receptor, integrin, signaling lymphocytic activation molecule (SLAM), activating NK cell receptor, BTLA, toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2 , SLAMF7, NKp80 (KLRF1), NKp44, NK
  • one or more selected from the signaling sites of CD28, OX-40 (CD134), 4-1BB (CD137), CD27 or ICOS may be one, two or three, but not limited
  • the costimulatory domain may be represented by the sequence of SEQ ID NO: 114, but is not limited thereto.
  • the intracellular signaling domain is a site that activates a T cell immune response to an antigen bound to a mucin1-binding polypeptide.
  • the signaling domain may be a component of the T cell receptor (TCR) or contain a signaling motif known as an immunoreceptor tyrosine-based activation motif (ITAM).
  • TCR T cell receptor
  • ITAM immunoreceptor tyrosine-based activation motif
  • the signaling domain may be, but is not limited to, a signaling domain derived from TCR or CD3 zeta, FcR gamma, CD3 gamma, CD3 delta and CD3 epsilon.
  • a preferred example may be the signaling domain of CD3 zeta, but is not limited thereto.
  • the intracellular signaling domain is capable of activating a CAR-T cell upon binding of the mucin1-binding polypeptide portion of the extracellular domain to a target.
  • CARs can stimulate the function of T cells, such as cytolytic activity or T-helper activity, and induce secretion of cytokines or other factors.
  • the intracellular signal transduction domain may be represented by the sequence of SEQ ID NO: 115, but is not limited thereto.
  • the CAR may be expressed in a form comprising a signal sequence.
  • the CAR can also be expressed with additional sequences useful for monitoring expression, for example, ribosomal skip sequences such as the 2A peptide or truncated cell surface polypeptides (such as tHER2 or tEGFR or truncated PSMA).
  • polynucleotide encoding the chimeric antigen receptor.
  • polynucleotides may be codon optimized for expression in humans.
  • a vector comprising a polynucleotide encoding the chimeric antigen receptor.
  • the vector may be constructed as a vector for gene cloning, a vector for protein expression, or a vector for gene delivery. In the case of a vector for cloning or expression, the details are as described above.
  • the vector may be a viral vector.
  • a vector may be a retroviral vector, a DNA vector, a murine leukemia virus vector, a SFG vector, a plasmid, an RNA vector, an adenoviral vector, a baculovirus vector, an Epstein Barr virus vector, a papovavirus vector, a vaccinia virus vector, It may be, but is not limited to, a herpes simplex virus vector, an adenovirus associated vector (AAV), or a lentiviral vector.
  • AAV adenovirus associated vector
  • an immune cell expressing a chimeric antigen receptor comprising the mucin1-binding polypeptide.
  • Immune cells include, but are not limited to, T cells, Tumor Infiltrating Lymphocytes (TILs), Natural killer (NK) cells, TCR-expressing cells, dendritic cells, or NK-T cells.
  • TILs Tumor Infiltrating Lymphocytes
  • NK Natural killer
  • TCR-expressing cells TCR-expressing cells
  • dendritic cells dendritic cells
  • NK-T cells NK-T cells.
  • the immune cells may be derived from human induced pluripotent stem cells (iPSCs). Immune cells can be derived from any known source. For example, immune cells can be differentiated in vitro from a hematopoietic stem cell population or obtained from a patient.
  • Immune cells can be obtained from, for example, peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from the site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • PBMC peripheral blood mononuclear cells
  • the immune cells may be derived from one or more immune cell lines available in the art.
  • Immune cells may be autologous or allogenic. Autologous means those derived from the patient to be treated. Allogeneic means that it is derived from another individual of the same species as the patient to be treated.
  • the immune cells may be derived from human induced pluripotent stem cells (iPSCs). Compared to autologous or allogeneic immune cells, iPSC-derived immune cells can self-proliferate, so mass-proliferation is easy.
  • iPSCs human induced pluripotent stem cells
  • Immune cells can be produced by microinjection, electroporation, sonication, biolistics (eg, gene gun), lipid transfection, polymer transfection, calcium phosphate precipitation, protoplast fusion, liposome-mediated transfection, nanoparticles or polyplexes, etc. It can be transfected or transduced with a vector using the method of, but is not limited thereto.
  • composition for preventing or treating cancer comprising a T cell comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide.
  • the prevention and/or treatment of cancer comprising administering to a patient in need thereof an effective amount of a T cell comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide or a method of treatment is provided.
  • the cancer may be a solid cancer or a blood cancer, including, but not limited to, breast cancer, lung cancer, prostate cancer, ovarian cancer, brain cancer, liver cancer, cervical cancer, endometrial cancer, uterine cancer, colon cancer, colorectal cancer, colorectal cancer , rectal cancer, kidney cancer, nephroblastoma, skin cancer, oral squamous cell carcinoma, epidermal cancer, nasopharyngeal cancer, head and neck cancer, bone cancer, esophageal cancer, bladder cancer, lymphatic duct cancer (eg Hodgkin's lymphoma or non-Hodgkin's lymphoma), stomach cancer, Pancreatic cancer, testicular cancer, thyroid cancer, thyroid follicular cancer, melanoma, myeloma, multiple myeloma, mesothelioma, osteosarcoma, myelodysplastic syndrome, tumor of mesenchymal origin, soft tissue sarcoma, lipo
  • the lung cancer may be, for example, small cell lung carcinoma (SCLC) or non-small cell lung carcinoma (NSCLC).
  • the leukemia can be, for example, acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), acute lymphocytic leukemia (ALL) or chronic lymphocytic leukemia (CLL).
  • the cancer is a cancer in which the MUC1 protein is expressed, and may be breast cancer, skin cancer, pancreatic cancer, prostate cancer, lung cancer, thyroid cancer, stomach cancer, ovarian cancer, colorectal cancer, liver cancer, gallbladder cancer, kidney cancer, cervical cancer, or bladder cancer,
  • the present invention is not limited thereto.
  • the cancer may be a primary cancer or a metastatic cancer.
  • the patient to be treated may be a patient receiving second-line anti-hyperproliferative therapy.
  • the second-line anti-hyperproliferative therapy may be chemotherapy, radiation therapy, immunotherapy, phototherapy, cryotherapy, toxin therapy, hormone therapy, or surgery.
  • T cells comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide of the present application
  • the mucin 1-binding polypeptide of the present application genetically engineered to express a chimeric antigen receptor containing
  • the step of extracting T cells from the blood of a healthy person or a patient to be treated is, for example, a process of separating leukocytes from blood using leukapheresis or aphresis and then concentrating the T cells.
  • T cells can be extracted through T cells can be isolated using specific antibody bead conjugates or markers at the CD4/CD8 constitutive level. Alternatively, it is also possible to stably obtain a large amount of T cells through differentiation from stem cells.
  • the step of genetically engineering the extracted T cells to express the chimeric antigen receptor may include, for example, converting a nucleic acid molecule designed to express a chimeric antigen receptor (CAR) into a vector, for example, a viral vector (lenti Viral vectors or retroviral vectors, etc.) can be used for injection into T cells.
  • the CAR may be introduced in the form of DNA or may be introduced in the form of RNA and then reverse transcribed into DNA by a reverse transcriptase and then integrated into the genome of the T cell.
  • genetic manipulation to remove or correct genes inducing transplant rejection in donor T cells may be additionally applied to prevent rejection, such as graft-versus-host disease (GvHD).
  • GvHD graft-versus-host disease
  • the T cells may be cultured, proliferated and expanded according to a culture technique known in the art. At this time, safety for the use of viruses and technology for selecting well-made CAR-T cells are required.
  • the step of re-administering the engineered T cells to the patient may consist of, for example, infusion.
  • the patient before injection of CAR-T cells, the patient may receive chemotherapy to control lymphocyte removal using cyclophosphamide or fludarabine, etc. to lower the white blood cell count.
  • cytokines such as IL-2 may be administered together.
  • Engineered T cells administered to a patient can mediate an immune response against tumor cells expressing mucin1. These immune responses include activation of T cells, secretion of cytokines such as IL-2 and IFN-gamma by T cells, proliferation and expansion of T cells that recognize tumor antigens, and T cell-mediated T cell-mediated specific killing (removal of the tumor).
  • T cells are activated through phosphorylation of an immunoreceptor tyrosine-based activation motif (ITAM) of CD3 zeta, and then, T Cell proliferation, cytotoxicity and/or cytokine secretion may be induced.
  • ITAM immunoreceptor tyrosine-based activation motif
  • anticancer therapy using CAR-T cells fundamentally activates the patient's immune system and exerts a continuous anticancer effect, so it does not need to be administered continuously. There is this.
  • compositions herein can elicit, induce, or promote an immune response that inhibits, arrests, delays, or prevents the onset or progression of a disease state.
  • the term "effective amount” means an amount sufficient to achieve the desired result, eg, an amount effective to treat or prevent cancer, when administered to a subject, including a human.
  • the effective amount may vary depending on various factors such as formulation method, administration mode, age, weight, sex, disease severity, food, administration time, administration route, excretion rate and reaction sensitivity of the patient. Dosage or therapeutic regimen can be adjusted to provide an optimal therapeutic response as will be understood by those skilled in the art.
  • a therapeutic regimen with a therapeutically effective amount may consist of a single administration or, alternatively, may include a series of applications.
  • the duration of the treatment phase is determined by various factors such as formulation method, administration mode, age, weight, sex, disease severity, food, administration time, administration route, excretion rate and response sensitivity of the patient.
  • the effective dosage of the anti-cancer composition used for treatment may be raised or lowered during the course of an individual therapeutic regimen. Variations in dosage may occur and will be apparent through standard diagnostic assays known in the art.
  • the compositions of the present invention in some aspects, may be administered before, during, or after treatment with conventional anticancer agents, radiation therapy, hormone therapy, biotherapy, and/or surgical resection of the tumor.
  • composition of the present application may be provided together with one or more additives selected from the group consisting of pharmaceutically acceptable carriers, diluents, and excipients.
  • the pharmaceutically acceptable carrier as commonly used in the formulation of antibodies, lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline It may be at least one selected from the group consisting of cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil, etc., but It is not limited.
  • the composition may further include at least one selected from the group consisting of diluents, excipients, lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc. commonly used in the preparation of pharmaceutical compositions in addition to the above ingredients. have.
  • the composition may be administered orally or parenterally.
  • parenteral administration intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, etc. can be administered.
  • oral compositions may be formulated to coat the active agent or to protect it from degradation in the stomach.
  • the composition may be administered by any device capable of transporting the active agent to a target cell.
  • the cells can be administered using standard administration techniques, formulations or devices.
  • Formulations and devices such as syringes and vials for storage and administration of the composition may be suitably used.
  • Administration of cells may be autologous, allogenic, or xenogenic.
  • Peripheral blood-derived immune cells or progeny thereof e.g., derived in vivo, ex vivo or in vitro
  • local injection including catheter administration, systemic injection, local injection, intravenous injection, or parenteral administration.
  • When administering immune cell therapeutics they are generally formulated in injectable unit dosage forms (solutions, suspensions, emulsions).
  • the cell population may be administered parenterally.
  • Formulations include intravenous infusion, subcutaneous infusion, intramuscular infusion, intraperitoneal infusion, endothelial administration, topical administration, intranasal administration, intrapulmonary administration and rectal administration.
  • compositions are provided as sterile liquid preparations, for example, as isotonic aqueous solutions, suspensions, emulsions, dispersions or viscous compositions, which in some aspects may be buffered to a selected pH.
  • Liquid formulations are generally easier to prepare than gels, other viscous compositions, and solid compositions.
  • liquid compositions are particularly convenient to administer by injection.
  • viscous compositions may be formulated within an appropriate viscosity range to provide a longer period of contact with a particular tissue.
  • a liquid or viscous composition may comprise a carrier which can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • a carrier which can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • a carrier can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • polyol e.g., glycerol, propylene glycol, liquid polyethylene glycol
  • Sterile injectable solutions can be prepared by incorporating the binding molecule in a solvent such as a suitable carrier, diluent, or admixture with such excipients as sterile water, saline, glucose, dextrose, and the like.
  • a solvent such as a suitable carrier, diluent, or admixture with such excipients as sterile water, saline, glucose, dextrose, and the like.
  • the composition may also be lyophilized.
  • the composition may contain auxiliary substances such as wetting agents, dispersing or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, coloring agents, and the like, depending on the route of administration and desired route of manufacture.
  • additives may be added to improve the stability and sterility of the composition, including antibacterial preservatives, antioxidants, chelating agents and buffers. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form may be brought about by the use of agents which delay absorption, for example, aluminum monostearate and gelatin.
  • a recombinant antigen was prepared by conjugating human mucin 1 (SEQ ID NO: 110) with CD4 (SEQ ID NO: 111), and clones secreting scFv specific for the antigen were screened from an scFv library. Ten species were selected. The sequence information of 10 selected scFvs and the positive control scFv G03 (a positive control made using the amino acid sequence of the G3 antibody in Table 6 of WO2018/174544) used in the subsequent experiments is shown in Table 3.
  • the affinity of the scFv-Fc antibody containing the scFv to the mucin 1 antigen was measured using a Biacore T200 (GE healthcare).
  • Biacore T200 GE healthcare
  • anti-human IgG (Fc) antibody GE healthcare, Cat. No. BR-1008-39, final concentration of 25 ug/mL was flowed at 5 uL/min for 360 seconds, and fixed at about 5000-7000 RU.
  • Extracellular domain (nucleotide sequence in Table 4), hinge (CD8 ⁇ ) (SEQ ID NO: 112) and transmembrane domain (CD28) (SEQ ID NO: 113), costimulatory domain (CD28) (SEQ ID NO: 114) comprising scFv polypeptide sequences , and an intracellular signaling domain (CD3zeta) (SEQ ID NO: 115) expressing a chimeric antigen receptor (CAR) containing a lentiviral vector (transfer vector or expression vector) was prepared.
  • CD3zeta intracellular signaling domain
  • CAR chimeric antigen receptor
  • the scFv portion of the CAR was separated by PCR fragments from the plasmid supplied by the screening company, and the hinge, transmembrane protein, and CD28 and CD3z signaling domains were fragmented from the synthesized plasmid by PCR. The two fragments were cloned into Clonetech's pLVX-EF1alpha vector using Takara's In-Fusion HD cloning kit.
  • the cloned lentiviral vector was transfected (product code 632180) into Takara's Lenti-X 293T Cell Line together with the packaging plasmid provided by the company's Lenti-X Expression System (EF1a Version) (product code 631253) 24 After time, the soup was separated and the lentivirus in it was used for further study.
  • EF1a Version Lenti-X Expression System
  • the prepared lentivirus transfer vector (transfer vector or expression vector) and packaging plasmid mix (lentivirus packaging plasmid mix) were transferred to Lenti-X 293T cells (Takara Product No. 632180) was transfected.
  • HEK293T cells were prepared to exist in about 6 to 70% of the culture plate area.
  • Dulbecco's modified Eagle medium (DMEM, Gibco) supplemented with 10% heat-inactivated fetal bovine serum (FBS, Gibco) was used as the medium, and a culture plate of 100 mm or 150 mm size was used.
  • DMEM Dulbecco's modified Eagle medium
  • FBS heat-inactivated fetal bovine serum
  • the HEK293T cells were transfected by dropwise treatment on the incubated plate. After transfection, the lentivirus produced in HEK293T cells was ejected out of the cell and was present in the cell culture medium in the form of virus particles. 48 hours after transfection, only the cell culture solution was removed from the culture plate and centrifuged to obtain lentiviral particles in the form of pellets. After dissolving the pellet using the solution, it was immediately used or stored in a cryogenic freezer.
  • the Optimizer T-Cell Expansion Supplement (26ml) is added to the DMEM medium used previously or the CTS optimizer T cell Expansion SFM 1L bottle (Gibco) used for T cell culture, and CTS Innume Cell SR (Serum Replacement, Gibo) is added to the final 2 %, and CTS GlutaMAX-I Supplement 100X (Gibco) was added so that the final 1X was used.
  • PBMC Peripheral blood mononuclear cell
  • Donor refers to the donor of the PBMC sample used in the experiment, and the number after Donor means that the donor is different (e.g., Donor 03, Donor 04, Donor 05, Donor 06) , Donor 07, Donor08, Donor 18-09, Donor 20-01, etc.).
  • CAR chimeric antigen receptor
  • T-cells were activated using T cell-specific amplification beads (Dynabeads Human T-expander CD3/CD28, Gibco), and the chimeric antigen receptor (CAR) in the form of a lentivirus was treated according to the number of activated cells. and transduced into T cells.
  • CAR chimeric antigen receptor
  • a suspension of Interleukin-2 (Norvatis) dissolved in filtered sterile distilled water is added so that the amount of the medium becomes 100IU/ml, and during the subsequent incubation period, each time the medium is replaced or added. was continuously put in.
  • the cell culture period is 10-11 days in total after activation, and the medium is replaced or newly added every 1-2 days depending on the number of cells and culture is carried out. done.
  • the prepared CAR-T cells were used immediately or mixed with a cell cryopreservation solution and injected into a vial for cell freezing and stored in a Liquid Nitrogen Tank. Confirmation and characterization of the expression level of the chimeric antigen receptor (CAR) of the prepared CAR-T cells was performed through flow cytometry (FACS).
  • FACS flow cytometry
  • Example 3 Affinity analysis of soluble scFv to mucin1-expressing cells
  • Example 3 A total of four cell lines were used in Example 3, and HEK293 (ATCC) and PANC-1 (ATCC) cell lines were used as negative controls, and HEK293T-v1 (transformed by ATCC and LG Chem) and T47D (Korean cell lines) as positive controls. Bank) cell lines were used.
  • the HEK293T-v1 cell line used as a positive control is a cell line expressing the C subunit of MUC1 in a HEK293T cell line that does not express mucin 1.
  • the soluble scFv prepared in Example 1 was diluted 5 times to prepare a total concentration of 8 steps.
  • the concentrations for each step were 380 ⁇ g/mL, 76 ⁇ g/mL, 15.2 ⁇ g/mL, 3.04 ⁇ g/mL, 0.608 ⁇ g/mL, 0.1216 ⁇ g/mL, 0.02432 ⁇ g/mL, and 0.004864 ⁇ g/mL.
  • the buffer used for dilution of soluble scFv and cell washing was PBS containing 2% FBS and 10 mM EDTA.
  • Four types of cells were prepared at 1X10 6 /mL, put in a 96-well U-bottom cell culture plate at 1X10 5 /100 ⁇ l/well, and centrifuged at 1500 RPM for 5 minutes.
  • the previously prepared soluble scFv was treated at 50 ⁇ l/well. It left still at 4 degreeC for 1 hour.
  • Cell washing buffer was added at 150 ⁇ l/well, mixed, and centrifuged at 1500 RPM for 5 minutes. After discarding the supernatant, 200 ⁇ l/well of cell washing buffer was added, mixed, and centrifuged at 1500 RPM for 5 minutes.
  • Goat anti-human IgG Fc-biotin antibody (Invitrogen, A18821) was diluted 500-fold and treated at 50 ⁇ l/well. It left still at 4 degreeC for 20 minutes.
  • Cell washing buffer was added at 150 ⁇ l/well, mixed, and centrifuged at 1500 RPM for 5 minutes.
  • the affinity of the soluble scFv to the mucin1-expressing cells was confirmed by the PE MFI value among the results of flow cytometry.
  • soluble scFv was not added, and the value obtained by staining with another fluorescent antibody (Goat anti-human IgG Fc-biotin antibody, PE-Streptavidin) was set as the negative control value, and G03 concentration of each cell was 380 ⁇ g/mL.
  • the MFI value was corrected as follows by setting the value treated as a positive control value as follows:
  • the ELISA assay method is the same as a commonly used method. To put it simply: First, a 96-well immune plate was coated with a capture antibody capable of capturing interferon-gamma or interleukin-2, and after one day, it was sufficiently washed with a washing buffer. A block buffer is added to each well, left at room temperature for 1 hour, and then washed sufficiently with a washing buffer again.
  • a culture solution sample was placed in each well and allowed to react by standing at room temperature for 2 hours. After washing sufficiently with a washing buffer, a detection antibody was added and reacted at room temperature for 2 hours. After washing sufficiently with the washing buffer, HRP-labeled streptavidin was added to each well and reacted at room temperature for 20 minutes. After sufficiently washing with the washing buffer, the substrate solution was added and reacted at room temperature for 20 minutes, and the reaction was stopped with a stop solution. The cytokine concentration in each well was calculated as absorbance according to the reaction.
  • FIG. 1 is a positive control group, and a group in which no CAR was injected (NO LV) was used as a negative control group.
  • FIG. 1 is a graph showing results representatively of independent experiments using a total of two T cell derivations, and was named Donor 03 and Donor 04 according to the origin of T cells.
  • Donor refers to the donor of the T cells used in the experiment, and the number after Donor means that the donor is different.
  • 1 is a graph in which the absorbance is normalized based on the control group G03, and it shows that the tested immune cells secrete cytokines.
  • FIG. 2 is a cytokine secretion assay for evaluating the reactivity of immune cells injected with anti-MUC1 scFv in the form of CAR against MUC1-positive tumor cells (T47D), showing that the tested immune cells secrete cytokines.
  • T cells were derived from Donor 06. A group in which no CAR was injected (Control T cell) was used as a negative control group.
  • FIG. 3 is a cytokine secretion analysis result evaluating the reactivity of immune cells injected with anti-MUC1 scFv in the form of CAR to mucin1 non-expressing cells (HEK293T). Interferon-gamma cytokines are not secreted, and in the case of IL-2 It shows that the secretion amount does not increase significantly when compared to the negative control group (Control T cell). T cells were derived from Donor 06. A group in which no CAR was injected (Control T cell) was used as a negative control group.
  • Human breast cancer cell lines T47D, HCC70, HCC1954), human liver cancer cell lines (Huh7, HepG2), and human neuroblastoma cell lines (SK-N-SH) were purchased from Korean Cell Line Bank (KCLB, Seoul, Korea), and human embryonic kidney The cell line (HEK293T) was purchased from the American Type Culture Collection (ATCC, Manassas, VA).
  • T47D, HCC70, and HCC1954 cells were cultured in RPMI-1640 medium (Thermo Fisher Scientific), and HEK293T, Huh7, and HepG2 cells were cultured in Dulbecco's modified Eagle's medium (DMEM, Thermo Fisher Scientific), respectively.
  • DMEM Dulbecco's modified Eagle's medium
  • CAR-T cells prepared according to Example 2 were CTS complete media (CTS TM OpTmizer TM T Cell Expansion SFM (Gibco, A1048501), 2% (w/v) CTS TM Immune Cell SR (Gibco, A25961-01), Incubated in 1X GlutaMAX TM Supplement (Gibco, 35050-061) at 37° C., 5% CO 2 conditions.
  • mucin1-expressing cells including T47D, HCC70, HCC1954, HEK293T-V1 (MUC1-C exogenously expressing cells), etc.
  • mucin1 ratio Cell solubility for the expressing cells including HEK293T, HepG2, Huh7, SK-N-SH, etc.
  • mucin 1 expressing or non-expressing target cells stained with CellTrace TM CFSE were aliquoted at 0.15-0.2 X 10 6 cells/150ul/well and cultured for one day.
  • CAR-T cells stored frozen at -196°C were thawed and cultured for one day in CTS complete media containing 30U/ml IL-2 (Novartis, Proleukin) at a concentration of 2 X 10 6 cells/ml. .
  • CTS complete media containing 30U/ml IL-2 (Novartis, Proleukin) at a concentration of 2 X 10 6 cells/ml.
  • the CAR expression rate of CAR-T cells in culture was measured using Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097) and APC Mouse Anti-Human CD3 ( It was stained with BD Pharmingen TM , 561811) and the ratio of both were positive through flow cytometry (FACS, flow cytometer).
  • each type of CAR-T (E, effector cells), adjusted to have the same number of CAR+ T cells, was cultured the previous day in a volume of 100ul/well with the cell culture medium of each target cell.
  • CFSE-stained Mucin1 expression was added in proportion to the number of non-expressing cells (T, target cells). Incubated at 37° C., 5% CO 2 conditions from 5 hours to 24 hours depending on the target cells. Then, both CAR-T cells and target cells were taken and stained with Fixable Viability Dye eFluor TM 450 (eBioscience TM , 65-0863-18) and APC Mouse Anti-Human CD3 to determine the number of viable target cells through flow cytometry. At this time, the number of viable target cells was defined as Fixable Viability Dye negative and CFSE positive cells. The killing activity (%) was calculated as follows:
  • FIGS. 4 to 8 The results are shown in FIGS. 4 to 8 .
  • G03 is a positive control, and a group in which no CAR is injected (NO LV) was used as a negative control.
  • NO LV no CAR is injected
  • these figures are graphs showing results representatively of independent experiments using a total of two T cell derivations, and were named Donor 03 and Donor 04 according to the origin of T cells. 4 to 8 , the tested immune cells showed cytotoxicity to mucin1-expressing cells.
  • FIGS. 9 and 10 are the results of a cytotoxicity test for CAR-T cells prepared using Donor 05 and Donor 06-derived T cells, a human breast cancer cell line T47D, respectively, and FIG. 11 shows Donor 07-derived T cells.
  • HCC70 breast cancer cell line
  • MCF10A human normal breast cell line
  • CAR-T cells Donor 05-derived T cells expressing CAR containing 2447_2H08 scFv
  • IL-2 Novartis , Proleukin
  • CAR CAR with 2447_2H08 scFv
  • expression rate of CAR was measured using Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097) and APC Mouse Anti-Human CD3 (BD PharmingenTM, 561811), and both were obtained at a positive rate through flow cytometry (FACS, flow cytometer).
  • each type of CAR-T (E, effector cells), adjusted to have the same number of CAR+ T cells, was used in a cell culture medium of each target cell in a volume of 100 ul/well to express CFSE-stained Mucin 1 cultured the previous day. Alternatively, it was added in proportion to the number of non-expressing cells (T, target cells).
  • T target cells
  • the target cells were cultured for 24 hours at 37° C., 5% CO 2 condition. Then, both CAR-T cells and target cells were taken and stained with Fixable Viability Dye eFluorTM 450 (eBioscienceTM, 65-0863-18) and APC Mouse Anti-Human CD3 to determine the number of viable target cells through flow cytometry.
  • the number of viable target cells was defined as Fixable Viability Dye-negative, CFSE-positive cells (strong CFSE signal for HCC70, weak CFSE signal for MCF10A). Calculation of titer (killing activity, %) was performed in the same manner as in Example 5.
  • FIGS. 13 and 14 The results are shown in FIGS. 13 and 14 .
  • a group in which no CAR was injected (mock T cells) was used as a negative control group.
  • CAR-T cells having 2447_2H08 scFv (indicated as #2-CAR-T in the figure, respectively) exhibited apoptotic ability against mucin1 overexpressing breast cancer cells (HCC70).
  • HCC70 mucin1 overexpressing breast cancer cells
  • MCF10A normal breast cell line
  • Example 7 Analysis of anticancer efficacy of CAR-T cells using an animal model
  • PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
  • sc subcutaneously
  • iv intravenous
  • T cells donor 18-09-derived T cells expressing scFv-containing CAR according to the present disclosure
  • hCD45+ cells The number of human immune cells
  • the size of the tumor initially increased, but gradually decreased after about 10 days, and after 30 days, the size of the tumor became so small that it was difficult to measure.
  • HCC1954 cells a breast cancer cell line that naturally expresses MUC1
  • sc subcutaneously
  • sc tumor volume reached 500 mm 3 (23 days after cell administration)
  • 0.1 X 10 6 of anti-MUC1 CAR-T cells Donor 20-01-derived T cells expressing scFv-containing CAR according to the present disclosure
  • iv intravenously
  • PBS Vehicle
  • T cells that do not express CAR Control T cells
  • the size of the tumor which was 500 mm 3
  • the size of the tumor which was 500 mm 3
  • the number of hCD45+ cells in the mouse blood showed an increasing pattern and gradually decreased after about 25 days. It seems that CAR-T cells are activated and proliferate after recognizing the antigen, thereby increasing the number of cells in the blood.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Hematology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)

