WO2022124282A1 - Prame結合性分子 - Google Patents
Prame結合性分子 Download PDFInfo
- Publication number
- WO2022124282A1 WO2022124282A1 PCT/JP2021/044807 JP2021044807W WO2022124282A1 WO 2022124282 A1 WO2022124282 A1 WO 2022124282A1 JP 2021044807 W JP2021044807 W JP 2021044807W WO 2022124282 A1 WO2022124282 A1 WO 2022124282A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- prame
- amino acid
- cells
- seq
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4271—Melanoma antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/32—T-cell receptors [TCR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4267—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K40/427—PRAME
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3053—Skin, nerves, brain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- C—CHEMISTRY; METALLURGY
- C40—COMBINATORIAL TECHNOLOGY
- C40B—COMBINATORIAL CHEMISTRY; LIBRARIES, e.g. CHEMICAL LIBRARIES
- C40B40/00—Libraries per se, e.g. arrays, mixtures
- C40B40/04—Libraries containing only organic compounds
- C40B40/10—Libraries containing peptides or polypeptides, or derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/57—Skin; melanoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/10041—Use of virus, viral particle or viral elements as a vector
- C12N2740/10043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/13011—Gammaretrovirus, e.g. murine leukeamia virus
- C12N2740/13041—Use of virus, viral particle or viral elements as a vector
- C12N2740/13043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- the present invention relates to PRAME-binding molecules and the like.
- PRAME Preferentially Expressed Antigen in Melanoma
- PRAME is known to be a cancer testis antigen, and in normal adult tissues, it is only slightly expressed in the endometrium, ovary, and adrenal gland in addition to the testis.
- Known cancers that highly express PRAME include melanoma (95% of patients), lung cancer (50%), breast cancer (27%), acute leukemia (30%), and multiple myeloma (52%).
- Bone marrow Non-Patent Documents 1, 2, 3) is attracting attention as a target for cancer treatment. As the target peptides, p100-108, p142-151, p300-309, p425-433, p435-443, etc.
- T cells that recognize pMHC have been cloned, and T cell receptors (TCRs) have been isolated and their functions have been analyzed (Non-Patent Documents 4, 5, 6), but so far they can be used for cancer treatment. TCR has not been isolated.
- PRAME a gene encoding an antigen recognized melanoma by cytolytic T cells, is expressed inacute leukemia cells.
- An object of the present invention is to provide a PRAME-binding molecule.
- the present inventor attempted to isolate an antibody that recognizes the HLA-A24 PRAMEp301-309pMHC complex and to prepare a CAR using it.
- the present inventor includes a heavy chain CDR1 containing the amino acid sequence shown in SEQ ID NO: 1, a heavy chain CDR2 containing the amino acid sequence shown in SEQ ID NO: 2, and an amino acid sequence shown in SEQ ID NO: 3.
- light chain CDR2 containing the amino acid sequence set forth in SEQ ID NO: 10
- the present invention includes the following aspects.
- a light chain variable region containing a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 9 a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 10
- a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 11.
- a PRAME-binding molecule including.
- Item 2 The PRAME-binding molecule according to Item 1, which comprises the heavy chain variable region and the light chain variable region.
- Item 3 The PRAME-binding molecule according to Item 1 or 2, which has a binding property to the HLA-A24 PRAMEp301-309pMHC complex.
- Item 4 Peptide consisting of the amino acid sequence shown in SEQ ID NO: 19, peptide consisting of the amino acid sequence shown in SEQ ID NO: 20, peptide consisting of the amino acid sequence shown in SEQ ID NO: 21, peptide consisting of the amino acid sequence shown in SEQ ID NO: 23, SEQ ID NO:
- the binding property to the peptide consisting of the amino acid sequence shown in 24, the peptide consisting of the amino acid sequence shown in SEQ ID NO: 25, and the peptide consisting of the amino acid sequence shown in SEQ ID NO: 26 is the peptide consisting of the amino acid sequence shown in SEQ ID NO: 17.
- the PRAME-binding molecule according to any one of Items 1 to 3, which is 1/2 or less of the binding property to.
- Item 5 The PRAME-binding molecule according to any one of Items 1 to 4, which is a chimeric antigen receptor.
- Item 6 The PRAME-binding molecule according to Item 5, which comprises the heavy chain variable region and the scFv domain including the light chain variable region, the transmembrane domain, and the core region containing the intracellular domain of TCR.
