WO2022139537A2 - 뮤신 1에 특이적인 폴리펩티드 및 이의 이용 - Google Patents
뮤신 1에 특이적인 폴리펩티드 및 이의 이용 Download PDFInfo
- Publication number
- WO2022139537A2 WO2022139537A2 PCT/KR2021/019790 KR2021019790W WO2022139537A2 WO 2022139537 A2 WO2022139537 A2 WO 2022139537A2 KR 2021019790 W KR2021019790 W KR 2021019790W WO 2022139537 A2 WO2022139537 A2 WO 2022139537A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- region
- amino acid
- cells
- acid sequence
- Prior art date
Links
- 108010008707 Mucin-1 Proteins 0.000 title claims abstract description 88
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 79
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 76
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 76
- 102000007298 Mucin-1 Human genes 0.000 title abstract description 77
- 210000004027 cell Anatomy 0.000 claims abstract description 221
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 92
- 239000013598 vector Substances 0.000 claims abstract description 69
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 56
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 56
- 239000002157 polynucleotide Substances 0.000 claims abstract description 56
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 46
- 210000002865 immune cell Anatomy 0.000 claims abstract description 39
- 238000000034 method Methods 0.000 claims abstract description 38
- 239000000203 mixture Substances 0.000 claims abstract description 34
- 201000011510 cancer Diseases 0.000 claims abstract description 33
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 77
- 108010047041 Complementarity Determining Regions Proteins 0.000 claims description 47
- 239000000427 antigen Substances 0.000 claims description 30
- 102000036639 antigens Human genes 0.000 claims description 30
- 108091007433 antigens Proteins 0.000 claims description 30
- 102100034256 Mucin-1 Human genes 0.000 claims description 24
- 239000012634 fragment Substances 0.000 claims description 23
- 230000011664 signaling Effects 0.000 claims description 11
- 125000006850 spacer group Chemical group 0.000 claims description 9
- 230000004068 intracellular signaling Effects 0.000 claims description 8
- -1 OX-40 Proteins 0.000 claims description 7
- 230000000139 costimulatory effect Effects 0.000 claims description 6
- 108060003951 Immunoglobulin Proteins 0.000 claims description 4
- 102000018358 immunoglobulin Human genes 0.000 claims description 4
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 claims description 4
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 3
- 102100027207 CD27 antigen Human genes 0.000 claims description 3
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 3
- 230000000735 allogeneic effect Effects 0.000 claims description 3
- 108020001507 fusion proteins Proteins 0.000 claims description 3
- 102000037865 fusion proteins Human genes 0.000 claims description 3
- 210000004443 dendritic cell Anatomy 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 40
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims 3
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims 3
- 238000011282 treatment Methods 0.000 abstract description 11
- 150000001413 amino acids Chemical class 0.000 description 66
- 235000001014 amino acid Nutrition 0.000 description 19
- 229940024606 amino acid Drugs 0.000 description 19
- 206010006187 Breast cancer Diseases 0.000 description 18
- 208000026310 Breast neoplasm Diseases 0.000 description 18
- 102220497176 Small vasohibin-binding protein_T47D_mutation Human genes 0.000 description 16
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 14
- 108090000623 proteins and genes Proteins 0.000 description 14
- 102000004127 Cytokines Human genes 0.000 description 13
- 108090000695 Cytokines Proteins 0.000 description 13
- 231100000263 cytotoxicity test Toxicity 0.000 description 13
- 239000013642 negative control Substances 0.000 description 13
- 210000004369 blood Anatomy 0.000 description 12
- 239000008280 blood Substances 0.000 description 12
- 239000011534 wash buffer Substances 0.000 description 12
- 230000028327 secretion Effects 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 10
- 239000013641 positive control Substances 0.000 description 10
- 108010002350 Interleukin-2 Proteins 0.000 description 9
- 102000000588 Interleukin-2 Human genes 0.000 description 9
- 238000010171 animal model Methods 0.000 description 9
- 231100000135 cytotoxicity Toxicity 0.000 description 9
- 230000003013 cytotoxicity Effects 0.000 description 9
- 102000004169 proteins and genes Human genes 0.000 description 9
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 8
- 238000002347 injection Methods 0.000 description 8
- 239000007924 injection Substances 0.000 description 8
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 8
- 201000002528 pancreatic cancer Diseases 0.000 description 8
- 208000008443 pancreatic carcinoma Diseases 0.000 description 8
- 235000018102 proteins Nutrition 0.000 description 8
- 239000000243 solution Substances 0.000 description 8
- 238000000684 flow cytometry Methods 0.000 description 7
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 7
- 239000013612 plasmid Substances 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 241000713666 Lentivirus Species 0.000 description 6
- 230000001093 anti-cancer Effects 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 239000002609 medium Substances 0.000 description 6
- 230000009257 reactivity Effects 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 230000004614 tumor growth Effects 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 5
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 5
- 101000600434 Homo sapiens Putative uncharacterized protein encoded by MIR7-3HG Proteins 0.000 description 5
- 108010074328 Interferon-gamma Proteins 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 102100037401 Putative uncharacterized protein encoded by MIR7-3HG Human genes 0.000 description 5
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 5
- 108091008874 T cell receptors Proteins 0.000 description 5
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 239000012091 fetal bovine serum Substances 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 238000001802 infusion Methods 0.000 description 5
- 210000003292 kidney cell Anatomy 0.000 description 5
- 239000007788 liquid Substances 0.000 description 5
- 238000002360 preparation method Methods 0.000 description 5
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 5
- 241000283707 Capra Species 0.000 description 4
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 4
- 102100022339 Integrin alpha-L Human genes 0.000 description 4
- 102000008070 Interferon-gamma Human genes 0.000 description 4
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 4
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 4
- 230000004913 activation Effects 0.000 description 4
- 210000000481 breast Anatomy 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 239000012636 effector Substances 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 4
- 201000005202 lung cancer Diseases 0.000 description 4
- 208000020816 lung neoplasm Diseases 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 238000004806 packaging method and process Methods 0.000 description 4
- 239000002953 phosphate buffered saline Substances 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 210000001236 prokaryotic cell Anatomy 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 230000035899 viability Effects 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 102100038078 CD276 antigen Human genes 0.000 description 3
- 206010008342 Cervix carcinoma Diseases 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 3
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 3
- 102100032818 Integrin alpha-4 Human genes 0.000 description 3
- 102100032816 Integrin alpha-6 Human genes 0.000 description 3
- 102100025390 Integrin beta-2 Human genes 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 208000000453 Skin Neoplasms Diseases 0.000 description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 description 3
- 208000024770 Thyroid neoplasm Diseases 0.000 description 3
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 239000000654 additive Substances 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- 235000011010 calcium phosphates Nutrition 0.000 description 3
- 239000006143 cell culture medium Substances 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 201000010881 cervical cancer Diseases 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 201000010099 disease Diseases 0.000 description 3
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 238000004520 electroporation Methods 0.000 description 3
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 3
- 230000004927 fusion Effects 0.000 description 3
- 206010017758 gastric cancer Diseases 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 229960003130 interferon gamma Drugs 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 201000007270 liver cancer Diseases 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 150000007523 nucleic acids Chemical group 0.000 description 3
- 239000002773 nucleotide Substances 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 238000001556 precipitation Methods 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 201000000849 skin cancer Diseases 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 201000011549 stomach cancer Diseases 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 239000013589 supplement Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 238000011285 therapeutic regimen Methods 0.000 description 3
- 201000002510 thyroid cancer Diseases 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 230000032258 transport Effects 0.000 description 3
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 2
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 2
- 239000012099 Alexa Fluor family Substances 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 102100024263 CD160 antigen Human genes 0.000 description 2
- 102100038077 CD226 antigen Human genes 0.000 description 2
- 101710185679 CD276 antigen Proteins 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 208000009329 Graft vs Host Disease Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 2
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 2
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 2
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 2
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 2
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 2
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 2
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 2
- 101100346929 Homo sapiens MUC1 gene Proteins 0.000 description 2
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 2
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 description 2
- 102100025323 Integrin alpha-1 Human genes 0.000 description 2
- 102100039904 Integrin alpha-D Human genes 0.000 description 2
- 102100022341 Integrin alpha-E Human genes 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 102100022297 Integrin alpha-X Human genes 0.000 description 2
- 102100025304 Integrin beta-1 Human genes 0.000 description 2
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 description 2
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 2
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 2
- 206010029260 Neuroblastoma Diseases 0.000 description 2
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- 208000031839 Peripheral nerve sheath tumour malignant Diseases 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 2
- 206010035226 Plasma cell myeloma Diseases 0.000 description 2
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 2
- 206010060862 Prostate cancer Diseases 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 2
- 102100029197 SLAM family member 6 Human genes 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 102100027744 Semaphorin-4D Human genes 0.000 description 2
- 101710163413 Signaling lymphocytic activation molecule Proteins 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 241000700618 Vaccinia virus Species 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 108700025316 aldesleukin Proteins 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 238000011319 anticancer therapy Methods 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 238000009795 derivation Methods 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000003995 emulsifying agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000003511 endothelial effect Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 210000002919 epithelial cell Anatomy 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 239000000796 flavoring agent Substances 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 235000013355 food flavoring agent Nutrition 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 208000024908 graft versus host disease Diseases 0.000 description 2
- 238000001794 hormone therapy Methods 0.000 description 2
- 102000057860 human MUC1 Human genes 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 description 2
- 230000031146 intracellular signal transduction Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 229920000609 methyl cellulose Polymers 0.000 description 2
- 239000001923 methylcellulose Substances 0.000 description 2
- 235000010981 methylcellulose Nutrition 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 238000000520 microinjection Methods 0.000 description 2
- 208000029974 neurofibrosarcoma Diseases 0.000 description 2
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 2
- 102000039446 nucleic acids Human genes 0.000 description 2
- 108020004707 nucleic acids Proteins 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 239000011574 phosphorus Substances 0.000 description 2
- 229910052698 phosphorus Inorganic materials 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 229940087463 proleukin Drugs 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000011200 topical administration Methods 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- HJCMDXDYPOUFDY-WHFBIAKZSA-N Ala-Gln Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O HJCMDXDYPOUFDY-WHFBIAKZSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000024188 Andala Species 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 description 1
- 101710095183 B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 108010056102 CD100 antigen Proteins 0.000 description 1
- 108010017009 CD11b Antigen Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010062802 CD66 antigens Proteins 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 101710139831 CD82 antigen Proteins 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 101100118093 Drosophila melanogaster eEF1alpha2 gene Proteins 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102100031780 Endonuclease Human genes 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 101000585551 Equus caballus Pregnancy-associated glycoprotein Proteins 0.000 description 1
- 241001522878 Escherichia coli B Species 0.000 description 1
- 241000672609 Escherichia coli BL21 Species 0.000 description 1
- 241001302584 Escherichia coli str. K-12 substr. W3110 Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 208000006168 Ewing Sarcoma Diseases 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 102100022086 GRB2-related adapter protein 2 Human genes 0.000 description 1
- 208000022072 Gallbladder Neoplasms Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000900690 Homo sapiens GRB2-related adapter protein 2 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 description 1
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101001047640 Homo sapiens Linker for activation of T-cells family member 1 Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101001090688 Homo sapiens Lymphocyte cytosolic protein 2 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 1
- 101001124867 Homo sapiens Peroxiredoxin-1 Proteins 0.000 description 1
- 101000692259 Homo sapiens Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Proteins 0.000 description 1
- 101000702132 Homo sapiens Protein spinster homolog 1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 1
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 101100321817 Human parvovirus B19 (strain HV) 7.5K gene Proteins 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 108010041100 Integrin alpha6 Proteins 0.000 description 1
- 108010030465 Integrin alpha6beta1 Proteins 0.000 description 1
- 102100033016 Integrin beta-7 Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100024032 Linker for activation of T-cells family member 1 Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 102100034709 Lymphocyte cytosolic protein 2 Human genes 0.000 description 1
- 101710141452 Major surface glycoprotein G Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- 201000009574 Mesenchymal Chondrosarcoma Diseases 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 101100508818 Mus musculus Inpp5k gene Proteins 0.000 description 1
- 101100236305 Mus musculus Ly9 gene Proteins 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- 108091008877 NK cell receptors Proteins 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 1
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 1
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 1
- 102100021462 Natural killer cells antigen CD94 Human genes 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 102100026066 Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 Human genes 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 101100366438 Rattus norvegicus Sphkap gene Proteins 0.000 description 1
- 101710138747 Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 102100029216 SLAM family member 5 Human genes 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 208000000102 Squamous Cell Carcinoma of Head and Neck Diseases 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 1
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 206010052779 Transplant rejections Diseases 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108010065158 Tumor Necrosis Factor Ligand Superfamily Member 14 Proteins 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100024586 Tumor necrosis factor ligand superfamily member 14 Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 108091023045 Untranslated Region Proteins 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 101001038499 Yarrowia lipolytica (strain CLIB 122 / E 150) Lysine acetyltransferase Proteins 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 238000011129 allogeneic cell therapy Methods 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000011394 anticancer treatment Methods 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 229940097012 bacillus thuringiensis Drugs 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 206010004398 benign neoplasm of skin Diseases 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 238000004820 blood count Methods 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000012937 correction Methods 0.000 description 1
- 238000005138 cryopreservation Methods 0.000 description 1
- 238000000315 cryotherapy Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 238000003568 cytokine secretion assay Methods 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000006185 dispersion Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 210000004700 fetal blood Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 230000003325 follicular Effects 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 201000010175 gallbladder cancer Diseases 0.000 description 1
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 239000007928 intraperitoneal injection Substances 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 206010024627 liposarcoma Diseases 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 208000025036 lymphosarcoma Diseases 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 201000002740 oral squamous cell carcinoma Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000008194 pharmaceutical composition Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 238000001126 phototherapy Methods 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000007651 self-proliferation Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 235000014347 soups Nutrition 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000012086 standard solution Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 239000012089 stop solution Substances 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 208000001608 teratocarcinoma Diseases 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000010257 thawing Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3076—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
- C07K16/3092—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties against tumour-associated mucins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464469—Tumor associated carbohydrates
- A61K39/46447—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70517—CD8
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/49—Breast
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/54—Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
Definitions
- a polypeptide that binds to Mucin1 an isolated polynucleotide encoding the same, a vector comprising the polynucleotide, and a cell comprising the vector.