Abstract

뮤신1(Mucin1)에 결합하는 폴리펩티드, 이를 코딩하는 단리된 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 및 상기 벡터를 포함하는 세포에 관한 것이다. 또한, 뮤신1에 결합하는 폴리펩티드를 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 상기 키메라 항원 수용체를 발현하는 면역 세포, 및 이들을 포함하는 암 치료용 조성물 및 치료 방법에 관한 것이다.

Description

뮤신 1에 특이적인 폴리펩티드 및 이의 이용
관련 출원들과의 상호 인용
본 출원은 2020년 12월 24일자 한국 특허 출원 제10-2020-0183768호 및 2021년 10월 15일자 한국 특허 출원 제10-2021-0137757호에 기초한 우선권의 이익을 주장하며, 해당 한국 특허 출원의 문헌에 개시된 모든 내용은 본 명세서의 일부로서 포함된다.
기술분야
뮤신1(Mucin1)에 결합하는 폴리펩티드, 이를 코딩하는 단리된 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 및 상기 벡터를 포함하는 세포에 관한 것이다. 또한, 뮤신1에 결합하는 폴리펩티드를 포함하는 키메라 항원 수용체, 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터, 상기 키메라 항원 수용체를 발현하는 면역 세포, 및 이들을 포함하는 암 치료용 조성물 및 치료 방법에 관한 것이다.
뮤신1(Mucin1)은 체내 거의 모든 기관의 상피세포에 존재하는 막 결합형 당단백질이다. 뮤신1은 N-말단 서브유닛(MUC1-N) 및 C-말단 서브유닛(MUC1-C) 의 비공유 상호작용으로부터 형성되는 이형이량체 단백질이다. MUC1-C 은 세포외 도메인, 막횡단 도메인 및 세포질 꼬리를 형성하고, MUC1-N 은 당화부위를 포함하는, 20개의 아미노산(HGVTSAPDTRPAPGSTAPPA)을 함유하는 직렬반복(tandem repeats, TRs)을 반복적으로 포함하며, MUC1-C 의 세포외 도메인과 상호 작용하여 MUC1-C 과 계속 연결되어 있다.
정상 상피 세포에서 뮤신1은 낮은 수준으로 발현되고 상피의 정측막(apical membranes)에 제한적으로 발현되나, 유방암, 폐암, 대장암, 피부암, 갑상선암, 위암, 췌장암, 신장암, 난소암 및 자궁경부암 등의 고형암 세포에서 과잉으로 발현하고 전체 세포 표면에 랜덤하게 발현되며 비정상적으로 당화되는 것으로 알려져 있다. 따라서, 뮤신1은 암 병소를 검출하기 위한 표적 분자로서, 또는 암을 치료하기 위한 표적 분자로서 유용한 것으로 알려져 있다.
이에, 현재 암 치료용 항-MUC1 항체가 다수 보고되어 있으나, 항체를 이용한 항암요법의 경우 항체가 특이적으로 인식하는 항원이 있는 암세포에만 적용 가능하고 효과 지속기간이 짧으며 장기 투여시 내성이 발생하기도 한다. 따라서, 체내 면역체계를 활성화해 다양한 암에서 지속적으로 강력한 항암 효과를 발휘할 수 있는 기술의 개발이 요구된다.
일예는, 뮤신1(Mucin1)에 결합하는 폴리펩티드를 제공한다.
다른 예는, 상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드를 제공한다.
다른 예는, 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
다른 예는, 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 포함하는 세포를 제공한다.
다른 예는, 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 제공한다.
다른 예는, 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드를 제공한다.
다른 예는, 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
다른 예는, 상기 키메라 항원 수용체를 발현하거나, 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는, 면역 세포를 제공한다.
다른 예는, 상기 뮤신1-결합 폴리펩티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 세포; 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체; 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드; 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 또는 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하거나 상기 키메라 항원 수용체를 발현하는 면역 세포를 포함하는, 암 치료용 조성물을 제공한다.
도 1은 donor 03 및 donor 04 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, MUC1-양성 종양세포(T47D, HEK293T-V1)에 대한 반응성을 평가한 사이토카인 분비 분석 결과이다.
도 2는 donor 06 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, MUC1-양성 종양세포(T47D)에 대한 반응성을 평가한 사이토카인 분비 분석 결과이다.
도 3은 donor 06 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 뮤신1 비발현 세포(HEK293T)에 대한 반응성을 평가한 사이토카인 분비 분석 결과이다.
도 4는 donor 03 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 인간유방암세포주인 T47D에 대한 세포 독성실험 결과이다.
도 5는 donor 04 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간유방암세포주인 T47D에 대한 세포 독성실험 결과이다.
도 6은 donor 03 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간배아신장 세포인 HEK293T에 대한 세포 독성실험 결과이다.
도 7은 donor 04 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간배아신장 세포인 HEK293T에 대한 세포 독성실험 결과이다.
도 8은 donor 04 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간배아신장세포주에 MUC1-C를 외제적 발현시킨 HEK293T-V1에 대한 세포 독성실험 결과이다.
도 9는 donor 05 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 인간유방암세포주인 T47D에 대한 세포 독성실험 결과이다.
도 10은 donor 06 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 인간유방암세포주인 T47D에 대한 세포 독성실험 결과이다.
도 11은 donor 07 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 인간배아신장 세포인 HEK293T에 대한 세포 독성실험 결과이다.
도 12는 donor 08 유래의 T 세포를 이용하여 제작한 본원의 일실시예에 따른 CAR-T 세포들의, 인간유방암세포주인 HCC70에 대한 세포 독성실험 결과이다. #2: 2447_2H08; #3: 2447_3A01; #4: 2447_3A08; #5: 2447_3A09; #6: 2447_3A12; #7: 2447_3B07; #8: 2447_3C08; #9: 2447_3H02; #10: 2447_3H08.
도 13은 효과기 세포(E)와 표적 세포(T)의 비율 0.3:1 에서 본원의 일실시예에 따른 CAR-T 세포의, 인간 유방암 세포주 (HCC70) 와 인간 정상 유방 세포주 (MCF10A)에 대한 차별적인 세포 독성 결과를 나타낸다. #2: 2447_2H08.
도 14는 효과기 세포(E)와 표적 세포(T)의 비율 0.1:1 에서 본원의 일실시예에 따른 CAR-T 세포의, 인간 유방암 세포주 (HCC70) 와 인간 정상 유방 세포주 (MCF10A)에 대한 차별적인 세포 독성 결과를 나타낸다. #2: 2447_2H08.
도 15는 PANC1-v1 세포 (MUC1 을 발현시킨 PANC1 췌장암 세포)를 주입한 암 동물 모델에서, 본원의 일실시예에 따른 CAR-T 세포들을 투여한 후 종양 성장 억제를 확인한 결과이다.
도 16은 PANC1-v1 세포 (MUC1 을 발현시킨 PANC1 췌장암 세포)를 주입한 암 동물 모델에서, 본원의 일실시예에 따른 CAR-T 세포들을 투여한 후 14일 및 28일 후 혈액 내 인간 면역세포(hCD45+ cell)의 수를 확인한 결과이다.
도 17은 PANC1-v1 세포 (MUC1 을 발현시킨 PANC1 췌장암 세포)를 주입한 암 동물 모델에서, 본원의 일실시예에 따른 CAR-T 세포를 두 가지 용량으로 투여한 후 종양 성장 억제를 확인한 결과이다.
도 18은 HCC1954 세포 (자연적으로 MUC1 을 발현하는 유방암 세포)를 주입한 암 동물 모델에서, 본원의 일실시예에 따른 CAR-T 세포들을 투여한 후 종양 성장 억제를 확인한 결과이다.
도 19는 HCC1954 세포 (자연적으로 MUC1 을 발현하는 유방암 세포)를 주입한 암 동물 모델에서, 본원의 일실시예에 따른 CAR-T 세포들을 투여한 후 일정한 시간 간격으로 혈액 내 인간 면역세포(hCD45+ cell)의 수를 확인한 결과이다.
본 발명의 한 측면에 따라 뮤신1(Mucin1)에 결합하는 폴리펩티드가 제공된다. 바람직한 일예로, 본원에서 뮤신1에 결합하는 폴리펩티드는 항체 또는 이의 항원 결합 단편일 수 있다.
일 구현예로, 다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 뮤신1에 결합하는 폴리펩티드가 제공된다:
- 각각 서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 기재되는상보성결정영역(CDR) 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 11, 서열번호 12 및 서열번호 13의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 14, 서열번호 15 및 서열번호 16의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 21, 서열번호 22 및 서열번호 23의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 24, 서열번호 25 및 서열번호 26의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 31, 서열번호 32 및 서열번호 33의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 44, 서열번호 45 및 서열번호 46의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 51, 서열번호 52 및 서열번호 53의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 54, 서열번호 55 및 서열번호 56의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 61, 서열번호 62 및 서열번호 63의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 64, 서열번호 65 및 서열번호 66의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 71, 서열번호 72 및 서열번호 73의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 74, 서열번호 75 및 서열번호 76의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
- 각각 서열번호 81, 서열번호 82 및 서열번호 83의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 84, 서열번호 85 및 서열번호 86의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역; 및
- 각각 서열번호 91, 서열번호 92 및 서열번호 93의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 94, 서열번호 95 및 서열번호 96의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역.
클론명 CDR
VH VL
CDR1 CDR2 CDR3 CDR1 CDR2 CDR3
2445_1F09 GFTVSSNY
(서열번호 1)
IYSGGST
(서열번호 2)
DRGWNHGMDV
(서열번호 3)
SSEVGSRY
(서열번호 4)
KND
(서열번호 5)
AAWDDSLNGYV
(서열번호 6)
2447_2H08 GYTFTNYG(서열번호 11) ISAYNGNT
(서열번호 12)
DPHILTGYYRGGWFDP
(서열번호 13)
SLRTSY
(서열번호 14)
GKT
(서열번호 15)
HSRDSNDNYLEVV
(서열번호 16)
2447_3A01 GFTFDDYA(서열번호 21) ISWNSGSI
(서열번호 22)
DISSGWYPGTFDY
(서열번호 23)
SLRSYY
(서열번호 24)
GKN
(서열번호 25)
SSRDSSDDVV
(서열번호 26)
2447_3A08 GYTFTSYG(서열번호 31) ISAYNGNT
(서열번호 32)
DRATIFGVVTPFDY
(서열번호 33)
SIRSYS
(서열번호 34)
GKN
(서열번호 35)
NSRDSSGNRVV
(서열번호 36)
2447_3A09 GFTFDDYA(서열번호 41) ISWNSGSI
(서열번호 42)
DVSSGWYWYAFDI
(서열번호 43)
SLRSYY
(서열번호 44)
GKN
(서열번호 45)
NSRDSGGSVV
(서열번호 46)
2447_3A12 GYTFTSYG(서열번호 51) ISAYNGNT
(서열번호 52)
DPHILTGYYRGGWFDP
(서열번호 53)
SLRSYY
(서열번호 54)
GKN
(서열번호 55)
NSRDSSGNHRV
(서열번호 56)
2447_3B07 GFTFDDYA(서열번호 61) TSWDGGST
(서열번호 62)
DHSSGWYNGGMDV
(서열번호 63)
SLRSYY
(서열번호 64)
GKN
(서열번호 65)
NSRDSSGNHVV
(서열번호 66)
2447_3C08 GFTFDDYA(서열번호 71) ISWNSGSI
(서열번호 72)
DRGSGYEGNYYGMDV
(서열번호 73)
SLRSYY
(서열번호 74)
GKN
(서열번호 75)
NSRDSSGNHYV
(서열번호 76)
2447_3H02 GFTFDDYA(서열번호 81) ISWDSGSI
(서열번호 82)
DVSSGWYWYAFDI
(서열번호 83)
ILRSYY
(서열번호 84)
GKN
(서열번호 85)
NSRDSSGNRVV
(서열번호 86)
2447_3H08 GFTFDDYA(서열번호 91) ISWNSGSI
(서열번호 92)
DRSSGWYTGSFDY
(서열번호 93)
SLRSYY
(서열번호 94)
GKN
(서열번호 95)
QSRDSSDNRVL
(서열번호 96)
다른 구현예로, 다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 뮤신1에 결합하는 폴리펩티드가 제공된다:- 서열번호 7의 아미노산 서열을 포함하는 VH 영역 및 서열번호 8의 아미노산 서열을 포함하는 VL 영역;- 서열번호 17의 아미노산 서열을 포함하는 VH 영역 및 서열번호 18의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 27의 아미노산 서열을 포함하는 VH 영역 및 서열번호 28의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 37의 아미노산 서열을 포함하는 VH 영역 및 서열번호 38의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 47의 아미노산 서열을 포함하는 VH 영역 및 서열번호 48의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 57의 아미노산 서열을 포함하는 VH 영역 및 서열번호 58의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 67의 아미노산 서열을 포함하는 VH 영역 및 서열번호 68의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 77의 아미노산 서열을 포함하는 VH 영역 및 서열번호 78의 아미노산 서열을 포함하는 VL 영역;
- 서열번호 87의 아미노산 서열을 포함하는 VH 영역 및 서열번호 88의 아미노산 서열을 포함하는 VL 영역; 및
- 서열번호 97의 아미노산 서열을 포함하는 VH 영역 및 서열번호 98의 아미노산 서열을 포함하는 VL 영역.
클론명 VH VL
2445_1F09 EVQLLETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGWNHGMDVWGQGTLVTVSS (서열번호 7) QSGLTQPPSASGTPGQRVTISCSGGSSEVGSRYVSWYQQLPGTAPRLLIYKNDRRPSGVPDRFSGSKSGSSASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKLTVL (서열번호 8)
2447_2H08 EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTTVTVSS (서열번호 17) SYELTQDPAVSVALGQTVTITCQGDSLRTSYAGWLQQKPGQAPVLVLYGKTSRPSGIPDRFSGSTSGNTASLTITGAQAEDEAEYFCHSRDSNDNYLEVVFGGGTKLTVL (서열번호 18)
2447_3A01 EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIVYADFVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDISSGWYPGTFDYWGQGTLVTVSS (서열번호 27) SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTVTGAQAEDEADYYCSSRDSSDDVVFGGGTQLTVL (서열번호 28)
2447_3A08 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDRATIFGVVTPFDYWGQGTLVTVSS (서열번호 37) SYELTQDPAVSVALGQTVRITCQGDSIRSYSASWYQQKPGQAPRLVIYGKNNRPSGIPDRVSGSTSGNTASLTVTGAQAEDEADYYCNSRDSSGNRVVFGGGTQLTVL (서열번호 38)
2447_3A09 EVQLLESGGGLVQPGRSLRLSCAATGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTASYYCAKDVSSGWYWYAFDIWGQGTLVTVSS (서열번호 47) SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPGRFSGSSSGNTASLTVTGAQAEDEADYYCNSRDSGGSVVFGGGTKLTVL (서열번호 48)
2447_3A12 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLRGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTLVTVSS (서열번호 57) SYELTQDPAVSVVLGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHRVFGGGTKLTVL (서열번호 58)
2447_3B07 QVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSLTSWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKDHSSGWYNGGMDVWGQGTMVTVSS (서열번호 67) SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL (서열번호 68)