- Item 7 The PRAME-binding molecule according to Item 6, wherein the core region further contains an intracellular domain of a co-stimulator.
- Item 8. The PRAME-binding molecule according to any one of Items 1 to 4, which is an antibody.
- Item 9 A polynucleotide encoding the PRAME-binding molecule according to any one of Items 1 to 8.
- Item 10 A cell containing the polynucleotide according to Item 9.
- Item 11 A lymphocyte cell containing a polynucleotide encoding the PRAME-binding molecule according to any one of Items 5 to 7.
- Item 12. A pharmaceutical composition containing the lymphocyte cell according to Item 11 or the PRAME-binding molecule according to Item 8.
- Item 13 The pharmaceutical composition according to Item 12, which is used for diagnosing, treating or preventing cancer.
- a PRAME-binding molecule can be provided.
- the PRAME-binding molecule of the present invention has a specific CDR sequence, and therefore has excellent binding property to PRAME, and exhibits an excellent anticancer effect particularly when used as a chimeric antigen receptor. Can be done.
- a schematic diagram of the antibody library screen method (magnet bead screen method) is shown (Test Example 1). An artificially prepared HLA-A24 PRAMEp301-309 was bound to Dynabeads MyOne Streptavidin T1 (Invitrogen), and a human antibody library was reacted with this to concentrate antibody clones.
- a schematic diagram of the antibody library screen method (cell screen) is shown (Test Example 1). For the polyclone antibody clone obtained by the method of FIG. 1a, T2A24 cells peptide-pulsed with PRAME p301-309 were reacted, and the antibody clone was divided into an aqueous layer and a cell pellet using an organic solvent to obtain an antibody clone bound to the cells. Sorted.
- the ELISA result of the antibody of each clone obtained in Test Example 1 is shown.
- the vertical axis shows the relative value of the color development intensity, and the horizontal axis shows the clone number.
- the results of an ELISA study of the recognition of various HLA-A24-related pMHCs for # 98 scFvCL-cp3 are shown (Test Example 1). It was confirmed that there was no reaction of 1.5 times or more of the background (none) with pMHC other than PRAME.
- the vertical axis shows the relative value of the color development intensity, and the horizontal axis shows the HLA-A24 related pMHC used.
- the affinity measurement result by the SPR method for # 98 is shown (Test Example 3).
- a schematic diagram of a CAR-introduced retrovirus vector is shown (Test Example 4).
- the FACS results of CAR-non-introduced cells are shown (Test Example 4).
- the FACS results of CAR-introduced cells are shown (Test Example 4).
- the results of alanine substitution studies on CAR-introduced cells are shown (Test Example 5).
- the vertical axis shows the substitution site and the amino acid after substitution in the peptide used, and the horizontal axis shows the IFN gamma concentration.
- the FACS results of IFNg-stained CAR-introduced cells are shown (Test Example 5).
- the vertical axis shows the IFNg positive rate, and the horizontal axis shows the PRAME p301-309 concentration in the peptide pulse.
- the results of PRAME expression analysis of the target cells of Test Examples 7 and 8 are shown.
- the vertical axis shows the relative value of the amount of PREME mRNA, and the horizontal axis shows the target cell.
- the results of HLA-A24 expression analysis of the target cells of Test Examples 7 and 8 are shown.
- the vertical axis shows the average fluorescence intensity for HLA-A24, and the horizontal axis shows the target cells.
- the measurement results of IFN gamma concentration by ELISA of Test Examples 7 and 8 are shown.
- the vertical axis shows the IFN gamma concentration, and the horizontal axis shows the target cells.
- NW-MEL-38 PRAME positive HLA-A24 negative
- the vertical axis shows the number of A24 NW-MEL-38 cells standardized with the number of NW-MEL-38 cells immediately before co-culturing with the effector cells as 1.
- the horizontal axis shows the elapsed time from the start of culture.
- the legend shows effector cells.
- the vertical axis shows the number of A24 NW-MEL-38 cells standardized with the number of NW-MEL-38 cells immediately before co-culturing with the effector cells as 1.
- the horizontal axis shows the elapsed time from the start of culture.
- the legend shows effector cells. The results of observing the index change due to xCelligence by allowing each effector cell to act on positive target cells (SK-MEL-124 cells (A24 + PRAME +)) are shown.