- a chimeric antigen receptor comprising a polypeptide that binds to mucin1
- an isolated polynucleotide encoding the chimeric antigen receptor an isolated polynucleotide encoding the chimeric antigen receptor
- a vector comprising the polynucleotide, an immune cell expressing the chimeric antigen receptor, and cancer comprising the same It relates to therapeutic compositions and methods of treatment.
- Mucin1 is a membrane-bound glycoprotein present in epithelial cells of almost all organs in the body.
- Mucin1 is a heterodimeric protein formed from the non-covalent interaction of an N-terminal subunit (MUC1-N) and a C-terminal subunit (MUC1-C).
- MUC1-C forms the extracellular domain, transmembrane domain and cytoplasmic tail, and MUC1-N repeatedly contains tandem repeats (TRs) containing 20 amino acids (HGVTSAPDTRPAPGSTAPPA), including glycosylation sites, , interacts with the extracellular domain of MUC1-C and remains associated with MUC1-C.
- TRs tandem repeats
- HGVTSAPDTRPAPGSTAPPA tandem repeats containing 20 amino acids
- mucin 1 In normal epithelial cells, mucin 1 is expressed at a low level and is restricted to the apical membranes of the epithelium, but it is used in breast cancer, lung cancer, colorectal cancer, skin cancer, thyroid cancer, stomach cancer, pancreatic cancer, kidney cancer, ovarian cancer and cervical cancer. It is known to be overexpressed in solid cancer cells, randomly expressed on the entire cell surface, and abnormally glycosylated. Therefore, mucin1 is known to be useful as a target molecule for detecting cancer lesions or as a target molecule for treating cancer.
- a polypeptide that binds to Mucin1 is provided.
- Another example provides an isolated polynucleotide encoding the mucin1-binding polypeptide.
- Another example provides a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
- Another example provides a cell comprising a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
- Another example provides a chimeric antigen receptor comprising the mucin1-binding polypeptide.
- Another example provides an isolated polynucleotide encoding the chimeric antigen receptor.
- Another example provides a vector comprising a polynucleotide encoding the chimeric antigen receptor.
- Another example provides an immune cell expressing the chimeric antigen receptor or comprising a polynucleotide encoding the chimeric antigen receptor.
- mucin1-binding polypeptide examples include the mucin1-binding polypeptide; an isolated polynucleotide encoding said mucin1-binding polypeptide; a vector comprising a polynucleotide encoding said mucin1-binding polypeptide; a cell comprising a polynucleotide encoding said mucin1-binding polypeptide; a chimeric antigen receptor comprising said mucin1-binding polypeptide; an isolated polynucleotide encoding said chimeric antigen receptor; a vector comprising a polynucleotide encoding the chimeric antigen receptor; Or comprising a polynucleotide encoding the chimeric antigen receptor or comprising an immune cell expressing the chimeric antigen receptor, it provides a composition for the treatment of cancer.
- cytokine 1 is a cytokine that evaluates the reactivity to MUC1-positive tumor cells (T47D, HEK293T-V1) of CAR-T cells according to an embodiment of the present application prepared using donor 03 and donor 04-derived T cells. secretion analysis results.
- FIG. 2 is a cytokine secretion analysis result for evaluating the reactivity of the CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells to MUC1-positive tumor cells (T47D).
- FIG 3 is a cytokine secretion analysis result of evaluating the reactivity of CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells to mucin 1 non-expressing cells (HEK293T).
- CAR-T cells is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 03-derived T cells, against T47D, a human breast cancer cell line.
- CAR-T cells prepared using donor 04-derived T cells, which is a human breast cancer cell line, T47D.
- CAR-T cells prepared using donor 03-derived T cells against HEK293T, a human embryonic kidney cell.
- CAR-T cells prepared using donor 04-derived T cells against HEK293T, a human embryonic kidney cell.
- CAR-T cells prepared using donor 04-derived T cells against HEK293T-V1 in which MUC1-C was exogenously expressed in a human embryonic kidney cell line.
- CAR-T cells 9 is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 05-derived T cells, against T47D, a human breast cancer cell line.
- CAR-T cells 10 is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 06-derived T cells, against T47D, a human breast cancer cell line.
- CAR-T cells are a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 07-derived T cells, against HEK293T, a human embryonic kidney cell.
- CAR-T cells is a cytotoxicity test result of CAR-T cells according to an embodiment of the present application prepared using donor 08-derived T cells against HCC70, a human breast cancer cell line. #2: 2447_2H08; #3: 2447_3A01; #4: 2447_3A08; #5: 2447_3A09; #6: 2447_3A12; #7: 2447_3B07; #8: 2447_3C08; #9: 2447_3H02; #10: 2447_3H08.
- FIG. 13 is a CAR-T cell according to an embodiment of the present application at a ratio of effector cells (E) to target cells (T) of 0.3:1 against a human breast cancer cell line (HCC70) and a human normal breast cell line (MCF10A). Phosphorus cytotoxicity results are shown. #2: 2447_2H08.
- CAR-T cell is a CAR-T cell according to an embodiment of the present disclosure at a ratio of effector cells (E) to target cells (T) of 0.1:1 against a human breast cancer cell line (HCC70) and a human normal breast cell line (MCF10A). Phosphorus cytotoxicity results are shown. #2: 2447_2H08.
- PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
- human immune cells in blood 14 days and 28 days after administration of CAR-T cells according to an embodiment of the present application This is the result of confirming the number of (hCD45+ cells).
- FIG. 17 is a cancer animal model injected with PANC1-v1 cells (PANC1 pancreatic cancer cells expressing MUC1), the results of confirming tumor growth inhibition after administration of two doses of CAR-T cells according to an embodiment of the present application .
- PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
- HCC1954 cells naturally expressed breast cancer cells
- human immune cells hCD45+ cells
- a polypeptide that binds to Mucin1 there is provided a polypeptide that binds to Mucin1.
- the polypeptide binding to mucin 1 herein may be an antibody or antigen-binding fragment thereof.
- a polypeptide that binds to Mucin1 comprising a pair of a heavy chain variable (VH) region and a light chain variable (VL) region selected from the group consisting of:
- VH region comprising complementarity determining regions (CDRs) 1, 2 and 3 described by the amino acid sequences of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: 3, respectively, and SEQ ID NO: 4, SEQ ID NO: 5 and SEQ ID NO: 6, respectively a VL region comprising CDRs 1, 2 and 3 described in amino acid sequence;
- CDRs complementarity determining regions
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13, respectively, and amino acid sequences of SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 21, SEQ ID NO: 22 and SEQ ID NO: 23, respectively, and amino acid sequences of SEQ ID NO: 24, SEQ ID NO: 25 and SEQ ID NO: 26, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 31, SEQ ID NO: 32 and SEQ ID NO: 33, respectively, and amino acid sequences of SEQ ID NO: 44, SEQ ID NO: 45 and SEQ ID NO: 46, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 51, SEQ ID NO: 52 and SEQ ID NO: 53, respectively, and amino acid sequences of SEQ ID NO: 54, SEQ ID NO: 55 and SEQ ID NO: 56, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 61, SEQ ID NO: 62 and SEQ ID NO: 63, respectively, and amino acid sequences of SEQ ID NO: 64, SEQ ID NO: 65 and SEQ ID NO: 66, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 71, SEQ ID NO: 72 and SEQ ID NO: 73, respectively, and amino acid sequences of SEQ ID NO: 74, SEQ ID NO: 75 and SEQ ID NO: 76, respectively a VL region comprising CDRs 1, 2 and 3;
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 81, SEQ ID NO: 82 and SEQ ID NO: 83, respectively, and amino acid sequences of SEQ ID NO: 84, SEQ ID NO: 85 and SEQ ID NO: 86, respectively a VL region comprising CDRs 1, 2 and 3; and
- VH region comprising CDRs 1, 2 and 3 set forth in the amino acid sequences of SEQ ID NO: 91, SEQ ID NO: 92 and SEQ ID NO: 93, respectively, and amino acid sequences of SEQ ID NO: 94, SEQ ID NO: 95 and SEQ ID NO: 96, respectively VL region comprising CDRs 1, 2 and 3.
- a polypeptide that binds to Mucin1 comprising a pair of a heavy chain variable (VH) region and a light chain variable (VL) region selected from the group consisting of: - comprising the amino acid sequence of SEQ ID NO:7 a VH region and a VL region comprising the amino acid sequence of SEQ ID NO: 8; a VH region comprising the amino acid sequence of SEQ ID NO: 17 and a VL region comprising the amino acid sequence of SEQ ID NO: 18;
- VH region comprising the amino acid sequence of SEQ ID NO: 27 and a VL region comprising the amino acid sequence of SEQ ID NO: 28;
- VH region comprising the amino acid sequence of SEQ ID NO: 37 and a VL region comprising the amino acid sequence of SEQ ID NO: 38;
- VH region comprising the amino acid sequence of SEQ ID NO: 47 and a VL region comprising the amino acid sequence of SEQ ID NO: 48;
- VH region comprising the amino acid sequence of SEQ ID NO: 57 and a VL region comprising the amino acid sequence of SEQ ID NO: 58;
- VH region comprising the amino acid sequence of SEQ ID NO: 67 and a VL region comprising the amino acid sequence of SEQ ID NO: 68;
- VH region comprising the amino acid sequence of SEQ ID NO: 77 and a VL region comprising the amino acid sequence of SEQ ID NO: 78;
- VH region comprising the amino acid sequence of SEQ ID NO: 87 and a VL region comprising the amino acid sequence of SEQ ID NO: 88;
- VH region comprising the amino acid sequence of SEQ ID NO: 97 and a VL region comprising the amino acid sequence of SEQ ID NO: 98.