2447_3C08 EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDRGSGYEGNYYGMDVWGQGTLVTVSS (서열번호 77) SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGTTSGNTASLTITGAQAEDEADYYCNSRDSSGNHYVFGTGTKVTVL (서열번호 78)
2447_3H02 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDVSSGWYWYAFDIWGQGTLVTVSS (서열번호 87) SYELTQDPAVSVALGQTVRITCQGDILRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNRVVFGGGTKLTVL (서열번호 88)
2447_3H08 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSSGWYTGSFDYWGQGTLVTVSS (서열번호 97) SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYRQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTIIGAQAEDEADYYCQSRDSSDNRVLFGGGTKVTVL (서열번호 98)
본원에서, 용어 "항체"는 특정 항원에 특이적으로 결합하는 단백질을 총칭하는 것으로서 가장 넓은 의미로 사용되며, 면역계 내에서 항원의 자극에 의하여 만들어지는 단백질 또는 이를 화학적 합성 또는 재조합적으로 제조한 단백질일 수 있으며, 그 종류는 특별히 제한되지 않는다. 구체적으로는 원하는 생물학적 활성을 나타내는 한 단일클론 항체 (전장 단일클론 항체 포함), 다클론 항체, 다중 특이성 항체 (예, 이중특이성 항체), 합성 항체 (또는 항체 모방체라고도 함), 키메라 항체, 인간화 항체, 인간 항체, 또는 항체 융합체 단백질(또는 항체 접합체라고도 함)을 포괄한다.완전한 항체(예컨대, IgG형)는 2개의 전장(full length) 경쇄 및 2개의 전장 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 이황화 결합으로 연결되어 있다. 항체의 불변 영역은 중쇄 불변 영역과 경쇄 불변 영역으로 나뉘어지며, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 또는 엡실론(ε) 타입을 가지고, 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 또는 알파2(α2)를 가진다. 경쇄의 불변 영역은 카파(κ) 및 람다(λ) 타입을 가진다.
용어 "항원 결합 단편"은 전장 쇄에 존재하는 아미노산 중 적어도 일부가 결여되었지만 여전히 항원에 특이적으로 결합할 수 있는 항체의 부분을 말한다. 이러한 단편은 표적 항원에 결합하고, 주어진 에피토프에의 결합에 대해 무손상 항체를 포함한 다른 항원 결합 분자와 경쟁할 수 있다는 점에서 생물학적으로 활성이다. 항원 결합 단편은 무손상 항체의 Fc 영역의 불변 중쇄 도메인 (즉, 항체이소형에 따라 즉 CH2, CH3 및 CH4)을 포함하지 않을 수 있다. 항원 결합 단편의 예로는 scFv (single chain variable fragment)(예를 들어, scFv, (scFv)2 등), Fab (fragment antigen binding) (예를 들어, Fab, Fab', F(ab')2 등), 도메인 항체, 펩티바디, 미니바디, 인트라바디, 디아바디, 트리아바디, 테트라바디 또는 및 단일-쇄 항체 등을 포함하나, 이에 제한되지는 않는다. 또한 항원 결합 단편은 scFv, 또는 scFv가 면역글로불린 (예컨대, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, 등)의 Fc 부위와 융합된 융합 폴리펩타이드 (scFv-Fc) 또는 경쇄의 불변 영역 (예컨대, 카파 또는 람다)와 융합된 융합 폴리펩타이드 (scFv-Ck (카파 불변영역) 또는 scFv-Cλ (람다 불변영역))일 수 있으나, 이에 제한되지 않는다.
용어, "중쇄(heavy chain)"는 항원에 특이성을 부여하기 위해 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VH 및 3개의 불변 영역 도메인 CH1, CH2 및 CH3과 힌지(hinge)를 포함하는 전장 중쇄 및 이의 단편을 모두 포함하는 의미로 해석된다. 또한, 용어 "경쇄(light chain)"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전장 경쇄 및 이의 단편을 모두 포함하는 의미로 해석된다.
용어 "상보성 결정 영역 (Complementarity-determining regions, CDR)"은, 항체의 가변 영역 중에서 항원과의 결합 특이성 또는 결합 친화도를 부여하는 부위를 말한다. 일반적으로 중쇄 가변 영역에 3개의 CDR(CDR-H1, CDR-H2, CDR-H3)이 존재하고, 경쇄 가변 영역에 3개의 CDR(CDR-L1, CDR-L2, CDR-L3)이 존재한다. 상기 CDR은 항체 또는 이의 단편이 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공할 수 있다. "프레임워크 영역(Framework region, FR)" 은 중쇄 및 경쇄의 가변 영역의 비-CDR 부분을 말하며, 일반적으로 중쇄 가변 영역에 4개의 FR(FR-H1, FR-H2, FR-H3 및 FR-H4)이 존재하고, 경쇄 가변 영역에는 4개의 FR(FR-L1, FR-L2, FR-L3 및 FR-L4)이 존재한다. 주어진 CDR 또는 FR의 정확한 아미노산 서열 경계는 카바트(Kabat) 넘버링 체계, 코티아(Chothia) 넘버링 체계, 콘택트(Contact) 넘버링 체계, IMGT 넘버링 체계, Aho 넘버링 체계, AbM 넘버링 체계 등 다수의 잘 알려진 체계 중 어느 하나를 사용하여 용이하게 결정될 수 있다.
용어 "가변 영역(variable region)"은 항체를 항원에 결합시키는데 관여하는 항체 중쇄 또는 경쇄의 도메인을 지칭한다. 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역은 일반적으로 유사한 구조를 가지며, 각각의 도메인은 4개의 보존된 프레임워크 영역(FR) 및 3개의 CDR을 포함한다.
특정 구체예에서, 본원의 뮤신1-결합 폴리펩티드는 scFv (single chain variable fragment), 펩티바디, Fab (fragment antigen binding), 단일클론 항체, 이중특이성 항체, 미니바디, 도메인 항체, 합성 항체, 키메라 항체, 인간화 항체, 인간 항체, 또는 항체 융합체 단백질일 수 있으나, 이에 제한되지 않는다.
바람직한 구체예에서, 본원의 뮤신1-결합 폴리펩티드는 scFv (single chain variable fragment)일 수 있다.
용어, "scFv (single chain variable fragment)" 는 항체의 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역이 공유결합으로 연결된 단일 쇄 항체 단편을 말한다. VH 영역 및 VL 영역은 직접 연결되거나, 링커에 의해 연결될 수 있다.
링커는 수용성 및/또는 가요성 링커(flexible linker)일 수 있다. 예를 들어, 링커에 의해 VH의 N-말단과 VL의 C-말단이 연결되거나, VH의 C-말단과 VL의 N-말단이 연결될 수 있다. 링커는 펩티드 링커일 수 있으며, 예를 들어 10 내지 30 아미노산 길이, 10 내지 25 아미노산 길이, 10 내지 20 아미노산 길이, 10 내지 15 아미노산 길이, 15 내지 30 아미노산 길이, 15 내지 25 아미노산 길이, 15 내지 20 아미노산 길이, 구체적으로는, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 또는 30 아미노산 길이일 수 있으나, 이에 제한되지 않는다.
링커에 적합한 아미노산 서열은 당 업계에 공지되어 있다. 예를 들어, 상기 링커는 유연성을 위해 글리신(Gly)이 풍부할 수 있고, 용해도를 위해 세린(Ser), 아스파라긴(Asn), 알라닌(Ala) 또는 트레오닌(Thr)을 포함할 수 있다. 링커는 Gly, Asn, Ser, Thr 및 Ala로 이루어진 군에서 선택된 1종 이상을 총 1 내지 100개, 2 내지 50개, 또는 5 내지 25개를 포함하여 이루어진 것일 수 있다. 비제한적인 예시로는, 링커의 아미노산 서열은 GGGS 또는 GGGGS 가 다양한 반복 횟수, 예컨대 2, 3, 4 및 5 회 반복을 갖는 서열일 수 있다. 예를 들어, 링커는 GGGGSGGGGSGGGGS, GGGGSGGGGSGGGGSGGGGS, 또는 GGGGSGGGGSGGGAS 일 수 있으나, 이에 제한되지 않는다.
scFv는 불변 영역이 없고 링커가 도입됨에도 불구하고 모 항체의 항원 특이성을 유지한다. scFv는 VH 영역 및 VL 영역을 코딩하는 폴리뉴클레오티드로부터 발현될 수 있으나, 이에 제한되지 않는다.
바람직한 구현예로, 서열번호 9, 서열번호 19, 서열번호 29, 서열번호 39, 서열번호 49, 서열번호 59, 서열번호 69, 서열번호 79, 서열번호 89 및 서열번호 99로 이루어진 군에서 선택되는 아미노산 서열을 포함하는 scFv 폴리펩티드가 제공된다.
본원에서 항체 또는 항원 결합 단편은, 이와 동등한 활성을 보유하는 변이체, 예를 들어 본원에 기재된 아미노산 서열들과 약 80%, 약 81%, 약 82%, 약 83%, 약 84%, 약 85%, 약 86%, 약 87%, 약 88%, 약 89%, 약 90%, 약 91%, 약 92%, 약 93%, 약 94%, 약 95%, 약 96%, 약 97%, 약 98% 또는 약 99% 이상의 동일성을 가지면서 동등한 생물학적 활성을 보유한 변이체도 본원의 범주에 포함될 수 있다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드가 제공된다.
바람직한 구현예로, 상기 폴리뉴클레오티드는 서열번호 10, 서열번호 20, 서열번호 30, 서열번호 40, 서열번호 50, 서열번호 60, 서열번호 70, 서열번호 80, 서열번호 90 및 서열번호 100으로 이루어진 군에서 선택되는 핵산 서열을 포함할 수 있다. 또한 본 발명은 상기 서열과 약 90%, 약 91%, 약 92%, 약 93%, 약 94%, 약 95%, 약 96%, 약 97%, 약 98% 또는 약 99% 이상의 동일성을 가지면서 동등한 활성을 가지는 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드를 포함할 수 있다. 일부 구현예에서, 폴리뉴클레오티드는 인간에서의 발현을 위한 코돈 최적화될 수 있다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터가 제공된다.
벡터에서 상기 폴리뉴클레오티드는 프로모터에 작동 가능하게 연결될 수 있다. 용어 "작동 가능하게 연결된(operatively linked)"은 뉴클레오티드 발현 조절 서열(예를 들어, 프로모터 서열)과 다른 뉴클레오티드 서열 사이의 기능적인 결합을 의미한다. 상기 조절 서열은 작동 가능하게 연결됨으로써 다른 뉴클레오티드 서열의 전사 및/또는 해독을 조절할 수 있다.
벡터는, 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 상기 발현용 벡터는 당업계에서 식물, 동물 또는 미생물에서 외래의 단백질을 발현하는 데 사용되는 통상의 것을 사용할 수 있다. 상기 벡터는 당업계에 공지된 다양한 방법을 통해 구축될 수 있다.
벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다. 예를 들어, 사용되는 벡터가 발현 벡터이고, 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터 (예를 들어, pLλ 프로모터, CMV promoter, trp 프로모터, lac 프로모터, tac 프로모터, T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 진핵 세포를 숙주로 하는 경우에는, 벡터에 포함되는 진핵 세포에서 작동하는 복제원점은 f1 복제원점, SV40 복제원점, pMB1 복제원점, 아데노 복제원점, AAV 복제원점 및 BBV 복제원점 등을 포함하나, 이에 한정되는 것은 아니다. 또한, 포유동물 세포의 게놈으로부터 유래된 프로모터 (예를 들어, 메탈로티오닌 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터 (예를 들어, 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터 및 HSV의 tk 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 가질 수 있다. 또한, 필요에 따라 인핸서 서열, 5'측 및 3'측의 비번역 영역, 분비 시그널 서열, 스플라이싱 접합부, 선택마커(예를 들어, 항생제 내성 유전자) 등을 더욱 포함할 수 있다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 포함하는 세포가 제공된다.
상기 세포는 상기 벡터를 적절한 숙주 세포에 도입시킴으로써 얻어진 것일 수 있다. 벡터를 함유하는 숙주 세포는 벡터에 함유된 폴리뉴클레오티드의 클로닝 또는 발현에 유용할 수 있다. 상기 숙주세포는 상기 벡터를 안정되면서 연속적으로 클로닝 또는 발현시킬 수 있는 세포로서 당업계에 공지된 어떠한 숙주 세포도 이용할 수 있다. 예를 들어, 원핵 세포로는, 예를 들어, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, 바실러스 서브틸리스, 바실러스 츄린겐시스와 같은 바실러스 속 균주, 그리고 살모넬라 티피무리움, 세라티아 마르세슨스 및 다양한 슈도모나스 종과 같은 장내균과 균주 등이 있으며, 진핵 세포에 형질 전환시키는 경우에는 숙주 세포로서, 효모(Saccharomyce cerevisiae), 곤충 세포, 식물 세포 및 동물 세포, 예를 들어, Sp2/0, CHO(Chinese hamster ovary) K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN, MDCK 세포주 등이 이용될 수 있으나, 이에 제한되는 것은 아니다.
상기 폴리뉴클레오티드 또는 이를 포함하는 벡터의 숙주 세포 내로의 운반(도입)은, 당업계에 널리 알려진 운반 방법을 사용할 수 있다. 상기 운반 방법은 예를 들어, 숙주 세포가 원핵 세포인 경우, CaCl2 방법 또는 전기 천공 방법 등을 사용할 수 있고, 숙주 세포가 진핵 세포인 경우에는, 미세 주입법, 칼슘 포스페이트 침전법, 전기 천공법, 리포좀-매개 형질감염법 및 유전자 밤바드먼트 등을 사용할 수 있으나, 이에 한정하지는 않는다.
상기 형질전환된 숙주 세포를 선별하는 방법은 선택 마커에 의해 발현되는 표현형을 이용하여, 당업계에 널리 알려진 방법에 따라 용이하게 실시할 수 있다. 예를 들어, 상기 선택 마커가 특정 항생제 내성 유전자인 경우에는, 상기 항생제가 함유된 배지에서 형질전환체를 배양함으로써 형질전환체를 용이하게 선별할 수 있다. 형질전환된 숙주 세포는 폴리펩티드가 발현 또는 분비되기에 충분한 기간동안 배양될 수 있고, 통상의 단백질에서 사용되고 있는 분리 및 정제 방법, 예를 들어 염석, 용매 침전법 등의 용해도를 이용하는 방법, 투석, 한외 여과, 겔 여과, 도데실황산나트륨-폴리아크릴아미드 겔 전기영동 등 분자량의 차를 이용하는 방법, 이온 교환 크로마토그래피나 히드록실아파타이트 크로마토그래피 등의 하전을 이용하는 방법, 친화성 크로마토그래피 등의 특이적 친화성을 이용하는 방법, 역상 고속 액체 크로마토그래피 등의 소수성의 차를 이용하는 방법, 등전점 전기 영동 등의 등전점의 차를 이용하는 방법 등에 의해 폴리펩티드를 분리 및 정제할 수 있다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체(chimeric antigen receptor, CAR)가 제공된다. 상기 뮤신1-결합 폴리펩티드는 다른 CAR 성분과 함께 단일 사슬의 일부로서 발현되도록 조작될 수 있기 때문에 키메라 항원 수용체에 사용하기에 적합하다.
키메라 항원 수용체는 전형적으로 뮤신1-결합 폴리펩티드를 포함하는 세포외 도메인(extracellular domain); 막관통 도메인(transmembrane domain); 세포내 신호 전달 도메인(intracellular signaling domain 또는 T cell activation domain)을 포함할 수 있다. 또한, 상기 세포외 도메인은 상기 폴리펩티드와 막관통 도메인 사이에 스페이서 영역(또는 힌지 영역)을 추가로 포함할 수 있다. 또한, 키메라 항원 수용체는 1개 이상의 공동자극 도메인(co-stimulatory domain)을 더욱 포함할 수 있으며, 바람직하게는 공동자극 도메인이 막관통 도메인과 세포내 신호 전달 도메인 사이에 위치할 수 있다.
따라서, 바람직한 일예로, 키메라 항원 수용체는 뮤신1-결합 폴리펩티드를 포함하는 세포외 도메인; 힌지 도메인; 막관통 도메인; 1개 이상의 공동자극 도메인; 및 세포내 신호 전달 도메인을 포함할 수 있다. 각각의 도메인은 이종일 수 있다. 즉, 상이한 단백질 쇄로부터 유래된 서열로 구성될 수 있다. 각각의 도메인은 짧은 올리고- 또는 폴리펩티드 링커, 예를 들어 2 내지 10개의 아미노산 길이의 링커로 연결될 수 있다. 또한 키메라 항원 수용체는 각 도메인이 연결된 하나의 폴리펩티드 사슬로 이루어질 수 있다.
세포외 도메인은 전술한 바와 같은 뮤신1-결합 폴리펩티드를 포함하며, 이는 암세포 표면에 발현하는 뮤신1을 인지한다.
세포외 도메인은 스페이서 영역 (또는 힌지 영역)을 더욱 포함할 수 있다. 스페이서 영역은 뮤신1-결합 폴리펩티드와 막관통 도메인 사이에 위치할 수 있다. 스페이서 영역은 뮤신1-결합 폴리펩티드가 CAR-T 세포의 세포막과 일정 거리를 두고 보다 유연하게 표적 항원을 인식할 수 있도록 한다. 스페이서 영역은 전형적으로 폴리펩티드일 수 있고, 10개 이상의 아미노산 길이, 예를 들어 10 내지 300개 아미노산 길이, 10 내지 250 아미노산 길이, 10 내지 200 아미노산 길이, 10 내지 150 아미노산 길이, 10 내지 100 아미노산 길이, 10 내지 50 아미노산 길이를 가질 수 있으나, 이에 제한되지 않는다.
스페이서 영역은 CD8α 또는 CD28의 힌지 부위, 또는 면역글로불린 (IgG)의 불변영역 등을 예시할 수 있으며, 이들에 의한 오프-타겟 효과를 제거하기 위하여 돌연변이를 도입할 수 있다. 예를 들어, 면역글로불린 불변 영역은 IgG 힌지 단독, CH2 및 CH3 도메인의 전부 또는 일부에서 유래될 수 있고, 예를 들어 Fc 영역일 수 있다. IgG 는 바람직하게는 IgG2 또는 IgG4 일 수 있다. 일부 구현예에서, 스페이서는 IgG2, IgG4, 및/또는 IgG2 및 IgG4로부터 유래된 힌지, CH2 및 CH3 서열 중 하나 이상을 함유하는 키메라 폴리펩티드일 수 있다. 일부 구현예에서, 힌지 도메인은 서열번호 112의 서열로 표시될 수 있으나, 이에 제한되지 않는다.
막관통 도메인은 세포막 도메인과 세포막 내부의 신호전달 도메인을 연결하는 역할을 하며, 천연 또는 합성 공급원으로부터 유래될 수 있다. 공급원이 천연인 경우에, 도메인은 임의의 막-결합 또는 막-횡단 단백질로부터 유래될 수 있다. 예를 들어, 막관통 도메인은 T 세포 수용체의 알파, 베타 또는 제타 사슬, CD3 입실론, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137 또는 CD154의 막관통 도메인일 수 있으나, 이에 제한되지 않는다. 바람직한 일예로, 막관통 도메인은 CD28 또는 CD8의 막관통 도메인일 수 있으나, 이에 제한되지 않는다. 공급원이 합성인 경우, 합성 막관통 도메인은 류신 및 발린과 같은 소수성 잔기를 포함할 수 있으며, 페닐알라닌, 트립토판 및 발린 등을 각 말단에 포함할 수 있으나, 이에 제한되지 않는다. 일부 구현예에서, 막관통 도메인은 서열번호 113의 서열로 표시될 수 있으나, 이에 제한되지 않는다.