- the vertical axis shows the number of A24 NW-MEL-38 cells standardized with the number of NW-MEL-38 cells immediately before co-culturing with the effector cells as 1.
- the horizontal axis shows the elapsed time from the start of culture.
- the legend shows effector cells.
- Test Example 10 The test outline of Test Example 10 is shown.
- the measurement result of the tumor area of Test Example 10 is shown.
- the vertical axis shows the area of the tumor area, and the horizontal axis shows the number of days elapsed since SK-MEL-124 cell inoculation.
- the weight measurement result of Test Example 10 is shown.
- the vertical axis shows the relative value of body weight, and the horizontal axis shows the number of days elapsed since SK-MEL-124 cell inoculation.
- the test outline of Test Example 11 is shown.
- the measurement result of the tumor size of Test Example 11 is shown.
- the vertical axis shows the tumor size, and the horizontal axis shows the number of days elapsed since SK-MEL-124 cell inoculation (-10).
- the measurement result of the CAR-T cell ratio of Test Example 11 is shown.
- the vertical axis shows the percentage of CAR-T cells in peripheral blood, and the horizontal axis shows the number of days elapsed since SK-MEL-124 cell inoculation.
- the peptides, CMV, and DMSO shown in Table 2 are pulsed to T2A24, co-cultured with # 98 CAR-T cells, and the amount of IFNg secreted in the culture supernatant is shown by ELISA (Test Example 5).
- the vertical axis shows the amount of IFNg
- the horizontal axis shows the peptide used. In addition, e alone indicates only effector cells.
- Identity of amino acid sequences refers to the degree of coincidence of amino acid sequences with each other among two or more contrastable amino acid sequences. Therefore, the higher the match between two amino acid sequences, the higher the identity or similarity of those sequences.
- the level of amino acid sequence identity is determined, for example, using FASTA, a tool for sequence analysis, with default parameters.
- FASTA a tool for sequence analysis, with default parameters.
- the algorithm BLAST by Karlin and Altschul Karlin and Altschul (KarlinS, Altschul SF. “Methods for assessing the statistical signature of molecular sequence features by using general scoring schemes” Proc Natl Acad Sci USA.
- K It can be determined using "Applications and statistics for multiple high-scoring segments in molecular sequences.” Proc Natl Acad Sci USA. 90: 5873-7 (1993). A program called BLASTX based on such a BLAST algorithm has been developed. Specific methods for these analysis methods are known, and the National Center for Biotechnology Information (NCBI) website (http://www.ncbi.nlm.nih.gov/) can be referred to. The "identity" of the base sequence is also defined according to the above.
- conservative substitution means that an amino acid residue is replaced with an amino acid residue having a similar side chain. For example, substitution between amino acid residues having basic side chains such as lysine, arginine, and histidine is a conservative substitution.
- amino acid residues having acidic side chains such as aspartic acid and glutamic acid
- amino acid residues having non-charged polar side chains such as glycine, asparagine, glutamine, serine, threonine, tyrosine and cysteine
- Amino acid residues with non-polar side chains such as proline, phenylalanine, methionine and tryptophan
- amino acid residues with beta-branched side chains such as threonine, valine and isoleucine
- aromatic side chains such as tyrosine, phenylalanine, tryptophan and histidine Substitutions between amino acid residues are also conservative substitutions.
- CDR is an abbreviation for Complementarity Measuring Region and is also referred to as complementarity determining regions.
- the CDR is a region existing in the variable region of the immunoglobulin, and is a region deeply involved in the specific binding of the antibody to the antigen.
- the "light chain CDR” means a CDR existing in the light chain variable region of the immunoglobulin
- the “heavy chain CDR” means a CDR existing in the heavy chain variable region of the immunoglobulin.
- the "variable region” means an region including CDR1 to CDR3 (hereinafter, simply referred to as "CDRs1-3").
- CDRs1-3 CDR1 to CDR3
- the arrangement order of these CDRs1-3 is not particularly limited, but preferably, the frames are continuous or described later in the order of CDR1, CDR2, and CDR3 in the direction from the N-terminal side to the C-terminal side, or vice versa. It means a region arranged via another amino acid sequence called a work region (FR).