- antibody is used in the broadest sense as a generic term for a protein that specifically binds to a specific antigen, and a protein produced by stimulation of an antigen in the immune system or a chemically synthesized or recombinantly prepared protein. may be, and the type is not particularly limited. Specifically, a monoclonal antibody (including a full-length monoclonal antibody), a polyclonal antibody, a multispecific antibody (eg, a bispecific antibody), a synthetic antibody (also called an antibody mimic), a chimeric antibody, a humanized antibody, as long as it exhibits the desired biological activity It encompasses antibodies, human antibodies, or antibody fusion proteins (also called antibody conjugates).
- a complete antibody (eg, type IgG) is a structure having two full length light chains and two full length heavy chains, each light chain being It is connected to the heavy chain by disulfide bonds.
- the constant region of an antibody is divided into a heavy chain constant region and a light chain constant region, and the heavy chain constant region has a gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) or epsilon ( ⁇ ) type, subclass gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), gamma 3 ( ⁇ 3), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) or alpha 2 ( ⁇ 2).
- the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
- antigen-binding fragment refers to a portion of an antibody that lacks at least some of the amino acids present in its full-length chain but is still capable of specifically binding an antigen. Such fragments are biologically active in that they bind to the target antigen and are able to compete with other antigen binding molecules, including intact antibodies, for binding to a given epitope.
- the antigen binding fragment may not comprise the constant heavy chain domains of the Fc region of an intact antibody (ie, depending on the antibody isotype ie CH2, CH3 and CH4).
- antigen-binding fragments include single chain variable fragment (scFv) (eg, scFv, (scFv) 2 , etc.), fragment antigen binding (Fab) (eg, Fab, Fab', F(ab') 2 , etc.) ), domain antibodies, peptibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies or single-chain antibodies, and the like.
- scFv single chain variable fragment
- Fab fragment antigen binding
- domain antibodies peptibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies or single-chain antibodies, and the like.
- Antigen-binding fragments also include scFvs, or fusion polypeptides (scFv-Fc) wherein the scFv is fused to the Fc region of an immunoglobulin (eg, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, etc.) Or it may be a fusion polypeptide (scFv-Ck (kappa constant region) or scFv-C ⁇ (lambda constant region)) fused to the constant region (eg, kappa or lambda) of the light chain, but is not limited thereto.
- an immunoglobulin eg, IgA, IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), IgM, etc.
- scFv-Ck kappa constant region
- scFv-C ⁇ lacambd
- variable chain refers to a variable region domain V H comprising an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen and three constant region domains C H1 , C H2 and C H3 and a hinge ( hinge) is interpreted as meaning including all the full-length heavy chains and fragments thereof.
- light chain refers to both a full-length light chain comprising a variable region domain VL and a constant region domain CL comprising an amino acid sequence having a sufficient variable region sequence to confer specificity to an antigen, and fragments thereof. interpreted as including
- CDR complementarity-determining regions
- Framework region refers to the non-CDR portions of the variable regions of heavy and light chains, generally comprising four FRs (FR-H1, FR-H2, FR-H3 and FR- H4), and there are four FRs (FR-L1, FR-L2, FR-L3 and FR-L4) in the light chain variable region.
- the exact amino acid sequence boundaries of a given CDR or FR are determined by a number of well-known systems, including the Kabat numbering system, Chothia numbering system, Contact numbering system, IMGT numbering system, Aho numbering system, AbM numbering system, etc. It can be easily determined using any one of them.
- variable region refers to the domain of an antibody heavy or light chain that is involved in binding an antibody to an antigen.
- the heavy chain variable (VH) and light chain variable (VL) regions generally have a similar structure, each domain comprising four conserved framework regions (FR) and three CDRs.
- the mucin 1-binding polypeptide of the present application is a single chain variable fragment (scFv), peptibody, fragment antigen binding (Fab), monoclonal antibody, bispecific antibody, minibody, domain antibody, synthetic antibody, chimeric antibody , a humanized antibody, a human antibody, or an antibody fusion protein, but is not limited thereto.
- the mucin 1-binding polypeptide of the present application may be a single chain variable fragment (scFv).
- scFv single chain variable fragment
- VH heavy chain variable
- VL light chain variable
- the linker may be a water-soluble and/or flexible linker.
- the N-terminus of VH and the C-terminus of VL may be connected by a linker, or the C-terminus of VH and N-terminus of VL may be connected.
- the linker may be a peptide linker, for example 10 to 30 amino acids in length, 10 to 25 amino acids in length, 10 to 20 amino acids in length, 10 to 15 amino acids in length, 15 to 30 amino acids in length, 15 to 25 amino acids in length, 15 to 20 amino acids in length.
- amino acid length specifically 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid length may be, but is not limited thereto.
- the linker may be rich in glycine (Gly) for flexibility, and may include serine (Ser), asparagine (Asn), alanine (Ala) or threonine (Thr) for solubility.
- the linker may be composed of a total of 1 to 100, 2 to 50, or 5 to 25 of one or more selected from the group consisting of Gly, Asn, Ser, Thr, and Ala.
- the amino acid sequence of the linker may be a sequence in which GGGS or GGGGS has a variable number of repeats, such as 2, 3, 4 and 5 repeats.
- the linker can be, but is not limited to, GGGGSGGGGSGGGGS, GGGGSGGGGSGGGGGGSGGGGS, or GGGGSGGGGSGGGAS.
- the scFv retains the antigenic specificity of the parent antibody despite the absence of a constant region and the introduction of a linker.
- the scFv may be expressed from a polynucleotide encoding a VH region and a VL region, but is not limited thereto.
- SEQ ID NO: 9 selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 39, SEQ ID NO: 49, SEQ ID NO: 59, SEQ ID NO: 69, SEQ ID NO: 79, SEQ ID NO: 89 and SEQ ID NO: 99
- SEQ ID NO: 9 selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 39, SEQ ID NO: 49, SEQ ID NO: 59, SEQ ID NO: 69, SEQ ID NO: 79, SEQ ID NO: 89 and SEQ ID NO: 99
- An scFv polypeptide comprising an amino acid sequence is provided.
- An antibody or antigen-binding fragment herein is a variant that possesses equivalent activity, e.g., about 80%, about 81%, about 82%, about 83%, about 84%, about 85% of the amino acid sequences described herein. , about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about Variants having 98% or greater than about 99% identity and equivalent biological activity may also be included in the scope of the present application.
- an isolated polynucleotide encoding said mucin1-binding polypeptide.
- the polynucleotide consists of SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 40, SEQ ID NO: 50, SEQ ID NO: 60, SEQ ID NO: 70, SEQ ID NO: 80, SEQ ID NO: 90 and SEQ ID NO: 100 It may include a nucleic acid sequence selected from the group.
- the present invention also has about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% identity to the sequence. and may include an isolated polynucleotide encoding a polypeptide having equivalent activity.
- polynucleotides may be codon optimized for expression in humans.
- a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
- the polynucleotide may be operably linked to a promoter.
- operatively linked refers to a functional linkage between a nucleotide expression control sequence (eg, a promoter sequence) and another nucleotide sequence.
- the regulatory sequences may be operably linked to regulate the transcription and/or translation of other nucleotide sequences.
- Vectors can be constructed, typically as vectors for cloning or as vectors for expression.
- the expression vector may be a conventional vector used to express a foreign protein in plants, animals or microorganisms in the art.
- the vector can be constructed through various methods known in the art.
- a vector can be constructed using a prokaryotic cell or a eukaryotic cell as a host.
- a prokaryotic cell when the vector used is an expression vector and a prokaryotic cell is used as a host, a strong promoter capable of proceeding transcription (eg, pL ⁇ promoter, CMV promoter, trp promoter, lac promoter, tac promoter, T7) promoter, etc.), a ribosome binding site for initiation of translation, and transcription/translation termination sequences.
- the replication origin operating in the eukaryotic cell contained in the vector includes the f1 origin of replication, the SV40 origin of replication, the pMB1 origin of replication, the adeno origin of replication, the AAV origin of replication and the BBV origin of replication. It is not limited.
- a promoter derived from the genome of a mammalian cell eg, a metallotionine promoter
- a promoter derived from a mammalian virus eg, adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter and tk promoter of HSV
- it may further include an enhancer sequence, 5'-side and 3'-side untranslated regions, a secretion signal sequence, a splicing junction, a selection marker (eg, an antibiotic resistance gene), and the like.
- a cell comprising a vector comprising a polynucleotide encoding the mucin1-binding polypeptide.
- the cell may be obtained by introducing the vector into an appropriate host cell.
- a host cell containing the vector may be useful for cloning or expression of a polynucleotide contained in the vector.
- any host cell known in the art may be used as a cell capable of cloning or expressing the vector stably and continuously.
- prokaryotic cells include, for example, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E.
- yeast Saccharomyce cerevisiae
- insect cells plant cells and animal cells
- Sp2/0 Chinese hamster ovary (CHO) K1
- CHO DG44 PER.C6, W138
- BHK COS-7
- COS-7 293, HepG2, Huh7 , 3T3, RIN, MDCK cell lines, etc.
- Transport introduction of the polynucleotide or a vector containing the same into a host cell
- a transport method well known in the art may be used.
- the transport method for example, when the host cell is a prokaryotic cell, CaCl 2 method or electroporation method, etc. can be used, and when the host cell is a eukaryotic cell, microinjection method, calcium phosphate precipitation method, electroporation method, Liposome-mediated transfection and gene bombardment may be used, but are not limited thereto.
- the method of selecting the transformed host cell can be easily performed according to a method well known in the art, using the phenotype expressed by the selection marker.
- the selection marker is a specific antibiotic resistance gene
- the transformant can be easily selected by culturing the transformant in a medium containing the antibiotic.
- the transformed host cell can be cultured for a period sufficient for the expression or secretion of the polypeptide, and separation and purification methods used in conventional proteins, for example, salting out, solvent precipitation, etc.
- Polypeptides can be separated and purified by a method using a difference in hydrophobicity, such as reverse phase high performance liquid chromatography, and a method using a difference in isoelectric point such as isoelectric point electrophoresis.
- a chimeric antigen receptor comprising the mucin 1-binding polypeptide.
- the mucin1-binding polypeptides are suitable for use in chimeric antigen receptors because they can be engineered to be expressed as part of a single chain along with other CAR components.
- a chimeric antigen receptor typically comprises an extracellular domain comprising a mucin1-binding polypeptide; transmembrane domain; It may include an intracellular signaling domain or T cell activation domain.
- the extracellular domain may further include a spacer region (or hinge region) between the polypeptide and the transmembrane domain.
- the chimeric antigen receptor may further comprise one or more co-stimulatory domains, preferably the co-stimulatory domain is located between the transmembrane domain and the intracellular signaling domain.
- the chimeric antigen receptor comprises an extracellular domain comprising a mucin1-binding polypeptide; hinge domain; transmembrane domain; one or more costimulatory domains; and an intracellular signal transduction domain.
- Each domain may be heterogeneous. That is, it may consist of sequences derived from different protein chains.
- Each domain may be joined by a short oligo- or polypeptide linker, for example a linker between 2 and 10 amino acids in length.
- the chimeric antigen receptor may consist of one polypeptide chain to which each domain is linked.
- the extracellular domain comprises a mucin1-binding polypeptide as described above, which recognizes mucin1 expressed on the surface of cancer cells.
- the extracellular domain may further comprise a spacer region (or hinge region).
- a spacer region may be positioned between the mucin1-binding polypeptide and the transmembrane domain.
- the spacer region allows the mucin1-binding polypeptide to more flexibly recognize the target antigen at a certain distance from the cell membrane of the CAR-T cell.
- the spacer region may typically be a polypeptide and may be at least 10 amino acids in length, for example 10 to 300 amino acids in length, 10 to 250 amino acids in length, 10 to 200 amino acids in length, 10 to 150 amino acids in length, 10 to 100 amino acids in length, It may have a length of 10 to 50 amino acids, but is not limited thereto.
- the spacer region may exemplify the hinge region of CD8 ⁇ or CD28, or the constant region of immunoglobulin (IgG), and a mutation may be introduced to remove the off-target effect by these.
- the immunoglobulin constant region may be derived from the IgG hinge alone, all or part of the CH2 and CH3 domains, eg an Fc region.
- IgG may preferably be IgG2 or IgG4.