공동자극 도메인은 공동자극신호가 전달되는 부위로 CAR-T 세포가 면역반응을 일으키고 자가증식을 하도록 신호를 전달하는 부위이다. 이는 CAR-T 세포의 증식, 세포독성, 지속적인 반응, 수명 연장 등을 향상시키기 위해 선택적으로 도입될 수 있다. 공동자극 도메인은 CD28, OX-40 (CD134), 4-1BB(CD137), CD2, CD7, CD27, CD30, CD40, PD-1, ICOS, LFA-1 (CD11a/CD18), CD3 감마, CD3 델타, CD3 엡실론, CD247, CD276 (B7-H3), LIGHT, (TNFSF14), NKG2C, Ig 알파 (CD79a), DAP-10, Fc 감마 수용체, MHC 클래스 1 분자, TNF 수용체 단백질, 이뮤노글로불린 단백질, 사이토카인 수용체, 인테그린, SLAM (signaling lymphocytic activation molecule), 활성화 NK 세포 수용체, BTLA, 톨 리간드 수용체, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp80 (KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8알파, CD8베타, IL-2R 베타, IL-2R 감마, IL-7R 알파, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAMF1( CD150, IPO-3), BLAME (SLAMF8), SELG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, 또는 CD19a 의 신호전달 부위에서 선택된 1종 이상, 예를 들어 1종, 2종 또는 3종일 수 있으나, 이에 제한되지 않는다. 바람직한 구현예로는, CD28, OX-40 (CD134), 4-1BB (CD137), CD27 또는 ICOS의 신호전달 부위에서 선택된 1종 이상, 예를 들어 1종, 2종 또는 3종일 수 있으나, 이에 제한되지 않는다. 일부 구현예에서, 공동자극 도메인은 서열번호 114의 서열로 표시될 수 있으나, 이에 제한되지 않는다.
세포내 신호 전달 도메인은 뮤신1-결합 폴리펩티드에 결합한 항원에 대해 T 세포 면역반응을 활성화시키는 부위이다. 상기 신호 전달 도메인은 T 세포 수용체(TCR)의 성분이거나 타이로신-기반 활성화 모티프 (immunoreceptor tyrosine-based activation motif, ITAM)로 알려진 신호 전달 모티프를 함유할 수 있다. 그 예로, 신호 전달 도메인은 TCR 또는 CD3 제타, FcR 감마, CD3 감마, CD3 델타 및 CD3 엡실론으로부터 유래된 신호전달 도메인일 수 있으나, 이에 제한되지 않는다. 바람직한 예로는, CD3 제타의 신호전달 도메인일 수 있으나, 이에 제한되지 않는다. 세포내 신호 전달 도메인은 세포외 도메인의 뮤신1-결합 폴리펩티드 부위가 표적에 결합시, CAR-T 세포를 활성화할 수 있다. 예를 들어, CAR는 T 세포의 기능, 예를 들어 세포 용해 활성 또는 T-헬퍼 활성을 자극하고, 사이토카인 또는 다른 인자의 분비를 유도할 수 있다. 일부 구현예에서, 세포내 신호 전달 도메인은 서열번호 115의 서열로 표시될 수 있으나, 이에 제한되지 않는다.
일부 구현예에서, CAR은 신호 서열을 포함하는 형태로 발현될 수 있다. 또한 CAR은 발현을 모니터링하는 데 유용한 추가 서열, 예를 들어, 2A 펩타이드와 같은 리보솜 스킵(skip) 서열 또는 절단형 세포 표면 폴리펩티드 (tHER2 또는 tEGFR 또는 절단된 PSMA 등) 와 함께 발현될 수 있다.
본 발명의 다른 측면에 따라, 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드가 제공된다. 일부 구현예에서, 폴리뉴클레오티드는 인간에서의 발현을 위한 코돈 최적화될 수 있다.
본 발명의 다른 측면에 따라, 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터가 제공된다. 벡터는 유전자 클로닝을 위한 벡터, 단백질의 발현을 위한 벡터, 또는 유전자의 전달을 위한 벡터로서 구축될 수 있다. 클로닝 또는 발현을 위한 벡터의 경우 상세한 사항은 전술한 바와 같다.
기술분야에 공지된 임의의 벡터가 본 발명에 적합할 수 있다. 예를 들어, 벡터는 바이러스 벡터일 수 있다. 예를 들어, 벡터는 레트로바이러스 벡터, DNA 벡터, 뮤린 백혈병 바이러스 벡터, SFG 벡터, 플라스미드, RNA 벡터, 아데노바이러스 벡터, 바큘로바이러스 벡터, 엡스타인 바르 바이러스 벡터, 파포바바이러스 벡터, 백시니아 바이러스 벡터, 단순 포진 바이러스 벡터, 아데노바이러스 연관 벡터 (AAV), 또는 렌티바이러스 벡터일 수 있으나 이에 제한되지 않는다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 발현하는 면역 세포가 제공된다.
면역 세포는 T 세포, 종양 침윤 림프구 (Tumor Infiltrating Lymphocyte, TIL), NK(Natural killer) 세포, TCR-발현 세포, 수지상 세포, 또는 NK-T 세포를 포함하나, 이에 제한되지 않는다. 또한 면역세포는 인간 유도만능 줄기세포(iPSC)에서 유래한 것일 수 있다. 면역 세포는 공지된 임의의 공급원으로부터 유래될 수 있다. 예를 들어, 면역 세포는 조혈 줄기 세포 집단으로부터 시험관내 분화되거나, 환자로부터 수득될 수 있다. 면역 세포는 예를 들어, 말초 혈액 단핵 세포 (PBMC), 골수, 림프절 조직, 제대혈, 흉선 조직, 감염 부위로부터의 조직, 복수, 흉막 삼출, 비장 조직, 및 종양으로부터 수득될 수 있다. 또한, 면역 세포는 관련 기술분야에서 입수 가능한 1종 이상의 면역 세포주로부터 유래될 수 있다.
면역 세포는 자가(autologous) 또는 동종(allogenic)일 수 있다. 자가는 치료대상 환자로부터 유래된 것을 말한다. 동종은 치료대상 환자와 동일한 종의 다른 개체에서 유래된 것을 말한다.
또한 면역 세포는 인간 유도만능 줄기세포(iPSC)에서 유래한 것일 수 있다. iPSC 에서 유래한 면역세포는 자가 또는 동종 면역세포에 비하여 자체증식이 가능하여 대량증식이 용이하고 모든 사람에게 적용가능한 범용적인 세포치료제 제작이 가능하며 균질한 생산과 원가 절감이 가능한 이점이 있다.
면역 세포는 미세주입, 전기천공, 초음파천공, 바이오리스틱 (예를 들어, 유전자 총), 지질 형질감염, 중합체 형질감염, 칼슘 포스페이트 침전, 원형질체 융합, 리포좀-매개 형질 감염, 나노입자 또는 폴리플렉스 등의 방법을 사용하여 벡터에 의해 형질감염 또는 형질도입될 수 있으나, 이에 제한되지 않는다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 세포; 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체; 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드; 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 또는 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하거나 상기 키메라 항원 수용체를 발현하는 면역 세포를 포함하는, 암의 예방 또는 치료용 조성물이 제공된다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 세포; 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체; 상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드; 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 또는 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하거나 상기 키메라 항원 수용체를 발현하는 면역 세포의 유효량을 암의 예방 또는 치료를 필요로 하는 환자에게 투여하는 단계를 포함하는 암의 예방 및/또는 치료 방법이 제공된다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 포함하는 T 세포를 포함하는, 암의 예방 또는 치료용 조성물이 제공된다.
본 발명의 다른 측면에 따라, 상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 포함하는 T 세포의 유효량을 암의 예방 또는 치료를 필요로 하는 환자에게 투여하는 단계를 포함하는 암의 예방 및/또는 치료 방법이 제공된다.
예를 들어, 암은 고형암 또는 혈액암일 수 있고, 비제한적인 예시로는, 유방암, 폐암, 전립선암, 난소암, 뇌암, 간암, 자궁경부암, 자궁내막암, 자궁암, 결장암, 대장암, 결장직장암, 직장암, 신장암, 콩팥모세포종, 피부암, 경구 편평 상피암, 표피암, 비인두암, 두경부암, 골암, 식도암, 방광암, 림프관암(예를들어, 호지킨 림프종 또는 비-호지킨 림프종), 위암, 췌장암, 고환암, 갑상선암, 갑상샘소포암, 흑색종, 골수종, 다발성 골수종, 중피종, 골육종, 골수이형성 증후군, 간엽 기원의 종양, 연조직 육종, 지방육종, 위장 기질 육종, 악성 말초 신경집 종양 (MPNST), 유잉 육종, 평활근육종, 간엽 연골육종, 림포육종, 섬유육종, 횡문근육종, 기형암종, 신경모세포종, 수모 세포종, 신경교종, 피부의 양성 종양, 또는 백혈병일 수 있다. 폐암은, 예를 들어 소세포폐암종(SCLC) 또는 비-소세포폐암종(NSCLC)일 수 있다. 백혈병은, 예를 들어 급성 골수성 백혈병(AML), 만성 골수성 백혈병(CML), 급성 림프구성 백혈병(ALL) 또는 만성 림프구성 백혈병(CLL)일 수 있다.
바람직하게, 암은 MUC1 단백질이 발현된 암으로서, 유방암, 피부암, 췌장암, 전립선암, 폐암, 갑상선암, 위암, 난소암, 대장암, 간암, 담낭암, 신장암, 자궁경부암, 또는 방광암일 수 있으나, 이에 제한되는 것은 아니다. 상기 암은 원발성 암 또는 전이성 암일 수 있다.
치료대상 환자는 2차적인 항-과다증식 요법을 받고 있는 환자일 수 있다. 예를 들어, 2차적인 항-과다증식 요법은 화학요법, 방사선요법, 면역요법, 광선요법, 냉동요법, 독소요법, 호르몬요법, 또는 외과수술일 수 있다.
본원의 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 포함하는 T 세포를 이용한 CAR-T 항암 치료는, 건강한 사람 또는 치료대상 환자의 혈액에서 T 세포를 추출한 뒤, 본원의 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 발현하도록 유전적으로 조작하고, 조작된 T 세포를 증폭 배양하고, 배양된 조작 T 세포를 환자에게 투여하는 일련의 과정으로 이루어질 수 있다.
바람직한 구현예로, 건강한 사람 또는 치료대상 환자의 혈액에서 T 세포를 추출하는 단계는, 예를 들어 혈액에서 백혈구성분분리채집(leukapheresis 또는 aphresis) 을 이용하여 백혈구를 분리한 후 T 세포를 농축하는 과정을 거쳐 T 세포를 추출할 수 있다. T 세포는 CD4/CD8 구성 수준에서 특정 항체 비드 결합체나 마커를 사용하여 분리될 수 있다. 대안적으로, 줄기세포로부터의 분화를 통해 안정적으로 대량의 T 세포를 얻는 것도 가능하다.
상기 추출된 T 세포가 본원에서 제공하는 키메라 항원 수용체를 발현하도록 유전적으로 조작하는 단계는, 예를 들어 키메라 항원 수용체(CAR)를 발현하도록 디자인된 핵산분자를 벡터, 예를 들어, 바이러스 벡터(렌티바이러스 벡터 또는 레트로바이러스 벡터 등)를 이용하여 T 세포에 주입할 수 있다. CAR 는 DNA 형태로 도입될 수도 있고, RNA 형태로 도입된 후 역전사효소에 의해 DNA 로 역전사된 후 T 세포의 게놈에 통합될 수도 있다. 또한, 동종 세포치료제의 경우 이식편대숙주질환(GvHD) 등 거부반응을 일으키지 않도록, 공여자 T 세포에서 이식 거부 반응을 유도하는 유전자들을 제거하거나 교정하는 유전자 조작을 추가로 가할 수 있다.
상기 조작된 T 세포를 증폭 배양하는 단계는, 당업계 공지된 배양기술에 따라 T 세포를 배양, 증식(proliferation) 및 증폭(expansion) 시킬 수 있다. 이때 바이러스 사용에 대한 안전성과 잘 제작된 CAR-T 세포를 선별하는 기술이 요구된다.
마지막으로, 조작 T 세포를 환자에게 다시 투여하는 단계는, 예를 들어 주입(infusion)으로 이루어질 수 있다. 바람직한 일예로, CAR-T 세포의 주입 전, 환자는 백혈구 수치를 낮추기 위해, 사이클로포스파미드 또는 플루다라빈 등을 이용한 림프구 제거 조절 화학요법을 받을 수 있다. 또한, CAR-T 세포의 지속성을 향상시키기 위하여 IL-2 등의 사이토카인을 함께 투여할 수 있다.
환자에게 투여된 조작된 T 세포는 뮤신1을 발현하는 종양 세포에 대해 면역 반응을 매개할 수 있다. 이러한 면역 반응에는 T 세포의 활성화, T 세포에 의한 IL-2 및 IFN-감마 등의 사이토카인의 분비, 종양 항원을 인식하는 T 세포의 증식 및 확장, 및 표적-양성 세포의 T 세포-매개된 특이적 사멸(종양 제거)을 포함한다. 예를 들어, CAR-T 세포에서 CAR 가 뮤신1에 특이적으로 결합하면 T 세포는 CD3 제타의 타이로신-기반 활성화 모티프 (immunoreceptor tyrosine-based activation motif, ITAM) 의 인산화를 통해 활성화되고, 이후, T 세포의 증식, 세포독성 및/또는 사이토카인 분비가 유도될 수 있다.
이와 같이 CAR-T 세포를 이용한 항암 요법은, 근본적으로 환자의 면역 체계를 활성화하여 지속적인 항암 효과를 발휘하기 때문에, 계속 투여하지 않아도 되며, 환자 자신의 T 세포를 이용함으로써 환자 개인 맞춤식 치료가 가능한 장점이 있다.
본원의 조성물의 투여는, 질병 상태의 발병 또는 진행을 저해하거나, 중지시키거나, 지연시키거나, 예방하는 면역반응을 일으키거나, 유도하거나 촉진할 수 있다.
용어 "유효량"은 인간을 비롯한 개체에게 투여하였을 때, 원하는 결과를 달성하는데 충분한 양, 예를 들어 암을 치료 또는 예방하는데 효과적인 양을 의미한다. 유효량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 질환의 중증도, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 다양한 인자에 따라 달라질 수 있다. 투여량 또는 치료 용법은 당업자들이 이해하는 바와 같이 최적의 치료 반응을 제공하도록 조정할 수 있다.
치료학적 유효량을 이용한 치료 용법은 1회 투여로 구성되거나, 또는 다른 예로, 일련의 적용을 포함할 수 있다. 치료기의 기간은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 질환의 중증도, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 다양한 인자에 따라 결정된다. 또한, 치료에 사용되는 항암 조성물의 유효 투여량은 개별 치료 용법의 코스 동안 높이거나 낮출 수 있는 것으로 이해될 것이다. 투여량에 변화가 생길 수 있으며, 당해 기술 분야에 공지된 표준 진단 분석을 통해 명확해질 수 있다. 본 발명의 조성물은, 몇몇 측면들에서, 통상적인 항암제, 방사선치료, 호르몬 치료, 바이오테라피 및/또는 외과적 종양 절제를 이용한 치료 전에, 치료 중에 또는 치료 후에, 투여할 수 있다.
본원의 조성물은 약학적으로 허용되는 담체, 희석제, 및 부형제 등으로 이루어진 군에서 선택된 1종 이상의 첨가제와 함께 제공될 수 있다.
상기 약학적으로 허용되는 담체는, 항체의 제제화에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘, 미네랄 오일 등으로 이루어진 군에서 선택된 1종 이상일 수 있으나, 이에 한정되는 것은 아니다. 상기 조성물은 상기 성분들 이외에 약학적 조성물 제조에 통상적으로 사용되는 희석제, 부형제, 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등으로 이루어진 군에서 선택된 1종 이상을 추가로 포함할 수 있다.
조성물은 경구 또는 비경구로 투여될 수 있다. 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화될 수 있다. 또한, 상기 조성물은 활성 물질이 표적 세포로 이동할 수 있는 임의의 장치에 의해 투여될 수 있다.
상기 세포는 표준 투여 기술, 제형 또는 디바이스를 사용하여 투여될 수 있다. 조성물의 저장 및 투여를 위한 주사기 및 바이알과 같은 제형 및 디바이스를 적절히 사용할 수 있다. 세포의 투여는 자가 (autologous), 동종 (allogenic), 또는 이종 (xenogenic) 일 수 있다. 말초 혈액 유래 면역 세포 또는 이의 자손(예를 들어, 생체 내, 생체 외 또는 시험관 내 유래)은 카테터 투여, 전신 주사, 국소 주사, 정맥 주사 또는 비경구 투여를 포함하는 국소 주사를 통해 투여될 수 있다. 면역 세포 치료제를 투여할 때, 일반적으로 이는 주사 가능한 단위 투여량 형태(용액, 현탁액, 에멀젼)으로 제형화될 수 있다. 일부 구현예에서, 세포 집단은 비경구적으로 투여될 수 있다. 제형은 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여를 포함한다.
일부 구현예에서 조성물은 멸균 액체 제제로서, 예를 들어, 등장성 수용액, 현탁액, 에멀젼, 분산액 또는 점성 조성물로 제공되며, 이는 일부 측면에서 선택된 pH로 완충될 수 있다. 액체 제제는 일반적으로 겔, 다른 점성 조성물 및 고체 조성물보다 제조가 보다 용이하다. 또한, 액체 조성물은 특히 주사에 의해 투여하기가 편리하다. 다른 한편으로, 점성 조성물은 특정 조직과의 보다 긴 접촉 기간을 제공하기 위해 적절한 점도 범위 내에서 제형화될 수 있다. 액체 또는 점성 조성물은 예를 들어, 물, 식염수, 인산 완충 식염수, 폴리올(예를 들어, 글리세롤, 프로필렌 글리콜, 액상 폴리에틸렌 글리콜) 및 이의 적합한 혼합물을 함유하는 용매 또는 분산 배지일 수 있는 담체를 포함할 수 있다.
멸균 주사용 용액은 적합한 담체, 희석제 또는 멸균수, 생리식염수, 포도당, 덱스트로스 등과 같은 부형제와의 혼화제와 같은 용매에 결합 분자를 통합함으로써 제조될 수 있다. 조성물은 또한 동결 건조될 수 있다. 조성물은 투여 경로 및 원하는 제조 경로에 따라 습윤제, 분산제 또는 유화제(예를 들어, 메틸셀룰로오스), pH 완충제, 겔화 또는 점도 향상 첨가제, 방부제, 향미제, 색소 등과 같은 보조 물질을 함유할 수 있다.
항균 방부제, 항산화제, 킬레이트화제 및 완충액을 포함한 조성물의 안정성 및 멸균성을 향상시키는 다양한 첨가제를 첨가할 수 있다. 미생물의 작용의 예방은 다양한 항균 및 항진균제, 예를 들어 파라벤, 클로로부탄올, 페놀, 소르브산 등에 의해 보장될 수 있다. 주사용 약학적 형태의 장기간 흡수는 흡수를 지연시키는 제제, 예를 들어, 알루미늄 모노스테아레이트 및 젤라틴의 사용에 의해 초래될 수 있다.
이하 본 발명을 다음의 실시예에 의하여 보다 구체적으로 설명하고자 한다. 그러나 이들은 본 발명을 예시하기 위한 것일 뿐이며, 본 발명의 범위가 이들 실시예에 의하여 제한되는 것은 아니다.
실시예 1.뮤신1에 결합하는 scFv 의 제조
인간 뮤신1(서열번호 110)을 CD4 (서열번호 111)와 접합시켜 재조합 항원을 준비하고, scFv 라이브러리로부터 상기 항원에 특이적인 scFv를 분비하는 클론을 스크리닝하여, 뮤신1에 특이적으로 결합하는 scFv 10 종을 선별하였다. 선별된 scFv 10종과, 이후 실험에 사용된 양성대조군 scFv G03 (WO2018/174544의 표 6의 G3 항체의 아미노산 서열을 이용하여 만든 양성대조군임)의 서열 정보를 표 3에 나타내었다.
클론명 scFv 아미노산 서열