- the spacer can be a chimeric polypeptide containing one or more of the hinge, CH2 and CH3 sequences derived from IgG2, IgG4, and/or IgG2 and IgG4.
- the hinge domain may be represented by the sequence of SEQ ID NO: 112, but is not limited thereto.
- the transmembrane domain serves to connect the cell membrane domain and the signaling domain inside the cell membrane, and may be derived from a natural or synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- the transmembrane domain may be the alpha, beta or zeta chain of a T cell receptor, CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD28, CD33, CD37, CD45, CD64, CD80, CD86, CD134, It may be a transmembrane domain of CD137 or CD154, but is not limited thereto.
- the transmembrane domain may be a transmembrane domain of CD28 or CD8, but is not limited thereto.
- the synthetic transmembrane domain may include hydrophobic residues such as leucine and valine, and may include phenylalanine, tryptophan, and valine at each end, but is not limited thereto.
- the transmembrane domain may be represented by the sequence of SEQ ID NO: 113, but is not limited thereto.
- the co-stimulatory domain is a site to which a co-stimulatory signal is transmitted, and is a site to transmit a signal to cause an immune response and self-proliferation of CAR-T cells. It can be selectively introduced to enhance the proliferation, cytotoxicity, sustained response, life extension of CAR-T cells, and the like.
- the costimulatory domains are CD28, OX-40 (CD134), 4-1BB (CD137), CD2, CD7, CD27, CD30, CD40, PD-1, ICOS, LFA-1 (CD11a/CD18), CD3 gamma, CD3 delta , CD3 epsilon, CD247, CD276 (B7-H3), LIGHT, (TNFSF14), NKG2C, Ig alpha (CD79a), DAP-10, Fc gamma receptor, MHC class 1 molecule, TNF receptor protein, immunoglobulin protein, cytoplasmic Cain receptor, integrin, signaling lymphocytic activation molecule (SLAM), activating NK cell receptor, BTLA, toll ligand receptor, ICAM-1, B7-H3, CDS, ICAM-1, GITR, BAFFR, LIGHT, HVEM (LIGHTR), KIRDS2 , SLAMF7, NKp80 (KLRF1), NKp44, NK
- one or more selected from the signaling sites of CD28, OX-40 (CD134), 4-1BB (CD137), CD27 or ICOS may be one, two or three, but not limited
- the costimulatory domain may be represented by the sequence of SEQ ID NO: 114, but is not limited thereto.
- the intracellular signaling domain is a site that activates a T cell immune response to an antigen bound to a mucin1-binding polypeptide.
- the signaling domain may be a component of the T cell receptor (TCR) or contain a signaling motif known as an immunoreceptor tyrosine-based activation motif (ITAM).
- TCR T cell receptor
- ITAM immunoreceptor tyrosine-based activation motif
- the signaling domain may be, but is not limited to, a signaling domain derived from TCR or CD3 zeta, FcR gamma, CD3 gamma, CD3 delta and CD3 epsilon.
- a preferred example may be the signaling domain of CD3 zeta, but is not limited thereto.
- the intracellular signaling domain is capable of activating a CAR-T cell upon binding of the mucin1-binding polypeptide portion of the extracellular domain to a target.
- CARs can stimulate the function of T cells, such as cytolytic activity or T-helper activity, and induce secretion of cytokines or other factors.
- the intracellular signal transduction domain may be represented by the sequence of SEQ ID NO: 115, but is not limited thereto.
- the CAR may be expressed in a form comprising a signal sequence.
- the CAR can also be expressed with additional sequences useful for monitoring expression, for example, ribosomal skip sequences such as the 2A peptide or truncated cell surface polypeptides (such as tHER2 or tEGFR or truncated PSMA).
- polynucleotide encoding the chimeric antigen receptor.
- polynucleotides may be codon optimized for expression in humans.
- a vector comprising a polynucleotide encoding the chimeric antigen receptor.
- the vector may be constructed as a vector for gene cloning, a vector for protein expression, or a vector for gene delivery. In the case of a vector for cloning or expression, the details are as described above.
- the vector may be a viral vector.
- a vector may be a retroviral vector, a DNA vector, a murine leukemia virus vector, a SFG vector, a plasmid, an RNA vector, an adenoviral vector, a baculovirus vector, an Epstein Barr virus vector, a papovavirus vector, a vaccinia virus vector, It may be, but is not limited to, a herpes simplex virus vector, an adenovirus associated vector (AAV), or a lentiviral vector.
- AAV adenovirus associated vector
- an immune cell expressing a chimeric antigen receptor comprising the mucin1-binding polypeptide.
- Immune cells include, but are not limited to, T cells, Tumor Infiltrating Lymphocytes (TILs), Natural killer (NK) cells, TCR-expressing cells, dendritic cells, or NK-T cells.
- TILs Tumor Infiltrating Lymphocytes
- NK Natural killer
- TCR-expressing cells TCR-expressing cells
- dendritic cells dendritic cells
- NK-T cells NK-T cells.
- the immune cells may be derived from human induced pluripotent stem cells (iPSCs). Immune cells can be derived from any known source. For example, immune cells can be differentiated in vitro from a hematopoietic stem cell population or obtained from a patient.
- Immune cells can be obtained from, for example, peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from the site of infection, ascites, pleural effusion, spleen tissue, and tumors.
- PBMC peripheral blood mononuclear cells
- the immune cells may be derived from one or more immune cell lines available in the art.
- Immune cells may be autologous or allogenic. Autologous means those derived from the patient to be treated. Allogeneic means that it is derived from another individual of the same species as the patient to be treated.
- the immune cells may be derived from human induced pluripotent stem cells (iPSCs). Compared to autologous or allogeneic immune cells, iPSC-derived immune cells can self-proliferate, so mass-proliferation is easy.
- iPSCs human induced pluripotent stem cells
- Immune cells can be produced by microinjection, electroporation, sonication, biolistics (eg, gene gun), lipid transfection, polymer transfection, calcium phosphate precipitation, protoplast fusion, liposome-mediated transfection, nanoparticles or polyplexes, etc. It can be transfected or transduced with a vector using the method of, but is not limited thereto.
- composition for preventing or treating cancer comprising a T cell comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide.
- the prevention and/or treatment of cancer comprising administering to a patient in need thereof an effective amount of a T cell comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide or a method of treatment is provided.
- the cancer may be a solid cancer or a blood cancer, including, but not limited to, breast cancer, lung cancer, prostate cancer, ovarian cancer, brain cancer, liver cancer, cervical cancer, endometrial cancer, uterine cancer, colon cancer, colorectal cancer, colorectal cancer , rectal cancer, kidney cancer, nephroblastoma, skin cancer, oral squamous cell carcinoma, epidermal cancer, nasopharyngeal cancer, head and neck cancer, bone cancer, esophageal cancer, bladder cancer, lymphatic duct cancer (eg Hodgkin's lymphoma or non-Hodgkin's lymphoma), stomach cancer, Pancreatic cancer, testicular cancer, thyroid cancer, thyroid follicular cancer, melanoma, myeloma, multiple myeloma, mesothelioma, osteosarcoma, myelodysplastic syndrome, tumor of mesenchymal origin, soft tissue sarcoma, lipo
- the lung cancer may be, for example, small cell lung carcinoma (SCLC) or non-small cell lung carcinoma (NSCLC).
- the leukemia can be, for example, acute myeloid leukemia (AML), chronic myelogenous leukemia (CML), acute lymphocytic leukemia (ALL) or chronic lymphocytic leukemia (CLL).
- the cancer is a cancer in which the MUC1 protein is expressed, and may be breast cancer, skin cancer, pancreatic cancer, prostate cancer, lung cancer, thyroid cancer, stomach cancer, ovarian cancer, colorectal cancer, liver cancer, gallbladder cancer, kidney cancer, cervical cancer, or bladder cancer,
- the present invention is not limited thereto.
- the cancer may be a primary cancer or a metastatic cancer.
- the patient to be treated may be a patient receiving second-line anti-hyperproliferative therapy.
- the second-line anti-hyperproliferative therapy may be chemotherapy, radiation therapy, immunotherapy, phototherapy, cryotherapy, toxin therapy, hormone therapy, or surgery.
- T cells comprising a chimeric antigen receptor comprising the mucin 1-binding polypeptide of the present application
- the mucin 1-binding polypeptide of the present application genetically engineered to express a chimeric antigen receptor containing
- the step of extracting T cells from the blood of a healthy person or a patient to be treated is, for example, a process of separating leukocytes from blood using leukapheresis or aphresis and then concentrating the T cells.
- T cells can be extracted through T cells can be isolated using specific antibody bead conjugates or markers at the CD4/CD8 constitutive level. Alternatively, it is also possible to stably obtain a large amount of T cells through differentiation from stem cells.
- the step of genetically engineering the extracted T cells to express the chimeric antigen receptor may include, for example, converting a nucleic acid molecule designed to express a chimeric antigen receptor (CAR) into a vector, for example, a viral vector (lenti Viral vectors or retroviral vectors, etc.) can be used for injection into T cells.
- the CAR may be introduced in the form of DNA or may be introduced in the form of RNA and then reverse transcribed into DNA by a reverse transcriptase and then integrated into the genome of the T cell.
- genetic manipulation to remove or correct genes inducing transplant rejection in donor T cells may be additionally applied to prevent rejection, such as graft-versus-host disease (GvHD).
- GvHD graft-versus-host disease
- the T cells may be cultured, proliferated and expanded according to a culture technique known in the art. At this time, safety for the use of viruses and technology for selecting well-made CAR-T cells are required.
- the step of re-administering the engineered T cells to the patient may consist of, for example, infusion.
- the patient before injection of CAR-T cells, the patient may receive chemotherapy to control lymphocyte removal using cyclophosphamide or fludarabine, etc. to lower the white blood cell count.
- cytokines such as IL-2 may be administered together.
- Engineered T cells administered to a patient can mediate an immune response against tumor cells expressing mucin1. These immune responses include activation of T cells, secretion of cytokines such as IL-2 and IFN-gamma by T cells, proliferation and expansion of T cells that recognize tumor antigens, and T cell-mediated T cell-mediated specific killing (removal of the tumor).
- T cells are activated through phosphorylation of an immunoreceptor tyrosine-based activation motif (ITAM) of CD3 zeta, and then, T Cell proliferation, cytotoxicity and/or cytokine secretion may be induced.
- ITAM immunoreceptor tyrosine-based activation motif
- anticancer therapy using CAR-T cells fundamentally activates the patient's immune system and exerts a continuous anticancer effect, so it does not need to be administered continuously. There is this.
- compositions herein can elicit, induce, or promote an immune response that inhibits, arrests, delays, or prevents the onset or progression of a disease state.
- the term "effective amount” means an amount sufficient to achieve the desired result, eg, an amount effective to treat or prevent cancer, when administered to a subject, including a human.
- the effective amount may vary depending on various factors such as formulation method, administration mode, age, weight, sex, disease severity, food, administration time, administration route, excretion rate and reaction sensitivity of the patient. Dosage or therapeutic regimen can be adjusted to provide an optimal therapeutic response as will be understood by those skilled in the art.
- a therapeutic regimen with a therapeutically effective amount may consist of a single administration or, alternatively, may include a series of applications.
- the duration of the treatment phase is determined by various factors such as formulation method, administration mode, age, weight, sex, disease severity, food, administration time, administration route, excretion rate and response sensitivity of the patient.
- the effective dosage of the anti-cancer composition used for treatment may be raised or lowered during the course of an individual therapeutic regimen. Variations in dosage may occur and will be apparent through standard diagnostic assays known in the art.
- the compositions of the present invention in some aspects, may be administered before, during, or after treatment with conventional anticancer agents, radiation therapy, hormone therapy, biotherapy, and/or surgical resection of the tumor.
- composition of the present application may be provided together with one or more additives selected from the group consisting of pharmaceutically acceptable carriers, diluents, and excipients.
- the pharmaceutically acceptable carrier as commonly used in the formulation of antibodies, lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia gum, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline It may be at least one selected from the group consisting of cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, mineral oil, etc., but It is not limited.
- the composition may further include at least one selected from the group consisting of diluents, excipients, lubricants, wetting agents, sweeteners, flavoring agents, emulsifiers, suspending agents, preservatives, etc. commonly used in the preparation of pharmaceutical compositions in addition to the above ingredients. have.
- the composition may be administered orally or parenterally.
- parenteral administration intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, etc. can be administered.
- oral compositions may be formulated to coat the active agent or to protect it from degradation in the stomach.
- the composition may be administered by any device capable of transporting the active agent to a target cell.
- the cells can be administered using standard administration techniques, formulations or devices.
- Formulations and devices such as syringes and vials for storage and administration of the composition may be suitably used.
- Administration of cells may be autologous, allogenic, or xenogenic.
- Peripheral blood-derived immune cells or progeny thereof e.g., derived in vivo, ex vivo or in vitro
- local injection including catheter administration, systemic injection, local injection, intravenous injection, or parenteral administration.
- When administering immune cell therapeutics they are generally formulated in injectable unit dosage forms (solutions, suspensions, emulsions).
- the cell population may be administered parenterally.
- Formulations include intravenous infusion, subcutaneous infusion, intramuscular infusion, intraperitoneal infusion, endothelial administration, topical administration, intranasal administration, intrapulmonary administration and rectal administration.
- compositions are provided as sterile liquid preparations, for example, as isotonic aqueous solutions, suspensions, emulsions, dispersions or viscous compositions, which in some aspects may be buffered to a selected pH.
- Liquid formulations are generally easier to prepare than gels, other viscous compositions, and solid compositions.
- liquid compositions are particularly convenient to administer by injection.
- viscous compositions may be formulated within an appropriate viscosity range to provide a longer period of contact with a particular tissue.
- a liquid or viscous composition may comprise a carrier which can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
- a carrier which can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
- a carrier can be a solvent or dispersion medium containing, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
- polyol e.g., glycerol, propylene glycol, liquid polyethylene glycol
- Sterile injectable solutions can be prepared by incorporating the binding molecule in a solvent such as a suitable carrier, diluent, or admixture with such excipients as sterile water, saline, glucose, dextrose, and the like.
- a solvent such as a suitable carrier, diluent, or admixture with such excipients as sterile water, saline, glucose, dextrose, and the like.
- the composition may also be lyophilized.
- the composition may contain auxiliary substances such as wetting agents, dispersing or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, coloring agents, and the like, depending on the route of administration and desired route of manufacture.
- additives may be added to improve the stability and sterility of the composition, including antibacterial preservatives, antioxidants, chelating agents and buffers. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form may be brought about by the use of agents which delay absorption, for example, aluminum monostearate and gelatin.
- a recombinant antigen was prepared by conjugating human mucin 1 (SEQ ID NO: 110) with CD4 (SEQ ID NO: 111), and clones secreting scFv specific for the antigen were screened from an scFv library. Ten species were selected. The sequence information of 10 selected scFvs and the positive control scFv G03 (a positive control made using the amino acid sequence of the G3 antibody in Table 6 of WO2018/174544) used in the subsequent experiments is shown in Table 3.
- the affinity of the scFv-Fc antibody containing the scFv to the mucin 1 antigen was measured using a Biacore T200 (GE healthcare).
- Biacore T200 GE healthcare
- anti-human IgG (Fc) antibody GE healthcare, Cat. No. BR-1008-39, final concentration of 25 ug/mL was flowed at 5 uL/min for 360 seconds, and fixed at about 5000-7000 RU.
- Extracellular domain (nucleotide sequence in Table 4), hinge (CD8 ⁇ ) (SEQ ID NO: 112) and transmembrane domain (CD28) (SEQ ID NO: 113), costimulatory domain (CD28) (SEQ ID NO: 114) comprising scFv polypeptide sequences , and an intracellular signaling domain (CD3zeta) (SEQ ID NO: 115) expressing a chimeric antigen receptor (CAR) containing a lentiviral vector (transfer vector or expression vector) was prepared.
- CD3zeta intracellular signaling domain
- CAR chimeric antigen receptor
- the scFv portion of the CAR was separated by PCR fragments from the plasmid supplied by the screening company, and the hinge, transmembrane protein, and CD28 and CD3z signaling domains were fragmented from the synthesized plasmid by PCR. The two fragments were cloned into Clonetech's pLVX-EF1alpha vector using Takara's In-Fusion HD cloning kit.
- the cloned lentiviral vector was transfected (product code 632180) into Takara's Lenti-X 293T Cell Line together with the packaging plasmid provided by the company's Lenti-X Expression System (EF1a Version) (product code 631253) 24 After time, the soup was separated and the lentivirus in it was used for further study.
- EF1a Version Lenti-X Expression System
- the prepared lentivirus transfer vector (transfer vector or expression vector) and packaging plasmid mix (lentivirus packaging plasmid mix) were transferred to Lenti-X 293T cells (Takara Product No. 632180) was transfected.
- HEK293T cells were prepared to exist in about 6 to 70% of the culture plate area.
- Dulbecco's modified Eagle medium (DMEM, Gibco) supplemented with 10% heat-inactivated fetal bovine serum (FBS, Gibco) was used as the medium, and a culture plate of 100 mm or 150 mm size was used.
- DMEM Dulbecco's modified Eagle medium
- FBS heat-inactivated fetal bovine serum
- the HEK293T cells were transfected by dropwise treatment on the incubated plate. After transfection, the lentivirus produced in HEK293T cells was ejected out of the cell and was present in the cell culture medium in the form of virus particles. 48 hours after transfection, only the cell culture solution was removed from the culture plate and centrifuged to obtain lentiviral particles in the form of pellets. After dissolving the pellet using the solution, it was immediately used or stored in a cryogenic freezer.
- the Optimizer T-Cell Expansion Supplement (26ml) is added to the DMEM medium used previously or the CTS optimizer T cell Expansion SFM 1L bottle (Gibco) used for T cell culture, and CTS Innume Cell SR (Serum Replacement, Gibo) is added to the final 2 %, and CTS GlutaMAX-I Supplement 100X (Gibco) was added so that the final 1X was used.
- PBMC Peripheral blood mononuclear cell
- Donor refers to the donor of the PBMC sample used in the experiment, and the number after Donor means that the donor is different (e.g., Donor 03, Donor 04, Donor 05, Donor 06) , Donor 07, Donor08, Donor 18-09, Donor 20-01, etc.).
- CAR chimeric antigen receptor
- T-cells were activated using T cell-specific amplification beads (Dynabeads Human T-expander CD3/CD28, Gibco), and the chimeric antigen receptor (CAR) in the form of a lentivirus was treated according to the number of activated cells. and transduced into T cells.
- CAR chimeric antigen receptor
- a suspension of Interleukin-2 (Norvatis) dissolved in filtered sterile distilled water is added so that the amount of the medium becomes 100IU/ml, and during the subsequent incubation period, each time the medium is replaced or added. was continuously put in.
- the cell culture period is 10-11 days in total after activation, and the medium is replaced or newly added every 1-2 days depending on the number of cells and culture is carried out. done.
- the prepared CAR-T cells were used immediately or mixed with a cell cryopreservation solution and injected into a vial for cell freezing and stored in a Liquid Nitrogen Tank. Confirmation and characterization of the expression level of the chimeric antigen receptor (CAR) of the prepared CAR-T cells was performed through flow cytometry (FACS).
- FACS flow cytometry
- Example 3 Affinity analysis of soluble scFv to mucin1-expressing cells
- Example 3 A total of four cell lines were used in Example 3, and HEK293 (ATCC) and PANC-1 (ATCC) cell lines were used as negative controls, and HEK293T-v1 (transformed by ATCC and LG Chem) and T47D (Korean cell lines) as positive controls. Bank) cell lines were used.
- the HEK293T-v1 cell line used as a positive control is a cell line expressing the C subunit of MUC1 in a HEK293T cell line that does not express mucin 1.
- the soluble scFv prepared in Example 1 was diluted 5 times to prepare a total concentration of 8 steps.
- the concentrations for each step were 380 ⁇ g/mL, 76 ⁇ g/mL, 15.2 ⁇ g/mL, 3.04 ⁇ g/mL, 0.608 ⁇ g/mL, 0.1216 ⁇ g/mL, 0.02432 ⁇ g/mL, and 0.004864 ⁇ g/mL.
- the buffer used for dilution of soluble scFv and cell washing was PBS containing 2% FBS and 10 mM EDTA.
- Four types of cells were prepared at 1X10 6 /mL, put in a 96-well U-bottom cell culture plate at 1X10 5 /100 ⁇ l/well, and centrifuged at 1500 RPM for 5 minutes.
- the previously prepared soluble scFv was treated at 50 ⁇ l/well. It left still at 4 degreeC for 1 hour.
- Cell washing buffer was added at 150 ⁇ l/well, mixed, and centrifuged at 1500 RPM for 5 minutes. After discarding the supernatant, 200 ⁇ l/well of cell washing buffer was added, mixed, and centrifuged at 1500 RPM for 5 minutes.
- Goat anti-human IgG Fc-biotin antibody (Invitrogen, A18821) was diluted 500-fold and treated at 50 ⁇ l/well. It left still at 4 degreeC for 20 minutes.
- Cell washing buffer was added at 150 ⁇ l/well, mixed, and centrifuged at 1500 RPM for 5 minutes.
- the affinity of the soluble scFv to the mucin1-expressing cells was confirmed by the PE MFI value among the results of flow cytometry.
- soluble scFv was not added, and the value obtained by staining with another fluorescent antibody (Goat anti-human IgG Fc-biotin antibody, PE-Streptavidin) was set as the negative control value, and G03 concentration of each cell was 380 ⁇ g/mL.
- the MFI value was corrected as follows by setting the value treated as a positive control value as follows:
- the ELISA assay method is the same as a commonly used method. To put it simply: First, a 96-well immune plate was coated with a capture antibody capable of capturing interferon-gamma or interleukin-2, and after one day, it was sufficiently washed with a washing buffer. A block buffer is added to each well, left at room temperature for 1 hour, and then washed sufficiently with a washing buffer again.
- a culture solution sample was placed in each well and allowed to react by standing at room temperature for 2 hours. After washing sufficiently with a washing buffer, a detection antibody was added and reacted at room temperature for 2 hours. After washing sufficiently with the washing buffer, HRP-labeled streptavidin was added to each well and reacted at room temperature for 20 minutes. After sufficiently washing with the washing buffer, the substrate solution was added and reacted at room temperature for 20 minutes, and the reaction was stopped with a stop solution. The cytokine concentration in each well was calculated as absorbance according to the reaction.
- FIG. 1 is a positive control group, and a group in which no CAR was injected (NO LV) was used as a negative control group.
- FIG. 1 is a graph showing results representatively of independent experiments using a total of two T cell derivations, and was named Donor 03 and Donor 04 according to the origin of T cells.
- Donor refers to the donor of the T cells used in the experiment, and the number after Donor means that the donor is different.
- 1 is a graph in which the absorbance is normalized based on the control group G03, and it shows that the tested immune cells secrete cytokines.
- FIG. 2 is a cytokine secretion assay for evaluating the reactivity of immune cells injected with anti-MUC1 scFv in the form of CAR against MUC1-positive tumor cells (T47D), showing that the tested immune cells secrete cytokines.
- T cells were derived from Donor 06. A group in which no CAR was injected (Control T cell) was used as a negative control group.
- FIG. 3 is a cytokine secretion analysis result evaluating the reactivity of immune cells injected with anti-MUC1 scFv in the form of CAR to mucin1 non-expressing cells (HEK293T). Interferon-gamma cytokines are not secreted, and in the case of IL-2 It shows that the secretion amount does not increase significantly when compared to the negative control group (Control T cell). T cells were derived from Donor 06. A group in which no CAR was injected (Control T cell) was used as a negative control group.
- Human breast cancer cell lines T47D, HCC70, HCC1954), human liver cancer cell lines (Huh7, HepG2), and human neuroblastoma cell lines (SK-N-SH) were purchased from Korean Cell Line Bank (KCLB, Seoul, Korea), and human embryonic kidney The cell line (HEK293T) was purchased from the American Type Culture Collection (ATCC, Manassas, VA).