2445_1F09 EVQLLETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGWNHGMDVWGQGTLVTVSSGGGGSGGGGSGGGASQSGLTQPPSASGTPGQRVTISCSGGSSEVGSRYVSWYQQLPGTAPRLLIYKNDRRPSGVPDRFSGSKSGSSASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKLTVL (서열번호 9)
2447_2H08 EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTTVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVTITCQGDSLRTSYAGWLQQKPGQAPVLVLYGKTSRPSGIPDRFSGSTSGNTASLTITGAQAEDEAEYFCHSRDSNDNYLEVVFGGGTKLTVL (서열번호 19)
2447_3A01 EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIVYADFVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDISSGWYPGTFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTVTGAQAEDEADYYCSSRDSSDDVVFGGGTQLTVL (서열번호 29)
2447_3A08 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDRATIFGVVTPFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSIRSYSASWYQQKPGQAPRLVIYGKNNRPSGIPDRVSGSTSGNTASLTVTGAQAEDEADYYCNSRDSSGNRVVFGGGTQLTVL (서열번호 39)
2447_3A09 EVQLLESGGGLVQPGRSLRLSCAATGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTASYYCAKDVSSGWYWYAFDIWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPGRFSGSSSGNTASLTVTGAQAEDEADYYCNSRDSGGSVVFGGGTKLTVL (서열번호 49)
2447_3A12 EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLRGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVVLGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHRVFGGGTKLTVL (서열번호 59)
2447_3B07 QVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSLTSWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKDHSSGWYNGGMDVWGQGTMVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL (서열번호 69)
2447_3C08 EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDRGSGYEGNYYGMDVWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGTTSGNTASLTITGAQAEDEADYYCNSRDSSGNHYVFGTGTKVTVL (서열번호 79)
2447_3H02 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDVSSGWYWYAFDIWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDILRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNRVVFGGGTKLTVL (서열번호 89)
2447_3H08 EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSSGWYTGSFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYRQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTIIGAQAEDEADYYCQSRDSSDNRVLFGGGTKVTVL (서열번호 99)
G03 EVQLVQSGAEVKKPGATVKISCKVSGYTFTSYWMHWVQQAPGKGLEWIGYINPGTGYIEYNQKFKDRVTITADKSTDTAYMELSSLRSEDTAVYYCASSTAPFDYWGQGTLVTVSSGGGGSGGGGSGGGASEIVLTQSPGTLSLSPGERATLSCKASQDIKSYLSWYQQKPGQAPRLLIYYATRLADGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCLQYDESPYTFGQGTKLEIK (서열번호 109)
클론명 scFv 염기 서열
2445_1F09 GAGGTGCAGCTGTTGGAGACTGGAGGAGGCTTGATCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGGTTCACCGTCAGTAGCAACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGTTATTTATAGCGGTGGTAGCACATATTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGATCGCGGCTGGAACCACGGTATGGACGTCTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCCAGTCTGGGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGGGGCAGCTCAGAAGTCGGAAGTAGATATGTGTCCTGGTACCAGCAACTCCCAGGAACGGCCCCCAGACTCCTCATCTATAAGAATGATCGGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCTCCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTTATGTCTTCGGAACTGGGACCAAGCTGACCGTCCTA (서열번호 10)
2447_2H08 GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAACTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCCGCATATTTTGACTGGTTATTATAGGGGAGGGTGGTTCGACCCCTGGGGGCAAGGGACCACGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGTCAGACAGTCACCATCACGTGCCAAGGAGACAGCCTCAGAACCTCTTATGCAGGCTGGCTCCAGCAGAAGCCAGGACAGGCCCCTGTACTCGTCCTCTATGGTAAAACCAGCCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCACCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAGGATGAGGCTGAGTATTTCTGTCACTCCCGGGACAGCAATGATAACTATCTAGAGGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 20)
2447_3A01 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGTCTATGCGGACTTTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATATTTCAAGTGGCTGGTACCCAGGGACCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGACGAGGCTGACTATTACTGTAGCTCCCGGGACAGCAGTGATGATGTGGTATTCGGCGGAGGGACCCAGCTCACCGTCCTA (서열번호 30)
2447_3A08 GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCGGGCTACGATTTTTGGAGTGGTTACCCCCTTTGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCCGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAGGGAGACAGTATTAGAAGTTATTCTGCCAGCTGGTACCAGCAGAAGCCAGGGCAGGCCCCTCGCCTTGTTATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGAGTCTCTGGCTCCACTTCAGGAAATACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCGTGTGGTATTCGGCGGAGGGACCCAGCTCACCGTCCTA (서열번호 40)
2447_3A09 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCACTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTCGTATTACTGTGCAAAAGATGTTAGCAGTGGCTGGTACTGGTATGCTTTTGATATCTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGGCCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAATTCCCGGGACAGCGGTGGTTCTGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 50)
2447_3A12 GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTATGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCGGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCCGCATATTTTGACTGGTTATTATAGGGGAGGGTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGTCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATCGTGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 60)
2447_3B07 CAGGTGCAGCTGGTGGAGTCTGGGGGAGTCGTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGTCAAGCTCCGGGGAGGGGTCTGGAGTGGGTCTCTCTTACTAGTTGGGATGGTGGTAGCACATACTATGCAGACTCTGTGAAGGGTCGATTCACCATCTCCAGAGACAACAGCAAAAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACCGCCTTGTATTACTGTGCAAAAGATCATAGCAGCGGCTGGTACAACGGGGGTATGGACGTCTGGGGCCAAGGGACAATGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 70)
2447_3C08 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATAGGGGTAGTGGCTACGAAGGAAACTACTACGGTATGGACGTCTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGTACCACCTCAGGAAACACAGCCTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCTA (서열번호 80)
2447_3H02 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGGATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATGTTAGCAGTGGCTGGTACTGGTATGCTTTTGATATCTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACATCCTCAGAAGTTATTATGCAAGTTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATTTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCGTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 90)
2447_3H08 GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACAGCTGTGTACTACTGTGCGAGAGATCGGAGTAGTGGCTGGTACACGGGGTCCTTTGACTACTGGGGCCAGGGCACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCGGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCGGGAAACACAGCTTCCTTGACCATCATTGGGGCTCAGGCGGAAGACGAGGCTGACTATTACTGTCAGTCCCGGGACAGCAGTGATAACCGTGTTCTATTCGGCGGAGGGACCAAGGTCACCGTCCTA (서열번호 100)
상기 scFv 를 포함하는 scFv-Fc 항체의 뮤신1 항원에 대한 친화력을 Biacore T200 (GE healthcare)를 사용하여 측정하였다. Series S Sensor Chip CM5 (GE healthcare, Cat. No. BR-1005-30) 상에 Amine Coupling Kit (GE healthcare, Cat. No. BR-1000-50)을 이용하여 anti-human IgG (Fc) 항체 (GE healthcare, Cat. No. BR-1008-39, 최종 농도 25 ug/mL)를 5 uL/min으로 360초 동안 흘려 약 5000-7000 RU로 고정시켰다. 항원인 인간 MUC1 단백질 을 25 nM부터 400 nM까지의 농도 범위 내에서 서로 다른 5개의 농도로 30 uL/min의 속도로 주입하여, 하기 표와 같이 ka과 kd 값을 구하고, 이로부터 KD값을 계산하였다. 그 결과 뮤신1에 대한 결합 친화도를 나타내는 KD (M) 값을 표 5에 나타내었다.
클론명 KD (M)
2447_2H08 94.8 x 10-9
2447_3A01 51.5 x 10-9
2447_3A08 320.3 x 10-9
2447_3A09 62.1 x 10-9
2447_3A12 13.8 x 10-9
2447_3B07 51.7 x 10-9
2447_3C08 24.0 x 10-9
2447_3H02 58.8 x 10-9
2447_3H08 39.9 x 10-9
G03 27.6 x 10-9
실시예 2. 뮤신1에 결합하는 scFv 를 이용한 CAR-T 세포의 제조
2-1. CAR 를 발현하는 렌티바이러스 전달 벡터 제작
scFv 폴리펩티드 서열을 포함하는 세포 외 도메인(표 4의 염기서열), 힌지(CD8α)(서열번호 112) 및 막 관통 도메인(CD28)(서열번호 113), 공동자극 도메인 (CD28)(서열번호 114), 및 세포 내 신호전달 도메인(CD3제타) (서열번호 115)을 포함하는 키메라 항원 수용체(CAR)를 발현하는 렌티바이러스 벡터(transfer vector 또는 expression vector)를 제조하였다. CAR의 scFv 부분은 screening 업체로부터 공급받은 플라스미드에서 PCR을 단편을 분리하였으며 힌지 (hinge), 막 관통 단백질, CD28 및 CD3z 신호전달 도메인은 기합성된 플라스미드에서 PCR로 단편 분리하였다. 두 개의 단편은 Takara사의 In-Fusion HD 클로닝 키트를 이용하여 Clonetech사의 pLVX-EF1alpha 벡터에 클로닝하였다. 이렇게 클로닝된 렌티바이러스 벡터는 동사의 Lenti-X Expression System (EF1a Version) (제품코드 631253)에서 제공되는 패키징 플라스미드와 함께 Takara사의 Lenti-X 293T Cell Line에 트랜스펙션 (제품코드 632180)시켰으며 24시간 후 soup를 분리하여 그 안에 있는 렌티바이러스를 추후 연구에 사용하였다.
2-2. 렌티바이러스 입자의 생성
렌티바이러스를 생성하기 위하여 상기 제조한 렌티바이러스 전달 벡터(transfer vector 또는 expression vector)와 패키징 플라스미드 혼합체(lentivirus packaging plasmid mix)를 리포좀 핵산 전달 시약(lipofectamine, Gibco)을 사용하여 Lenti-X 293T 세포(Takara 제품번호 632180)에 트랜스펙션(transfection)하였다. 형질주입 하루 전에 HEK293T 세포를 배양 플레이트 면적의 6~70% 가량 존재하도록 준비하였다. 배지는 10% 열에 의해 불활성화된 우태아혈청(FBS, Gibco) 이 첨가된 Dulbecco's modified Eagle medium(DMEM, Gibco)을 사용하였으며, 배양 플레이트는 100mm 또는 150mm 크기를 사용하였다. 배양 조건으로 37℃, 5% CO2, 가습조건을 유지하였다. 전달 벡터와 렌티바이러스 패키징 플라스미드 혼합체 그리고 리포좀 핵산 전달 시약을 제조업체의 설명에 따라 비율을 맞추어 상온에서 혼합한 뒤, 배양 중인 플레이트 위의 HEK293T 세포에 drop 방식으로 처리함으로써 HEK293T 세포를 형질 주입시켰다. 형질 주입 후 HEK293T 세포에서 제작된 렌티바이러스는 세포 밖으로 분출되어 나와 바이러스 입자(virus particle) 형태로 세포 배양액에 존재하였다. 이에 형질주입 48시간 뒤, 배양 플레이트에서 세포 배양액만을 걷어내 원심분리를 진행하여 렌티바이러스 입자를 펠렛 형태로 얻었다. 이후 용액를 이용하여 펠렛을 풀어낸 뒤 즉시 사용하거나, 초저온 냉동고에 보관하였다. 용액은 앞서 사용한 DMEM 배지 혹은 T 세포 배양에 사용되는 CTS optimizer T cell Expansion SFM 1L병(Gibco)에 Optimizer T-Cell Expansion Supplement(26ml) 첨가하고, CTS Innume Cell SR(Serum Replacement, Gibo)를 최종 2%가 되도록 첨가하고, CTS GlutaMAX-I Supplement 100X(Gibco)를 최종 1X가 되도록 첨가한 것을 사용하였다.
2-3. CAR-T 세포의 제조
말초 혈액 단핵 세포 (PBMC) 샘플은 가톨릭대학교와의 연구 협약을 통해 공급받았으며 가톨릭대학교 임상연구심사위원회(The Catholic University of Korea-Institutional Review Board)의 승인을 거쳐 공여자 모집 및 혈액 채취를 진행하였다. 모두 정상인의 혈액을 사용하였다. 본원의 실시예에서 "Donor"은 실험에 사용된 PBMC 샘플의 공여자를 지칭하며, Donor 뒤의 숫자는 공여자가 각각 상이함을 의미한다 (예를 들어, Donor 03, Donor 04, Donor 05, Donor 06, Donor 07, Donor08, Donor 18-09, Donor 20-01 등으로 표시함). T세포 표면에 키메라 항원 수용체(CAR)가 발현된 CAR-T 세포를 제조하기 위해, 동결 PBMC 바이알을 37℃ 항온 수조에서 해동하였다. 동결 PBMC 해동 다음 날, 세포 수 측정 후 세포를 새로운 배지로 교체하였다. 이와 동시에 T 세포 특이적 증폭 비드(Dynabeads Human T-expander CD3/CD28, Gibco)를 사용하여 T-세포를 활성화하고, 렌티바이러스 형태로 되어있는 키메라 항원 수용체(CAR)를 활성화된 세포 수에 맞추어 처리하여 T 세포에 형질도입(transduction) 시켰다. 형질 전환된 T세포를 배양하기 위해 여과된 멸균 증류수로 풀어낸 인터류킨-2(Interleukin-2, Norvatis) 현탁액을 배지 양 기준 100IU/ml이 되도록 첨가하고, 이후의 배양기간 동안 배지 교체 혹은 첨가 시 마다 지속적으로 넣어주었다. 세포 배양 기간은 활성화시킨 후 전체 10-11일로 하며, 배지는 세포 수에 따라 1~2일 마다 교체 혹은 새로이 첨가하며 배양을 진행하고, 배양 기간이 끝나면 세포 배양을 마무리하고 CAR-T 세포 제작을 완료하였다. 제작된 CAR-T 세포는 즉시 사용하거나 세포 동결보존액과 혼합하여 세포 동결용 바이알에 주입 후 액화질소탱크(Liquid Nitrogen Tank)에 보관하였다. 제작된 CAR-T 세포의 키메라 항원 수용체(CAR)의 발현량 확인 및 특성 분석은 유세포분석(FACS)을 통해서 진행하였다.