- T47D, HCC70, and HCC1954 cells were cultured in RPMI-1640 medium (Thermo Fisher Scientific), and HEK293T, Huh7, and HepG2 cells were cultured in Dulbecco's modified Eagle's medium (DMEM, Thermo Fisher Scientific), respectively.
- DMEM Dulbecco's modified Eagle's medium
- CAR-T cells prepared according to Example 2 were CTS complete media (CTS TM OpTmizer TM T Cell Expansion SFM (Gibco, A1048501), 2% (w/v) CTS TM Immune Cell SR (Gibco, A25961-01), Incubated in 1X GlutaMAX TM Supplement (Gibco, 35050-061) at 37° C., 5% CO 2 conditions.
- mucin1-expressing cells including T47D, HCC70, HCC1954, HEK293T-V1 (MUC1-C exogenously expressing cells), etc.
- mucin1 ratio Cell solubility for the expressing cells including HEK293T, HepG2, Huh7, SK-N-SH, etc.
- mucin 1 expressing or non-expressing target cells stained with CellTrace TM CFSE were aliquoted at 0.15-0.2 X 10 6 cells/150ul/well and cultured for one day.
- CAR-T cells stored frozen at -196°C were thawed and cultured for one day in CTS complete media containing 30U/ml IL-2 (Novartis, Proleukin) at a concentration of 2 X 10 6 cells/ml. .
- CTS complete media containing 30U/ml IL-2 (Novartis, Proleukin) at a concentration of 2 X 10 6 cells/ml.
- the CAR expression rate of CAR-T cells in culture was measured using Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097) and APC Mouse Anti-Human CD3 ( It was stained with BD Pharmingen TM , 561811) and the ratio of both were positive through flow cytometry (FACS, flow cytometer).
- each type of CAR-T (E, effector cells), adjusted to have the same number of CAR+ T cells, was cultured the previous day in a volume of 100ul/well with the cell culture medium of each target cell.
- CFSE-stained Mucin1 expression was added in proportion to the number of non-expressing cells (T, target cells). Incubated at 37° C., 5% CO 2 conditions from 5 hours to 24 hours depending on the target cells. Then, both CAR-T cells and target cells were taken and stained with Fixable Viability Dye eFluor TM 450 (eBioscience TM , 65-0863-18) and APC Mouse Anti-Human CD3 to determine the number of viable target cells through flow cytometry. At this time, the number of viable target cells was defined as Fixable Viability Dye negative and CFSE positive cells. The killing activity (%) was calculated as follows:
- FIGS. 4 to 8 The results are shown in FIGS. 4 to 8 .
- G03 is a positive control, and a group in which no CAR is injected (NO LV) was used as a negative control.
- NO LV no CAR is injected
- these figures are graphs showing results representatively of independent experiments using a total of two T cell derivations, and were named Donor 03 and Donor 04 according to the origin of T cells. 4 to 8 , the tested immune cells showed cytotoxicity to mucin1-expressing cells.
- FIGS. 9 and 10 are the results of a cytotoxicity test for CAR-T cells prepared using Donor 05 and Donor 06-derived T cells, a human breast cancer cell line T47D, respectively, and FIG. 11 shows Donor 07-derived T cells.
- HCC70 breast cancer cell line
- MCF10A human normal breast cell line
- CAR-T cells Donor 05-derived T cells expressing CAR containing 2447_2H08 scFv
- IL-2 Novartis , Proleukin
- CAR CAR with 2447_2H08 scFv
- expression rate of CAR was measured using Alexa Fluor 488-AffiniPure Goat Anti-Human IgG, F(ab')2 Fragment Specific (Jackson laboratory, 109-545-097) and APC Mouse Anti-Human CD3 (BD PharmingenTM, 561811), and both were obtained at a positive rate through flow cytometry (FACS, flow cytometer).
- each type of CAR-T (E, effector cells), adjusted to have the same number of CAR+ T cells, was used in a cell culture medium of each target cell in a volume of 100 ul/well to express CFSE-stained Mucin 1 cultured the previous day. Alternatively, it was added in proportion to the number of non-expressing cells (T, target cells).
- T target cells
- the target cells were cultured for 24 hours at 37° C., 5% CO 2 condition. Then, both CAR-T cells and target cells were taken and stained with Fixable Viability Dye eFluorTM 450 (eBioscienceTM, 65-0863-18) and APC Mouse Anti-Human CD3 to determine the number of viable target cells through flow cytometry.
- the number of viable target cells was defined as Fixable Viability Dye-negative, CFSE-positive cells (strong CFSE signal for HCC70, weak CFSE signal for MCF10A). Calculation of titer (killing activity, %) was performed in the same manner as in Example 5.
- FIGS. 13 and 14 The results are shown in FIGS. 13 and 14 .
- a group in which no CAR was injected (mock T cells) was used as a negative control group.
- CAR-T cells having 2447_2H08 scFv (indicated as #2-CAR-T in the figure, respectively) exhibited apoptotic ability against mucin1 overexpressing breast cancer cells (HCC70).
- HCC70 mucin1 overexpressing breast cancer cells
- MCF10A normal breast cell line
- Example 7 Analysis of anticancer efficacy of CAR-T cells using an animal model
- PANC1-v1 cells PANC1 pancreatic cancer cells expressing MUC1
- sc subcutaneously
- iv intravenous
- T cells donor 18-09-derived T cells expressing scFv-containing CAR according to the present disclosure
- hCD45+ cells The number of human immune cells
- the size of the tumor initially increased, but gradually decreased after about 10 days, and after 30 days, the size of the tumor became so small that it was difficult to measure.
- HCC1954 cells a breast cancer cell line that naturally expresses MUC1
- sc subcutaneously
- sc tumor volume reached 500 mm 3 (23 days after cell administration)
- 0.1 X 10 6 of anti-MUC1 CAR-T cells Donor 20-01-derived T cells expressing scFv-containing CAR according to the present disclosure
- iv intravenously
- PBS Vehicle
- T cells that do not express CAR Control T cells
- the size of the tumor which was 500 mm 3
- the size of the tumor which was 500 mm 3
- the number of hCD45+ cells in the mouse blood showed an increasing pattern and gradually decreased after about 25 days. It seems that CAR-T cells are activated and proliferate after recognizing the antigen, thereby increasing the number of cells in the blood.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Wood Science & Technology (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
Abstract
Description
클론명 | CDR | |||||
VH | VL | |||||
CDR1 | CDR2 | CDR3 | CDR1 | CDR2 | CDR3 | |
2445_1F09 | GFTVSSNY (서열번호 1) |
IYSGGST (서열번호 2) |
DRGWNHGMDV (서열번호 3) |
SSEVGSRY (서열번호 4) |
KND (서열번호 5) |
AAWDDSLNGYV (서열번호 6) |
2447_2H08 | GYTFTNYG(서열번호 11) | ISAYNGNT (서열번호 12) |
DPHILTGYYRGGWFDP (서열번호 13) |
SLRTSY (서열번호 14) |
GKT (서열번호 15) |
HSRDSNDNYLEVV (서열번호 16) |
2447_3A01 | GFTFDDYA(서열번호 21) | ISWNSGSI (서열번호 22) |
DISSGWYPGTFDY (서열번호 23) |
SLRSYY (서열번호 24) |
GKN (서열번호 25) |
SSRDSSDDVV (서열번호 26) |
2447_3A08 | GYTFTSYG(서열번호 31) | ISAYNGNT (서열번호 32) |
DRATIFGVVTPFDY (서열번호 33) |
SIRSYS (서열번호 34) |
GKN (서열번호 35) |
NSRDSSGNRVV (서열번호 36) |
2447_3A09 | GFTFDDYA(서열번호 41) | ISWNSGSI (서열번호 42) |
DVSSGWYWYAFDI (서열번호 43) |
SLRSYY (서열번호 44) |
GKN (서열번호 45) |
NSRDSGGSVV (서열번호 46) |
2447_3A12 | GYTFTSYG(서열번호 51) | ISAYNGNT (서열번호 52) |
DPHILTGYYRGGWFDP (서열번호 53) |
SLRSYY (서열번호 54) |
GKN (서열번호 55) |
NSRDSSGNHRV (서열번호 56) |
2447_3B07 | GFTFDDYA(서열번호 61) | TSWDGGST (서열번호 62) |
DHSSGWYNGGMDV (서열번호 63) |
SLRSYY (서열번호 64) |
GKN (서열번호 65) |
NSRDSSGNHVV (서열번호 66) |
2447_3C08 | GFTFDDYA(서열번호 71) | ISWNSGSI (서열번호 72) |
DRGSGYEGNYYGMDV (서열번호 73) |
SLRSYY (서열번호 74) |
GKN (서열번호 75) |
NSRDSSGNHYV (서열번호 76) |
2447_3H02 | GFTFDDYA(서열번호 81) | ISWDSGSI (서열번호 82) |
DVSSGWYWYAFDI (서열번호 83) |
ILRSYY (서열번호 84) |
GKN (서열번호 85) |
NSRDSSGNRVV (서열번호 86) |
2447_3H08 | GFTFDDYA(서열번호 91) | ISWNSGSI (서열번호 92) |
DRSSGWYTGSFDY (서열번호 93) |
SLRSYY (서열번호 94) |
GKN (서열번호 95) |
QSRDSSDNRVL (서열번호 96) |
클론명 | VH | VL |
2445_1F09 | EVQLLETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGWNHGMDVWGQGTLVTVSS (서열번호 7) | QSGLTQPPSASGTPGQRVTISCSGGSSEVGSRYVSWYQQLPGTAPRLLIYKNDRRPSGVPDRFSGSKSGSSASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKLTVL (서열번호 8) |
2447_2H08 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTTVTVSS (서열번호 17) | SYELTQDPAVSVALGQTVTITCQGDSLRTSYAGWLQQKPGQAPVLVLYGKTSRPSGIPDRFSGSTSGNTASLTITGAQAEDEAEYFCHSRDSNDNYLEVVFGGGTKLTVL (서열번호 18) |
2447_3A01 | EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIVYADFVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDISSGWYPGTFDYWGQGTLVTVSS (서열번호 27) | SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTVTGAQAEDEADYYCSSRDSSDDVVFGGGTQLTVL (서열번호 28) |
2447_3A08 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDRATIFGVVTPFDYWGQGTLVTVSS (서열번호 37) | SYELTQDPAVSVALGQTVRITCQGDSIRSYSASWYQQKPGQAPRLVIYGKNNRPSGIPDRVSGSTSGNTASLTVTGAQAEDEADYYCNSRDSSGNRVVFGGGTQLTVL (서열번호 38) |
2447_3A09 | EVQLLESGGGLVQPGRSLRLSCAATGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTASYYCAKDVSSGWYWYAFDIWGQGTLVTVSS (서열번호 47) | SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPGRFSGSSSGNTASLTVTGAQAEDEADYYCNSRDSGGSVVFGGGTKLTVL (서열번호 48) |
2447_3A12 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLRGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTLVTVSS (서열번호 57) | SYELTQDPAVSVVLGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHRVFGGGTKLTVL (서열번호 58) |
2447_3B07 | QVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSLTSWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKDHSSGWYNGGMDVWGQGTMVTVSS (서열번호 67) | SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL (서열번호 68) |
2447_3C08 | EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDRGSGYEGNYYGMDVWGQGTLVTVSS (서열번호 77) | SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGTTSGNTASLTITGAQAEDEADYYCNSRDSSGNHYVFGTGTKVTVL (서열번호 78) |
2447_3H02 | EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDVSSGWYWYAFDIWGQGTLVTVSS (서열번호 87) | SYELTQDPAVSVALGQTVRITCQGDILRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNRVVFGGGTKLTVL (서열번호 88) |
2447_3H08 | EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSSGWYTGSFDYWGQGTLVTVSS (서열번호 97) | SYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYRQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTIIGAQAEDEADYYCQSRDSSDNRVLFGGGTKVTVL (서열번호 98) |
클론명 | scFv 아미노산 서열 |
2445_1F09 | EVQLLETGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRGWNHGMDVWGQGTLVTVSSGGGGSGGGGSGGGASQSGLTQPPSASGTPGQRVTISCSGGSSEVGSRYVSWYQQLPGTAPRLLIYKNDRRPSGVPDRFSGSKSGSSASLAISGLRSEDEADYYCAAWDDSLNGYVFGTGTKLTVL (서열번호 9) |
2447_2H08 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTTVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVTITCQGDSLRTSYAGWLQQKPGQAPVLVLYGKTSRPSGIPDRFSGSTSGNTASLTITGAQAEDEAEYFCHSRDSNDNYLEVVFGGGTKLTVL (서열번호 19) |
2447_3A01 | EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIVYADFVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDISSGWYPGTFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTVTGAQAEDEADYYCSSRDSSDDVVFGGGTQLTVL (서열번호 29) |
2447_3A08 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDRATIFGVVTPFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSIRSYSASWYQQKPGQAPRLVIYGKNNRPSGIPDRVSGSTSGNTASLTVTGAQAEDEADYYCNSRDSSGNRVVFGGGTQLTVL (서열번호 39) |
2447_3A09 | EVQLLESGGGLVQPGRSLRLSCAATGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTASYYCAKDVSSGWYWYAFDIWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPGRFSGSSSGNTASLTVTGAQAEDEADYYCNSRDSGGSVVFGGGTKLTVL (서열번호 49) |
2447_3A12 | EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLRGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDPHILTGYYRGGWFDPWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVVLGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHRVFGGGTKLTVL (서열번호 59) |
2447_3B07 | QVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSLTSWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCAKDHSSGWYNGGMDVWGQGTMVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVL (서열번호 69) |
2447_3C08 | EVQLLESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDRGSGYEGNYYGMDVWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGTTSGNTASLTITGAQAEDEADYYCNSRDSSGNHYVFGTGTKVTVL (서열번호 79) |
2447_3H02 | EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWDSGSIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKDVSSGWYWYAFDIWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDILRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNRVVFGGGTKLTVL (서열번호 89) |
2447_3H08 | EVQLLESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRSSGWYTGSFDYWGQGTLVTVSSGGGGSGGGGSGGGASSYELTQDPAVSVALGQTVRITCQGDSLRSYYASWYRQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTIIGAQAEDEADYYCQSRDSSDNRVLFGGGTKVTVL (서열번호 99) |
G03 | EVQLVQSGAEVKKPGATVKISCKVSGYTFTSYWMHWVQQAPGKGLEWIGYINPGTGYIEYNQKFKDRVTITADKSTDTAYMELSSLRSEDTAVYYCASSTAPFDYWGQGTLVTVSSGGGGSGGGGSGGGASEIVLTQSPGTLSLSPGERATLSCKASQDIKSYLSWYQQKPGQAPRLLIYYATRLADGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCLQYDESPYTFGQGTKLEIK (서열번호 109) |
클론명 | scFv 염기 서열 |
2445_1F09 | GAGGTGCAGCTGTTGGAGACTGGAGGAGGCTTGATCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGGTTCACCGTCAGTAGCAACTACATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGTTATTTATAGCGGTGGTAGCACATATTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTTCAAATGAACAGCCTGAGAGCCGAGGACACGGCCGTGTATTACTGTGCGAGAGATCGCGGCTGGAACCACGGTATGGACGTCTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCCAGTCTGGGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTTCTGGGGGCAGCTCAGAAGTCGGAAGTAGATATGTGTCCTGGTACCAGCAACTCCCAGGAACGGCCCCCAGACTCCTCATCTATAAGAATGATCGGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCTCCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTTATGTCTTCGGAACTGGGACCAAGCTGACCGTCCTA (서열번호 10) |
2447_2H08 | GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAACTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCCGCATATTTTGACTGGTTATTATAGGGGAGGGTGGTTCGACCCCTGGGGGCAAGGGACCACGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGTCAGACAGTCACCATCACGTGCCAAGGAGACAGCCTCAGAACCTCTTATGCAGGCTGGCTCCAGCAGAAGCCAGGACAGGCCCCTGTACTCGTCCTCTATGGTAAAACCAGCCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCACCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAGGATGAGGCTGAGTATTTCTGTCACTCCCGGGACAGCAATGATAACTATCTAGAGGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 20) |
2447_3A01 | GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGTCTATGCGGACTTTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATATTTCAAGTGGCTGGTACCCAGGGACCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGACGAGGCTGACTATTACTGTAGCTCCCGGGACAGCAGTGATGATGTGGTATTCGGCGGAGGGACCCAGCTCACCGTCCTA (서열번호 30) |
2447_3A08 | GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTACGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCGGGCTACGATTTTTGGAGTGGTTACCCCCTTTGACTACTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCCGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAGGGAGACAGTATTAGAAGTTATTCTGCCAGCTGGTACCAGCAGAAGCCAGGGCAGGCCCCTCGCCTTGTTATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGAGTCTCTGGCTCCACTTCAGGAAATACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCGTGTGGTATTCGGCGGAGGGACCCAGCTCACCGTCCTA (서열번호 40) |
2447_3A09 | GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCACTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTCGTATTACTGTGCAAAAGATGTTAGCAGTGGCTGGTACTGGTATGCTTTTGATATCTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGGCCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCGTCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAATTCCCGGGACAGCGGTGGTTCTGTGGTTTTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 50) |
2447_3A12 | GAAGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTATGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCGGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGATCCGCATATTTTGACTGGTTATTATAGGGGAGGGTGGTTCGACCCCTGGGGCCAGGGCACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGTCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATCGTGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 60) |
2447_3B07 | CAGGTGCAGCTGGTGGAGTCTGGGGGAGTCGTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGTCAAGCTCCGGGGAGGGGTCTGGAGTGGGTCTCTCTTACTAGTTGGGATGGTGGTAGCACATACTATGCAGACTCTGTGAAGGGTCGATTCACCATCTCCAGAGACAACAGCAAAAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACCGCCTTGTATTACTGTGCAAAAGATCATAGCAGCGGCTGGTACAACGGGGGTATGGACGTCTGGGGCCAAGGGACAATGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 70) |
2447_3C08 | GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATAGGGGTAGTGGCTACGAAGGAAACTACTACGGTATGGACGTCTGGGGCCAAGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGTACCACCTCAGGAAACACAGCCTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCATTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCTA (서열번호 80) |
2447_3H02 | GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGGATAGTGGTAGCATAGGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGCAAAAGATGTTAGCAGTGGCTGGTACTGGTATGCTTTTGATATCTGGGGCCAGGGAACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACATCCTCAGAAGTTATTATGCAAGTTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATTTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGAAACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCCGGGACAGCAGTGGTAACCGTGTGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA (서열번호 90) |
2447_3H08 | GAGGTGCAGCTGTTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTAGCATAGACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACAGCTGTGTACTACTGTGCGAGAGATCGGAGTAGTGGCTGGTACACGGGGTCCTTTGACTACTGGGGCCAGGGCACCCTGGTCACCGTCTCGAGTGGTGGAGGCGGTTCAGGCGGAGGTGGCTCTGGCGGTGGCGCTAGCTCCTATGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCCAAGGAGACAGCCTCAGAAGCTATTATGCAAGCTGGTACCGGCAGAAGCCAGGACAGGCCCCTGTACTTGTCATCTATGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCGGGAAACACAGCTTCCTTGACCATCATTGGGGCTCAGGCGGAAGACGAGGCTGACTATTACTGTCAGTCCCGGGACAGCAGTGATAACCGTGTTCTATTCGGCGGAGGGACCAAGGTCACCGTCCTA (서열번호 100) |
클론명 | KD (M) |
2447_2H08 | 94.8 x 10-9 |
2447_3A01 | 51.5 x 10-9 |
2447_3A08 | 320.3 x 10-9 |
2447_3A09 | 62.1 x 10-9 |
2447_3A12 | 13.8 x 10-9 |
2447_3B07 | 51.7 x 10-9 |
2447_3C08 | 24.0 x 10-9 |
2447_3H02 | 58.8 x 10-9 |
2447_3H08 | 39.9 x 10-9 |
G03 | 27.6 x 10-9 |
클론명 | EC50 (293T-v1) (ug/ml) | EC50 (T47D) (ug/ml) |
G03 | 3.46 | 3.56 |
2445_1F09 | 1.51x107 | 6.19x107 |
2447_3A01 | 4.78 | 11.14 |
2447_3A08 | 1.73 | 3.76 |
2447_3A09 | 1.96 | 2.2 |
2447_3A12 | 1.47 | 0.75 |
2447_3C08 | 1.38 | 2.04 |
2447_3H02 | 1.41 | 1.6 |
2447_3H08 | 2.57 | 5.6 |
2447_2H08 | 21.73 | 130.4 |
2447_3B07 | 3.86 | 3.47 |
Claims (25)
- 다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 뮤신1(Mucin1)에 결합하는 폴리펩티드:- 각각 서열번호 1, 서열번호 2 및 서열번호 3의 아미노산 서열로 기재되는상보성결정영역(CDR) 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 4, 서열번호 5 및 서열번호 6의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 11, 서열번호 12 및 서열번호 13의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 14, 서열번호 15 및 서열번호 16의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 21, 서열번호 22 및 서열번호 23의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 24, 서열번호 25 및 서열번호 26의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 31, 서열번호 32 및 서열번호 33의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 44, 서열번호 45 및 서열번호 46의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 51, 서열번호 52 및 서열번호 53의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 54, 서열번호 55 및 서열번호 56의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 61, 서열번호 62 및 서열번호 63의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 64, 서열번호 65 및 서열번호 66의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 71, 서열번호 72 및 서열번호 73의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 74, 서열번호 75 및 서열번호 76의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역;- 각각 서열번호 81, 서열번호 82 및 서열번호 83의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 84, 서열번호 85 및 서열번호 86의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역; 및- 각각 서열번호 91, 서열번호 92 및 서열번호 93의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VH 영역, 및 각각 서열번호 94, 서열번호 95 및 서열번호 96의 아미노산 서열로 기재되는 CDR 1, 2 및 3을 포함하는 VL 영역.
- 제1항에 있어서,다음으로 이루어진 군에서 선택되는 중쇄 가변(VH) 영역 및 경쇄 가변(VL) 영역 쌍을 포함하는, 폴리펩티드:- 서열번호 7의 아미노산 서열을 포함하는 VH 영역 및 서열번호 8의 아미노산 서열을 포함하는 VL 영역;- 서열번호 17의 아미노산 서열을 포함하는 VH 영역 및 서열번호 18의 아미노산 서열을 포함하는 VL 영역;- 서열번호 27의 아미노산 서열을 포함하는 VH 영역 및 서열번호 28의 아미노산 서열을 포함하는 VL 영역;- 서열번호 37의 아미노산 서열을 포함하는 VH 영역 및 서열번호 38의 아미노산 서열을 포함하는 VL 영역;- 서열번호 47의 아미노산 서열을 포함하는 VH 영역 및 서열번호 48의 아미노산 서열을 포함하는 VL 영역;- 서열번호 57의 아미노산 서열을 포함하는 VH 영역 및 서열번호 58의 아미노산 서열을 포함하는 VL 영역;- 서열번호 67의 아미노산 서열을 포함하는 VH 영역 및 서열번호 68의 아미노산 서열을 포함하는 VL 영역;- 서열번호 77의 아미노산 서열을 포함하는 VH 영역 및 서열번호 78의 아미노산 서열을 포함하는 VL 영역;- 서열번호 87의 아미노산 서열을 포함하는 VH 영역 및 서열번호 88의 아미노산 서열을 포함하는 VL 영역; 및- 서열번호 97의 아미노산 서열을 포함하는 VH 영역 및 서열번호 98의 아미노산 서열을 포함하는 VL 영역.
- 제1항에 있어서,항체 또는 이의 항원 결합 단편인, 폴리펩티드.
- 제1항에 있어서,scFv (single chain variable fragment), 펩티바디, Fab (fragment antigen binding), 단일클론 항체, 이중특이성 항체, 미니바디, 도메인 항체, 합성 항체, 키메라 항체, 인간화 항체, 인간 항체, 또는 항체 융합체 단백질인, 폴리펩티드.