실시예 3.가용성 scFv의 뮤신1-발현 세포에 대한 친화력 분석
이하, 특별한 언급이 없는 한, 본원의 실시예에서 사용한 세포주에 대한 정보는 다음과 같다:
- PANC-1; 한국세포주은행, 21469
- HCC1954; 한국세포주은행, 9S1954
- HCC70; 한국세포주은행, 9S0070
- T47D; 한국세포주은행, 30133
- HEK293T; ATCC, CRL-3216
- Huh7; 한국세포주은행, 60104
- HepG2; ATCC, HB-8065
- SK-N-SH; 한국세포주은행, 30011
실시예 3에서 사용한 세포주는 총 4종류이고 이중 음성대조군으로 HEK293(ATCC) 및 PANC-1 (ATCC) 세포주를 사용하였으며 양성대조군으로 HEK293T-v1 (ATCC 및 LG화학에서 형질전환) 및 T47D (한국세포주은행) 세포주를 사용하였다. 양성대조군으로 사용한 HEK293T-v1 세포주는 뮤신1을 발현하지 않는 HEK293T 세포주에 MUC1의 C 서브유닛을 발현시킨 세포주이다. 사용한 scFv는 11종류이며 이 중 양성대조군은 G03이다 (표 3). 실시예 1에서 제조한 가용성 scFv를 5배씩 희석하여 총 8단계의 농도로 준비하였다. 각 단계별 농도는 380μg/mL, 76μg/mL, 15.2μg/mL, 3.04μg/mL, 0.608μg/mL, 0.1216μg/mL, 0.02432μg/mL, 0.004864μg/mL였다. 가용성 scFv 희석 및 세포 세척시 사용한 버퍼는 2% FBS, 10mM EDTA가 들어간 PBS이다. 4종류의 세포를 1X106/mL로 준비하여 96well U-bottom 세포 배양 플레이트에 1X105/100μl/well로 넣고 1500RPM에서 5분간 원심분리하였다. 앞서 만들어둔 가용성 scFv를 50μl/well로 처리하였다. 4℃에서 1시간 정치하였다. 세포 세척용 버퍼를 150μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. 상층액을 버린 후 세포 세척용 버퍼를 200μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. Goat anti-human IgG Fc-biotin antibody(Invitrogen, A18821)을 500배 희석하여 50μl/well로 처리하였다. 4℃에서 20분간 정치하였다. 세포 세척용 버퍼를 150μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. 상층액을 버린 후 세포 세척용 버퍼를 200μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. PE-Streptavidin(BD Pharmigen, 554061)을 1000배 희석하여 50μl/well로 처리하였다. 4℃에서 20분간 정치하였다. 세포 세척용 버퍼를 150μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. 상층액을 버린 후 세포 세척용 버퍼를 200μl/well로 넣고 섞어준 후 1500RPM에서 5분간 원심분리하였다. 세포 세척용 버퍼를 80 μl/well로 넣고 섞어준 후 유세포분석기로 분석하였다.
가용성 scFv의 뮤신1-발현 세포에 대한 친화력은 유세포 분석기의 결과 값 중 PE MFI값으로 확인하였다. 각 세포주에 가용성 scFv는 넣지 않고 다른 형광 항체(Goat anti-human IgG Fc-biotin antibody, PE-Streptavidin) 를 이용하여 염색을 진행한 값을 음성대조군값으로 두고, 각 세포별 G03을 380μg/mL농도로 처리했을 때의 값을 양성대조군값으로 두어 다음과 같이 MFI값을 보정하였다:
(실험값-음성대조군값)/(양성대조군값-음성대조군값)X100=실험값의 보정값
보정한 값을 이용하여 EC50을 구하였으며, 기술된 결과값은 양성대조군으로 사용한 두가지의 세포주의 결과값이다 (표 6).
클론명 EC50 (293T-v1) (ug/ml) EC50 (T47D) (ug/ml)
G03 3.46 3.56
2445_1F09 1.51x107 6.19x107
2447_3A01 4.78 11.14
2447_3A08 1.73 3.76
2447_3A09 1.96 2.2
2447_3A12 1.47 0.75
2447_3C08 1.38 2.04
2447_3H02 1.41 1.6
2447_3H08 2.57 5.6
2447_2H08 21.73 130.4
2447_3B07 3.86 3.47
실시예 4. CAR-T 세포의 사이토카인 분비 분석
MUC1-양성 종양세포(T47D, HEK293T-V1)에 대한, 항 MUC1 scFv가 CAR 형태로 주입된 면역세포(T 세포)의 반응성을 평가하였다. MUC1이 자연적으로 많이 발현하는 T47D 세포와, 사람의 MUC1의 C 서브유닛을 과발현시킨 HEK293T-V1 세포에, 실시예 2에 따라 제조한, 항 MUC1 scFv가 CAR 형태로 주입된 면역세포 2445_1F09, 2447_3A01, 2447_3A08, 2447_3A09, 2447_3A12, 2447_3C08, 2447_3H02, 2447_3H08, 2447_2H08, 2447_3B07 (또는 일부 도면에서는 각각 1F09, 3A01, 3A08, 3A09, 3A12, 3C08, 3H02, 3H08, 2H08, 3B07 로 약칭함) 총 10 종을 종양세포:면역세포의 비율 1:1.5로 맞춰 24시간 동안 동시배양하였다. 이로부터 얻어진 배양액 내의 사이토카인 2종, 즉, 인터페론-감마(IFNg)와 인터류킨-2(IL-2) 농도를 ELISA를 통하여 확인하였다. ELISA 분석 방법은 통상적으로 사용되는 방법과 같다. 간단히 서술하자면 다음과 같다. 먼저, 96웰 면역 플레이트에 인터페론-감마 또는 인터류킨-2를 잡을 수 있는 캡쳐 항체(capture antibody)로 코팅하고, 1일 후, 워싱 버퍼(washing buffer)로 충분히 씻어주었다. 블락 버퍼(block buffer)를 웰마다 넣고 상온에서 1시간 정치 후, 다시 워싱 버퍼로 충분히 씻어준다. 절대값을 알기 위하여, 농도를 아는 스탠다드 솔루션과 함께, 배양액 샘플을 각 웰에 넣고 2시간 동안 상온에서 정치하여 반응시켰다. 워싱 버퍼로 충분히 씻어준 후에, 감지 항체(detection antibody)를 넣어 2시간 동안 상온에서 반응시켰다. 워싱버퍼로 충분히 씻어준 후에, HRP가 표지된 스트렙트애비딘(streptavidin)을 각 웰에 넣어 20분간 상온에서 반응시켰다. 워싱 버퍼로 충분히 씻어준 후에, 기질 용액을 첨가 후 20분 동안 상온에서 반응시키고, 스탑 용액(stop solution)으로 반응을 멈췄다. 각 웰의 사이토카인 농도는 반응에 따른 흡광도로 계산하였다.
도 1의 G03은 양성대조군이며, 음성대조군으로 어떠한 CAR도 주입되지 않은 군(NO LV)을 사용하였다. 또한 도 1은 총 2개의 T 세포 유래를 이용한 독립적 실험을 대표적으로 보여주는 결과 그래프로서, T 세포의 유래에 따라 Donor 03, Donor 04로 명명하였다. 본 실시예에서 "Donor"은 실험에 사용된 T 세포의 공여자를 지칭하며, Donor 뒤의 숫자는 공여자가 각각 상이함을 의미한다. 도 1은 대조군인 G03을 기준으로 그 흡광도를 평준화한 그래프이며, 테스트된 면역세포들이 사이토카인을 분비함을 보여준다.
도 2는 MUC1-양성 종양세포(T47D)에 대한, 항 MUC1 scFv가 CAR 형태로 주입된 면역세포의 반응성을 평가한 사이토카인 분비 분석 결과로서, 테스트된 면역세포들이 사이토카인을 분비함을 보여준다. T 세포는 Donor 06에서 유래하였다. 음성대조군으로 어떠한 CAR도 주입되지 않은 군(Control T cell)을 사용하였다.
도 3은 뮤신1 비발현 세포(HEK293T)에 대한, 항 MUC1 scFv가 CAR 형태로 주입된 면역세포의 반응성을 평가한 사이토카인 분비 분석 결과로서, 인터페론 감마 사이토카인은 분비하지 않으며 IL-2의 경우 음성대조군 (Control T cell)과 비교하였을 때 분비 양이 크게 증가하지 않는 것을 보여준다. T 세포는 Donor 06에서 유래하였다. 음성대조군으로 어떠한 CAR도 주입되지 않은 군(Control T cell)을 사용하였다.
실시예 5. CAR-T 세포의 세포독성 분석
인간 유방암 세포주(T47D, HCC70, HCC1954), 인간 간암 세포주(Huh7, HepG2), 인간 신경모세포종 세포주 (SK-N-SH)은 Korean Cell Line Bank(KCLB, Seoul, Korea)으로부터 구입하였고, 인간배아신장세포주 (HEK293T)는 American Type Culture Collection(ATCC, Manassas, VA)으로부터 구입하였다. T47D, HCC70, HCC1954 세포는 RPMI-1640 medium(Thermo Fisher Scientific)에서, HEK293T, Huh7, HepG2는 Dulbecco's modified Eagle's medium(DMEM, Thermo Fisher Scientific)에서 각각 배양하였다. 모든 배지는 10%(w/v) heat inactivated 우태아혈청(FBS, Thermo Fisher Scientific)을 보충하여 사용하였다. 모든 세포는 37℃, 5% CO2 조건에서 배양하였다. 실시예 2에 따라 제조한 CAR-T세포는 CTS complete media (CTSTM OpTmizerTM T Cell Expansion SFM (Gibco, A1048501), 2%(w/v) CTSTM Immune Cell SR (Gibco, A25961-01), 1X GlutaMAXTM Supplement (Gibco, 35050-061)에 37℃, 5% CO2 조건에서 배양하였다.
CAR-T 세포의 뮤신1-특이적 세포독성을 분석하기 위해, 뮤신1-발현 세포(T47D, HCC70, HCC1954, HEK293T-V1(MUC1-C 외재적 발현세포) 등을 포함한다)와 뮤신1 비발현 세포(HEK293T, HepG2, Huh7, SK-N-SH 등을 포함한다)에 대한 세포 용해도를 다음과 같은 방법으로 측정하였다. 우선 CellTraceTM CFSE (invitrogen, C34554)로 염색시킨 뮤신1 발현 또는 비 발현 표적 세포를 0.15~0.2 X 106 cells/150ul/well로 분주하여 하루 동안 배양하였다. 같은 날, -196℃ 동결 보관 된 CAR-T 세포를 해동시켜, 2 X 106 cells/ml의 농도로 30U/ml의 IL-2 (Novartis, Proleukin)이 포함 된 CTS complete media에 하루 동안 배양하였다. 다음 날, 배양 중인 CAR-T 세포의 CAR 발현율을 Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097)와 APC Mouse Anti-Human CD3 (BD PharmingenTM, 561811)으로 염색하여 유세포분석기 (FACS, flow cytometer)를 통해 둘다 양성인 비율로 구했다. CAR 발현율을 기반으로 CAR+ T세포의 수가 동일하도록 맞춰준 각 종류의 CAR-T (E, effector cells)를 각 표적 세포의 세포배양액으로 100ul/well의 부피에 맞춰 전날 배양한 CFSE 염색 된 뮤신1 발현 또는 비발현 세포 (T, target cells)의 수에 비례하여 넣어주었다. 37℃, 5% CO2조건에서 표적 세포에 따라 5시간에서 최대 24시간까지 배양하였다. 이후, CAR-T세포와 표적 세포 모두를 취하여 Fixable Viability Dye eFluorTM 450 (eBioscienceTM, 65-0863-18), APC Mouse Anti-Human CD3로 염색하여 유세포 분석기를 통해 살아있는 표적세포 수를 구했다. 이때, 살아있는 표적세포 수는 Fixable Viability Dye 음성, CFSE 양성인 세포로 정의하였다. 역가 계산 (killing activity, %)은 다음와 같은 식으로 구했다:
Figure PCTKR2021019790-appb-img-000001
그 결과를, 도 4 내지 도 8에 나타내었다. 이들 도면에서 G03은 양성대조군이며, 음성대조군으로 어떠한 CAR도 주입되지 않은 군(NO LV)을 사용하였다. 또한 이들 도면은 총 2개의 T세포 유래를 이용한 독립적 실험을 대표적으로 보여주는 결과 그래프로서, T 세포의 유래에 따라 Donor 03, Donor 04로 명명하였다. 도 4 내지 도 8에 나타난 바와 같이, 테스트된 면역세포들이 뮤신1-발현 세포들에 세포독성을 나타내었다.
도 9 및 도 10은 각각 Donor 05 및 Donor 06 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간 유방암 세포주인 T47D에 대한 세포 독성실험 결과이고, 도 11은 Donor 07 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간배아신장 세포인 HEK293T에 대한 세포 독성실험 결과이고, 도 12는 Donor 08 유래의 T 세포를 이용하여 제작한 CAR-T 세포들의, 인간 유방암 세포주 HCC70 에 대한 세포 독성실험 결과이다. 도 9 내지 도 12에 나타난 바와 같이, 테스트된 면역세포들이 뮤신1-발현 세포에 세포독성을 나타내었다.
실시예 6. CAR-T 세포의 뮤신1-특이적 세포독성 분석
CAR-T 세포가 항원의 양 차이에 따라 정상 세포와 암 세포를 구분할 수 있는지를 알아보기 위하여, 유방암 세포주 (HCC70) 와 인간 정상 유방 세포주 (MCF10A)에 대한 세포 용해도를 다음과 같은 방법으로 측정하였다: 우선 뮤신1 과발현 세포인 HCC70과 뮤신1을 적게 발현하는 세포인 MCF10A를 각각 다른 농도의 CellTraceTM CFSE (Invitrogen, C34554)로 염색시킨 후 다른 비율로 섞었다. 사용한 비율은 HCC70 : MCF10A가 각 0:0.2, 0.025:0.175, 0.05:0.15, 0.075:0.125, 0.1:0.1, 0.125:0.075, 0.15:0.05, 0.175:0025, 0.2:0 이다. 일정 비율로 섞인 세포는 0.2 x 106 cells/500ul/well로 분주하여 하루 동안 배양하였다. 같은 날, -196℃ 동결 보관된 CAR-T 세포(2447_2H08 scFv 함유 CAR 가 발현된 Donor 05 유래 T 세포)를 해동시켜, 2 X 106 cells/ml의 농도로 30U/ml의 IL-2 (Novartis, Proleukin)이 포함된 CTS complete media에 하루 동안 배양하였다. 다음 날, 배양 중인 CAR-T 세포의 CAR (2447_2H08 scFv를 가지고 있는 CAR) 발현율을 Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097)와 APC Mouse Anti-Human CD3 (BD Pharmingen™, 561811)으로 염색하여 유세포분석기 (FACS, flow cytometer)를 통해 둘다 양성인 비율로 구했다. CAR 발현율을 기반으로 CAR+ T 세포의 수가 동일하도록 맞춰준 각 종류의 CAR-T (E, effector cells)를 각 표적 세포의 세포배양액으로 100ul/well의 부피에 맞춰 전날 배양한 CFSE 염색된 뮤신1 발현 또는 비발현 세포 (T, target cells)의 수에 비례하여 넣어주었다. 37℃, 5% CO2 조건에서 표적 세포에 24시간 배양하였다. 이후, CAR-T세포와 표적 세포 모두를 취하여 Fixable Viability Dye eFluor™ 450 (eBioscience™, 65-0863-18), APC Mouse Anti-Human CD3로 염색하여 유세포 분석기를 통해 살아있는 표적세포 수를 구했다. 이때, 살아있는 표적세포 수는 Fixable Viability Dye 음성, CFSE 양성 (HCC70의 경우 강한 CFSE 시그널, MCF10A의 경우 약한 CFSE 시그널)인 세포로 정의하였다. 역가 계산 (killing activity, %)은 실시예5와 동일한 방법으로 수행하였다.
그 결과를, 도 13 및 도 14에 나타내었다. 이들 도면에서 음성대조군으로 어떠한 CAR도 주입되지 않은 군(mock T cell)을 사용하였다. 도 13 및 도 14에 나타난 바와 같이, 2447_2H08 scFv 를 가지고 있는 CAR-T 세포(도면에서 각각 #2-CAR-T로 표시됨)는 뮤신1을 과발현하는 유방암세포 (HCC70)에 대한 세포사멸능을 보이며 반면 뮤신1을 약하게 발현하는 정상 유방 세포주 (MCF10A)에 대한 세포독성은 보이지 않거나 현저히 감소된 양으로 보이는 것을 관찰하였다.
실시예 7. 동물 모델을 이용한 CAR-T 세포의 항암 효능 분석
7-1. 췌장암 동물 모델을 이용한 항암 효능 분석
7주령의 NOG 암컷 마우스에 6 X 106 PANC1-v1 세포 (MUC1 을 발현시킨 PANC1 췌장암 세포)를 피하(s.c.) 주입하고, 종양 체적이 500 mm3 되었을 때 1 X 106 의 항-MUC1 CAR-T 세포(본원에 따른 scFv 함유 CAR 가 발현된 Donor 18-09 유래 T 세포)를 정맥(i.v.) 투여한 후 종양 성장을 관찰하고, CAR-T 세포 투여 14일과 28일 후에 혈액을 채취하여 혈액 내 인간 면역세포(hCD45+ cell)의 수를 관찰하였다 (그룹당 n = 5). 음성대조군으로는 PBS (Vehicle) 주입 군과 CAR 를 발현하지 않는 T 세포 (Control T cell)을 사용하였다.
그 결과, 도 15 및 도 16에 나타난 바와 같이, 500mm3 크기의 종양이 작아지는 것을 관찰하였으며 T 세포 투여 후 약 20일이 경과하였을 때는 외관으로 종양이 관찰되지 않았다. 그러나 음성대조군의 경우 암의 크기가 지속적으로 커지는 것을 관찰할 수 있었다.
다음으로, 위와 동일한 동물 모델에서, 종양 체적이 1500 mm3 을 넘었을 때(즉, PANC1-v1 세포 투여 66일 후) 1 X 106 또는 0.5 X 106 의 항-MUC1 CAR-T 세포를 정맥(i.v.) 투여한 후 종양 성장을 관찰하였다 (그룹당 n = 2).
그 결과, 도 17에 나타난 바와 같이, 종양의 크기가 초기에는 커졌으나 약 10일이 경과한 후 그 크기가 점점 작아지면서 30일 경과 후에는 측정하기 힘들 정도로 종양의 크기가 작아졌다.
7-2. 유방암 동물 모델을 이용한 항암 효능 분석
9주령의 NOG 암컷 마우스에 4 X 106 HCC1954 세포 (자연적으로 MUC1 을 발현하는 유방암 세포주)를 피하(s.c.) 주입하고, 종양 체적이 500 mm3 되었을 때(세포 투여 23일 후) 0.5 X 106 또는 0.1 X 106 의 항-MUC1 CAR-T 세포(본원에 따른 scFv 함유 CAR 가 발현된 Donor 20-01 유래 T 세포)를 정맥(i.v.) 투여한 후 종양 성장을 관찰하고(그룹당 n = 7), T 세포 투여 후 일정한 간격으로 혈액을 채취하여 혈액 내 인간 면역세포(hCD45+ cell)의 수를 관찰하였다 (그룹당 n = 3). 음성대조군으로는 PBS (Vehicle) 주입 군과 CAR 를 발현하지 않는 T 세포 (Control T cell)을 사용하였다.
그 결과, 도 18 및 도 19에 나타난 바와 같이, 500mm3이던 종양의 크기는 CAR-T 세포 투여후 7일 동안 크기가 정체되었으나 그 이후 급격히 감소하면서 25일 이후 측정이 힘들 정도로 작아졌다. 또한 마우스 혈액 내 hCD45+ 세포의 수는 증가하는 양상을 보였으며 약 25일 이후에는 점차 그 수가 감소하였다. 이는 CAR-T 세포들이 항원을 인식한 후 활성화되고 증식하여 혈액내의 세포 수가 증가한 것으로 보인다.
이상의 설명으로부터, 본 발명이 속하는 기술분야에서 통상의 지식을 가진 자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (25)

  1. 다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 뮤신1(Mucin1)에 결합하는 폴리펩티드:
    - 각각 서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 기재되는상보성결정영역(CDR) 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 11, 서열번호 12 및 서열번호 13의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 14, 서열번호 15 및 서열번호 16의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 21, 서열번호 22 및 서열번호 23의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 24, 서열번호 25 및 서열번호 26의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 31, 서열번호 32 및 서열번호 33의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 44, 서열번호 45 및 서열번호 46의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 51, 서열번호 52 및 서열번호 53의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 54, 서열번호 55 및 서열번호 56의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 61, 서열번호 62 및 서열번호 63의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 64, 서열번호 65 및 서열번호 66의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 71, 서열번호 72 및 서열번호 73의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 74, 서열번호 75 및 서열번호 76의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;
    - 각각 서열번호 81, 서열번호 82 및 서열번호 83의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 84, 서열번호 85 및 서열번호 86의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역; 및
    - 각각 서열번호 91, 서열번호 92 및 서열번호 93의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 94, 서열번호 95 및 서열번호 96의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역.
  2. 제1항에 있어서,
    다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 폴리펩티드:
    - 서열번호 7의 아미노산 서열을 포함하는 VH 영역 및 서열번호 8의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 17의 아미노산 서열을 포함하는 VH 영역 및 서열번호 18의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 27의 아미노산 서열을 포함하는 VH 영역 및 서열번호 28의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 37의 아미노산 서열을 포함하는 VH 영역 및 서열번호 38의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 47의 아미노산 서열을 포함하는 VH 영역 및 서열번호 48의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 57의 아미노산 서열을 포함하는 VH 영역 및 서열번호 58의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 67의 아미노산 서열을 포함하는 VH 영역 및 서열번호 68의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 77의 아미노산 서열을 포함하는 VH 영역 및 서열번호 78의 아미노산 서열을 포함하는 VL 영역;
    - 서열번호 87의 아미노산 서열을 포함하는 VH 영역 및 서열번호 88의 아미노산 서열을 포함하는 VL 영역; 및
    - 서열번호 97의 아미노산 서열을 포함하는 VH 영역 및 서열번호 98의 아미노산 서열을 포함하는 VL 영역.
  3. 제1항에 있어서,
    항체 또는 이의 항원 결합 단편인, 폴리펩티드.
  4. 제1항에 있어서,
    scFv (single chain variable fragment), 펩티바디, Fab (fragment antigen binding), 단일클론 항체, 이중특이성 항체, 미니바디, 도메인 항체, 합성 항체, 키메라 항체, 인간화 항체, 인간 항체, 또는 항체 융합체 단백질인, 폴리펩티드.
  5. 제1항에 있어서,
    상기 VH 영역 및 상기 VL 영역이 링커에 의해 연결된 것인, 폴리펩티드.
  6. 제5항에 있어서,
    상기 링커의 아미노산 서열이 GGGGSGGGGSGGGAS 인, 폴리펩티드.
  7. 제1항에 있어서,
    서열번호 9, 서열번호 19, 서열번호 29, 서열번호 39, 서열번호 49, 서열번호 59, 서열번호 69, 서열번호 79, 서열번호 89 및 서열번호 99로 이루어진 군에서 선택되는 아미노산 서열을 포함하는 scFv인, 폴리펩티드.
  8. 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드.
  9. 제8항의 폴리뉴클레오티드를 포함하는 벡터.
  10. 제9항의 벡터를 포함하는 세포.
  11. 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 포함하는, 키메라 항원 수용체 (chimeric antigen receptor).
  12. 제11항에 있어서,
    상기 뮤신1-결합 폴리펩티드를 포함하는 세포외 도메인; 막관통 도메인; 및 세포내 신호 전달 도메인을 포함하는, 키메라 항원 수용체.
  13. 제12항에 있어서,
    상기 세포외 도메인은 상기 뮤신1-결합 폴리펩티드와 막관통 도메인 사이에 스페이서 영역을 추가로 포함하는, 키메라 항원 수용체.
  14. 제13항에 있어서,
    상기 스페이서가 CD8α 또는 CD28의 힌지 부위, 또는 면역글로불린 (IgG)의 불변영역의 전부 또는 일부를 포함하는 것인, 키메라 항원 수용체.
  15. 제12항에 있어서,
    상기 막관통 도메인이 CD28 또는 CD8의 막관통 도메인인, 키메라 항원 수용체.
  16. 제12항에 있어서,
    상기 세포내 신호 전달 도메인이 CD3 제타 신호전달 도메인인, 키메라 항원 수용체.
  17. 제12항에 있어서,
    1개 이상의 공동자극 도메인(co-stimulatory domain)을 더욱 포함하는, 키메라 항원 수용체.
  18. 제17항에 있어서,
    공동자극 도메인이 막관통 도메인과 세포내 신호 전달 도메인 사이에 위치한 것인, 키메라 항원 수용체.
  19. 제17항에 있어서,
    공동자극 도메인이 CD28, OX-40, 4-1BB (CD137), CD27 또는 ICOS의 신호전달 도메인인, 키메라 항원 수용체.
  20. 제11항의 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드.
  21. 제20항의 폴리뉴클레오티드를 포함하는 벡터.
  22. 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 발현하거나, 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는, 면역 세포.
  23. 제22항에 있어서,
    T 세포, 종양 침윤 림프구 (TIL), NK (Natural killer) 세포, TCR-발현 세포, 수지상 세포, 또는 NK-T 세포인, 면역 세포.
  24. 제22항에 있어서,
    자가 T 세포 또는 동종 T 세포인, 면역 세포.
  25. 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드;
    상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드;
    상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터;
    상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 세포;
    상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체;
    상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드;
    상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 또는
    상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하거나 상기 키메라 항원 수용체를 발현하는 면역 세포를 포함하는,
    암의 예방 또는 치료용 조성물.
PCT/KR2021/019790 2020-12-24 2021-12-24 뮤신 1에 특이적인 폴리펩티드 및 이의 이용 WO2022139537A2 (ko)