- 제1항에 있어서,상기 VH 영역 및 상기 VL 영역이 링커에 의해 연결된 것인, 폴리펩티드.
- 제5항에 있어서,상기 링커의 아미노산 서열이 GGGGSGGGGSGGGAS 인, 폴리펩티드.
- 제1항에 있어서,서열번호 9, 서열번호 19, 서열번호 29, 서열번호 39, 서열번호 49, 서열번호 59, 서열번호 69, 서열번호 79, 서열번호 89 및 서열번호 99로 이루어진 군에서 선택되는 아미노산 서열을 포함하는 scFv인, 폴리펩티드.
- 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드.
- 제8항의 폴리뉴클레오티드를 포함하는 벡터.
- 제9항의 벡터를 포함하는 세포.
- 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 포함하는, 키메라 항원 수용체 (chimeric antigen receptor).
- 제11항에 있어서,상기 뮤신1-결합 폴리펩티드를 포함하는 세포외 도메인; 막관통 도메인; 및 세포내 신호 전달 도메인을 포함하는, 키메라 항원 수용체.
- 제12항에 있어서,상기 세포외 도메인은 상기 뮤신1-결합 폴리펩티드와 막관통 도메인 사이에 스페이서 영역을 추가로 포함하는, 키메라 항원 수용체.
- 제13항에 있어서,상기 스페이서가 CD8α 또는 CD28의 힌지 부위, 또는 면역글로불린 (IgG)의 불변영역의 전부 또는 일부를 포함하는 것인, 키메라 항원 수용체.
- 제12항에 있어서,상기 막관통 도메인이 CD28 또는 CD8의 막관통 도메인인, 키메라 항원 수용체.
- 제12항에 있어서,상기 세포내 신호 전달 도메인이 CD3 제타 신호전달 도메인인, 키메라 항원 수용체.
- 제12항에 있어서,1개 이상의 공동자극 도메인(co-stimulatory domain)을 더욱 포함하는, 키메라 항원 수용체.
- 제17항에 있어서,공동자극 도메인이 막관통 도메인과 세포내 신호 전달 도메인 사이에 위치한 것인, 키메라 항원 수용체.
- 제17항에 있어서,공동자극 도메인이 CD28, OX-40, 4-1BB (CD137), CD27 또는 ICOS의 신호전달 도메인인, 키메라 항원 수용체.
- 제11항의 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드.
- 제20항의 폴리뉴클레오티드를 포함하는 벡터.
- 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체를 발현하거나, 상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는, 면역 세포.
- 제22항에 있어서,T 세포, 종양 침윤 림프구 (TIL), NK (Natural killer) 세포, TCR-발현 세포, 수지상 세포, 또는 NK-T 세포인, 면역 세포.
- 제22항에 있어서,자가 T 세포 또는 동종 T 세포인, 면역 세포.
- 제1항 내지 제7항 중 어느 한 항의 뮤신1-결합 폴리펩티드;상기 뮤신1-결합 폴리펩티드를 코딩하는 단리된 폴리뉴클레오티드;상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 벡터;상기 뮤신1-결합 폴리펩티드를 코딩하는 폴리뉴클레오티드를 포함하는 세포;상기 뮤신1-결합 폴리펩티드를 포함하는 키메라 항원 수용체;상기 키메라 항원 수용체를 코딩하는 단리된 폴리뉴클레오티드;상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터; 또는상기 키메라 항원 수용체를 코딩하는 폴리뉴클레오티드를 포함하거나 상기 키메라 항원 수용체를 발현하는 면역 세포를 포함하는,암의 예방 또는 치료용 조성물.
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
MX2023007665A MX2023007665A (es) | 2020-12-24 | 2021-12-24 | Polipeptido especifico para mucina 1 y uso del mismo. |
PE2023001953A PE20240117A1 (es) | 2020-12-24 | 2021-12-24 | Polipeptido especifico para mucina 1 y sus usos |
EP21911602.7A EP4265640A2 (en) | 2020-12-24 | 2021-12-24 | Polypeptide specific for mucin 1 and use thereof |
CA3203067A CA3203067A1 (en) | 2020-12-24 | 2021-12-24 | Polypeptide specific for mucin 1 and use thereof |
AU2021410416A AU2021410416A1 (en) | 2020-12-24 | 2021-12-24 | Polypeptide specific for mucin 1 and use thereof |
CN202180086168.7A CN116670162A (zh) | 2020-12-24 | 2021-12-24 | 粘蛋白1特异性多肽及其用途 |
IL303902A IL303902A (en) | 2020-12-24 | 2021-12-24 | MUCIN 1-specific polypeptide and its use |
JP2023539197A JP2024503803A (ja) | 2020-12-24 | 2021-12-24 | ムチン1に特異的なポリペプチドおよびその利用 |
CONC2023/0009764A CO2023009764A2 (es) | 2020-12-24 | 2023-07-24 | Polipéptido específico para mucina 1 y sus usos |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20200183768 | 2020-12-24 | ||
KR10-2020-0183768 | 2020-12-24 | ||
KR20210137757 | 2021-10-15 | ||
KR10-2021-0137757 | 2021-10-15 |
Publications (4)
Publication Number | Publication Date |
---|---|
WO2022139537A2 true WO2022139537A2 (ko) | 2022-06-30 |
WO2022139537A3 WO2022139537A3 (ko) | 2022-09-09 |
WO2022139537A4 WO2022139537A4 (ko) | 2022-10-06 |
WO2022139537A9 WO2022139537A9 (ko) | 2022-11-17 |
Family
ID=82159981
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2021/019790 WO2022139537A2 (ko) | 2020-12-24 | 2021-12-24 | 뮤신 1에 특이적인 폴리펩티드 및 이의 이용 |
Country Status (12)
Country | Link |
---|---|
EP (1) | EP4265640A2 (ko) |
JP (1) | JP2024503803A (ko) |
KR (1) | KR20220092432A (ko) |
AU (1) | AU2021410416A1 (ko) |
CA (1) | CA3203067A1 (ko) |
CL (1) | CL2023001873A1 (ko) |
CO (1) | CO2023009764A2 (ko) |
IL (1) | IL303902A (ko) |
MX (1) | MX2023007665A (ko) |
PE (1) | PE20240117A1 (ko) |
TW (1) | TW202233667A (ko) |
WO (1) | WO2022139537A2 (ko) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018174544A2 (ko) | 2017-03-21 | 2018-09-27 | 주식회사 펩트론 | Muc1에 특이적으로 결합하는 항체 및 그의 용도 |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20020146750A1 (en) * | 2000-03-30 | 2002-10-10 | Hoogenboom Hendricus R.J.M. | Mucin-1 specific binding members and methods of use thereof |
US10208125B2 (en) * | 2013-07-15 | 2019-02-19 | University of Pittsburgh—of the Commonwealth System of Higher Education | Anti-mucin 1 binding agents and uses thereof |
DK3543337T3 (da) | 2016-11-18 | 2022-05-09 | Astellas Pharma Inc | Hidtil ukendt fab-fragment af et anti-humant muc1-antistof |
RU2746413C1 (ru) * | 2017-03-21 | 2021-04-13 | Пептрон, Инк. | Антитело, специфически связывающееся с muc1, и его применение |
-
2021
- 2021-12-23 KR KR1020210186471A patent/KR20220092432A/ko unknown
- 2021-12-24 AU AU2021410416A patent/AU2021410416A1/en active Pending
- 2021-12-24 WO PCT/KR2021/019790 patent/WO2022139537A2/ko active Application Filing
- 2021-12-24 CA CA3203067A patent/CA3203067A1/en active Pending
- 2021-12-24 PE PE2023001953A patent/PE20240117A1/es unknown
- 2021-12-24 TW TW110148778A patent/TW202233667A/zh unknown
- 2021-12-24 IL IL303902A patent/IL303902A/en unknown
- 2021-12-24 MX MX2023007665A patent/MX2023007665A/es unknown
- 2021-12-24 EP EP21911602.7A patent/EP4265640A2/en active Pending
- 2021-12-24 JP JP2023539197A patent/JP2024503803A/ja active Pending
-
2023
- 2023-06-22 CL CL2023001873A patent/CL2023001873A1/es unknown
- 2023-07-24 CO CONC2023/0009764A patent/CO2023009764A2/es unknown
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018174544A2 (ko) | 2017-03-21 | 2018-09-27 | 주식회사 펩트론 | Muc1에 특이적으로 결합하는 항체 및 그의 용도 |
Also Published As
Publication number | Publication date |
---|---|
TW202233667A (zh) | 2022-09-01 |
KR20220092432A (ko) | 2022-07-01 |
CA3203067A1 (en) | 2022-06-30 |
EP4265640A2 (en) | 2023-10-25 |
MX2023007665A (es) | 2023-07-07 |
WO2022139537A3 (ko) | 2022-09-09 |
PE20240117A1 (es) | 2024-01-22 |
CL2023001873A1 (es) | 2024-01-26 |
AU2021410416A1 (en) | 2023-08-10 |
JP2024503803A (ja) | 2024-01-29 |
WO2022139537A4 (ko) | 2022-10-06 |
IL303902A (en) | 2023-08-01 |
WO2022139537A9 (ko) | 2022-11-17 |
CO2023009764A2 (es) | 2023-09-08 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2019098682A1 (ko) | 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체 | |
WO2019225787A1 (ko) | 항-b7-h3 항체 및 그 용도 | |
TW201805306A (zh) | 包含tnf家族配位三聚體及pd1結合部份之抗原結合分子 | |
WO2015058573A1 (zh) | 拮抗抑制程序性死亡受体pd-1与其配体结合的单克隆抗体及其编码序列与用途 | |
WO2015133817A1 (ko) | B 세포 림프종 세포를 특이적으로 인지하는 단일클론항체 및 이의 용도 | |
WO2021006619A1 (ko) | B7-h3에 특이적으로 결합하는 항체 및 그의 용도 | |
WO2019112347A2 (ko) | 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도 | |
WO2014025198A2 (ko) | Lfa3 변이체 및 상기 변이체 또는 lfa3 cd2 결합영역과 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도 | |
WO2018222019A1 (ko) | 신규한 항-cd40 항체 및 이의 용도 | |
WO2021235696A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2019155408A1 (en) | Anti-pd-1/anti-her2 natural antibody structural heterodimeric bispecific antibody and method of preparing same | |
WO2023277361A1 (ko) | 메소텔린 특이적 항체 및 이의 용도 | |
WO2021210939A1 (ko) | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 | |
WO2021060914A1 (ko) | 항-클라우딘-3 키메라 항원 수용체 | |
WO2022139537A2 (ko) | 뮤신 1에 특이적인 폴리펩티드 및 이의 이용 | |
WO2021235697A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2021182929A1 (ko) | Bcma에 특이적인 항체 및 키메라 항원 수용체 | |
WO2022124866A1 (ko) | 항-pd-1 항체 및 이의 용도 | |
WO2022216079A1 (ko) | Gucy2c 결합 폴리펩타이드 및 그의 용도 | |
WO2021246637A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2024101962A1 (ko) | 유전자 조작된 세포 및 이의 용도 | |
WO2022181992A1 (ko) | Cd22에 특이적인 인간화 항체 및 이의 용도 | |
WO2024101942A1 (ko) | 유전자 조작된 세포 및 이의 용도 | |
WO2022169269A1 (ko) | 항 ctla-4 항체 및 이의 용도 | |
WO2024010118A1 (ko) | 항 bdca-2 항체 및 이의 용도 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21911602 Country of ref document: EP Kind code of ref document: A2 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 202180086168.7 Country of ref document: CN |
|
ENP | Entry into the national phase |
Ref document number: 3203067 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 001953-2023 Country of ref document: PE |
|
WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/007665 Country of ref document: MX |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2023539197 Country of ref document: JP |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023012713 Country of ref document: BR |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2021911602 Country of ref document: EP Effective date: 20230721 |
|
ENP | Entry into the national phase |
Ref document number: 2021410416 Country of ref document: AU Date of ref document: 20211224 Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 112023012713 Country of ref document: BR Kind code of ref document: A2 Effective date: 20230623 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 523441314 Country of ref document: SA |