Priority Applications (9)

Application Number Priority Date Filing Date Title
MX2023007665A MX2023007665A (es) 2020-12-24 2021-12-24 Polipeptido especifico para mucina 1 y uso del mismo.
PE2023001953A PE20240117A1 (es) 2020-12-24 2021-12-24 Polipeptido especifico para mucina 1 y sus usos
EP21911602.7A EP4265640A2 (en) 2020-12-24 2021-12-24 Polypeptide specific for mucin 1 and use thereof
CA3203067A CA3203067A1 (en) 2020-12-24 2021-12-24 Polypeptide specific for mucin 1 and use thereof
AU2021410416A AU2021410416A1 (en) 2020-12-24 2021-12-24 Polypeptide specific for mucin 1 and use thereof
CN202180086168.7A CN116670162A (zh) 2020-12-24 2021-12-24 粘蛋白1特异性多肽及其用途
IL303902A IL303902A (en) 2020-12-24 2021-12-24 MUCIN 1-specific polypeptide and its use
JP2023539197A JP2024503803A (ja) 2020-12-24 2021-12-24 ムチン1に特異的なポリペプチドおよびその利用
CONC2023/0009764A CO2023009764A2 (es) 2020-12-24 2023-07-24 Polipéptido específico para mucina 1 y sus usos

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20200183768 2020-12-24
KR10-2020-0183768 2020-12-24
KR20210137757 2021-10-15
KR10-2021-0137757 2021-10-15

Publications (4)

Publication Number Publication Date
WO2022139537A2 true WO2022139537A2 (ko) 2022-06-30
WO2022139537A3 WO2022139537A3 (ko) 2022-09-09
WO2022139537A4 WO2022139537A4 (ko) 2022-10-06
WO2022139537A9 WO2022139537A9 (ko) 2022-11-17

Family

ID=82159981

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/019790 WO2022139537A2 (ko) 2020-12-24 2021-12-24 뮤신 1에 특이적인 폴리펩티드 및 이의 이용

Country Status (12)

Country Link
EP (1) EP4265640A2 (ko)
JP (1) JP2024503803A (ko)
KR (1) KR20220092432A (ko)
AU (1) AU2021410416A1 (ko)
CA (1) CA3203067A1 (ko)
CL (1) CL2023001873A1 (ko)
CO (1) CO2023009764A2 (ko)
IL (1) IL303902A (ko)
MX (1) MX2023007665A (ko)
PE (1) PE20240117A1 (ko)
TW (1) TW202233667A (ko)
WO (1) WO2022139537A2 (ko)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018174544A2 (ko) 2017-03-21 2018-09-27 주식회사 펩트론 Muc1에 특이적으로 결합하는 항체 및 그의 용도

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020146750A1 (en) * 2000-03-30 2002-10-10 Hoogenboom Hendricus R.J.M. Mucin-1 specific binding members and methods of use thereof
US10208125B2 (en) * 2013-07-15 2019-02-19 University of Pittsburgh—of the Commonwealth System of Higher Education Anti-mucin 1 binding agents and uses thereof
DK3543337T3 (da) 2016-11-18 2022-05-09 Astellas Pharma Inc Hidtil ukendt fab-fragment af et anti-humant muc1-antistof
RU2746413C1 (ru) * 2017-03-21 2021-04-13 Пептрон, Инк. Антитело, специфически связывающееся с muc1, и его применение

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018174544A2 (ko) 2017-03-21 2018-09-27 주식회사 펩트론 Muc1에 특이적으로 결합하는 항체 및 그의 용도

Also Published As

Publication number Publication date
TW202233667A (zh) 2022-09-01
KR20220092432A (ko) 2022-07-01
CA3203067A1 (en) 2022-06-30
EP4265640A2 (en) 2023-10-25
MX2023007665A (es) 2023-07-07
WO2022139537A3 (ko) 2022-09-09
PE20240117A1 (es) 2024-01-22
CL2023001873A1 (es) 2024-01-26
AU2021410416A1 (en) 2023-08-10
JP2024503803A (ja) 2024-01-29
WO2022139537A4 (ko) 2022-10-06
IL303902A (en) 2023-08-01
WO2022139537A9 (ko) 2022-11-17
CO2023009764A2 (es) 2023-09-08

Similar Documents

Publication Publication Date Title
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
WO2019225787A1 (ko) 항-b7-h3 항체 및 그 용도
TW201805306A (zh) 包含tnf家族配位三聚體及pd1結合部份之抗原結合分子
WO2015058573A1 (zh) 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途
WO2015133817A1 (ko) B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도
WO2021006619A1 (ko) B7-h3에 특이적으로 결합하는 항체 및 그의 용도
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2014025198A2 (ko) Lfa3 변이체 및 상기 변이체 또는 lfa3 cd2 결합영역과 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도
WO2018222019A1 (ko) 신규한 항-cd40 항체 및 이의 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2019155408A1 (en) Anti-pd-1/anti-her2 natural antibody structural heterodimeric bispecific antibody and method of preparing same
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2021060914A1 (ko) 항-클라우딘-3 키메라 항원 수용체
WO2022139537A2 (ko) 뮤신 1에 특이적인 폴리펩티드 및 이의 이용
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021182929A1 (ko) Bcma에 특이적인 항체 및 키메라 항원 수용체
WO2022124866A1 (ko) 항-pd-1 항체 및 이의 용도
WO2022216079A1 (ko) Gucy2c 결합 폴리펩타이드 및 그의 용도
WO2021246637A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2024101962A1 (ko) 유전자 조작된 세포 및 이의 용도
WO2022181992A1 (ko) Cd22에 특이적인 인간화 항체 및 이의 용도
WO2024101942A1 (ko) 유전자 조작된 세포 및 이의 용도
WO2022169269A1 (ko) 항 ctla-4 항체 및 이의 용도
WO2024010118A1 (ko) 항 bdca-2 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21911602

Country of ref document: EP

Kind code of ref document: A2

WWE Wipo information: entry into national phase

Ref document number: 202180086168.7

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 3203067

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 001953-2023

Country of ref document: PE

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/007665

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2023539197

Country of ref document: JP

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023012713

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021911602

Country of ref document: EP

Effective date: 20230721

ENP Entry into the national phase

Ref document number: 2021410416

Country of ref document: AU

Date of ref document: 20211224

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112023012713

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230623

WWE Wipo information: entry into national phase

Ref document number: 523441314

Country of ref document: SA