- the "heavy chain variable region” is a region in which the above-mentioned heavy chain CDRs1-3 is arranged, and the “light chain variable region” is a region in which the above-mentioned light chain CDRs1-3 is arranged.
- FR framework areas
- the region between the N-terminal of the variable region and the above CDR1 is FR1
- the region between CDR1 and CDR2 is FR2
- the region between CDR2 and CDR3 is FR3
- the region between CDR3 and the C-terminal of the variable region is Defined as FR4 respectively.
- the heavy chain CDR1 containing the amino acid sequence represented by SEQ ID NO: 1 the heavy chain CDR2 containing the amino acid sequence represented by SEQ ID NO: 2, and the amino acid sequence represented by SEQ ID NO: 3.
- a heavy chain variable region comprising a heavy chain CDR3 comprising, and / or a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 9, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 10, and represented by SEQ ID NO: 11.
- PRAME-binding molecule (which is also referred to herein as "the PRAME-binding molecule of the invention") comprising a light chain variable region comprising a light chain CDR3 comprising an amino acid sequence. This will be described below.
- the PRAME-binding molecule of the present invention is a heavy chain CDR1 containing the amino acid sequence represented by SEQ ID NO: 1, a heavy chain CDR2 containing the amino acid sequence represented by SEQ ID NO: 2, and a heavy chain containing the amino acid sequence represented by SEQ ID NO: 3.
- a heavy chain variable region comprising CDR3 and / or a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 9, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 10, and the amino acid sequence set forth in SEQ ID NO: 11.
- the molecule is not particularly limited as long as it contains a light chain variable region containing the light chain CDR3 and has a binding property to PRAME.
- the PRAME-binding molecule of the present invention may be a molecule composed of one kind of polypeptide or a molecule composed of a complex of two or more kinds of polypeptides. Further, the PRAME-binding molecule of the present invention may be a molecule composed of a polypeptide or a complex thereof, or another substance (for example, a fluorescent substance, a radioactive substance, an inorganic particle, etc.) may be added to the polypeptide or the complex thereof. May be connected.
- the binding property to PRAME can be measured according to a known method, for example, by the ELISA method (specifically, for example, by the method of Test Example 2).
- the binding property of the PRAME-binding molecule of the present invention to PRAME is, for example, 20% or more, 50% or more, 70% or more, 80% with respect to 100% of the binding property of the # 98 antibody of the examples described below to PRAME. Above, 90% or more, 95% or more, 99% or more.
- the PRAME-binding molecule of the present invention preferably contains both the heavy chain variable region and the light chain variable region.
- the heavy chain variable region is preferably 90% or more (preferably 95% or more, preferably 98% or more, preferably 99%) with respect to the amino acid sequence shown in SEQ ID NO: 4 or the amino acid sequence shown in SEQ ID NO: 4. It is a heavy chain variable region containing an amino acid sequence having the same identity as above).
- the light chain variable region is preferably 90% or more (preferably 95% or more, preferably 98% or more, preferably 99%) with respect to the amino acid sequence shown by SEQ ID NO: 12 or the amino acid sequence shown by SEQ ID NO: 12. It is a light chain variable region containing an amino acid sequence having the same identity as above). If there is an amino acid mutation from SEQ ID NO: 4 or 12, the mutation is preferably an amino acid substitution, more preferably a conservative substitution of the amino acid.
- the PRAME-binding molecule of the present invention can have binding to the HLA-A24 PRAMEp301-309pMHC complex.
- the HLA-A24 PRAME p301-309 pMHC complex is a complex of HLA-A24 and a partial peptide of PRAME (p301-309: SEQ ID NO: 17).
- the aspect of the complex is an aspect in which HLA presents a peptide as an antigen, and is not particularly limited as long as this is the case.
- the PRAME-binding molecule of the present invention can specifically recognize PRAMEp301-309 (SEQ ID NO: 17).
- the PRAME-binding molecule of the present invention is a peptide consisting of a partial modification of PRAMEp301-309 (a peptide consisting of the amino acid sequence shown in SEQ ID NO: 19, a peptide consisting of the amino acid sequence shown in SEQ ID NO: 20, and a sequence.
- the binding property to at least one (preferably 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 (all)) of the amino acid sequence represented by 26 is PRAMEp301. -1/2 or less of binding to 309 (SEQ ID NO: 17) (preferably 1/5 or less, 1/10 or less, 1/20 or less, 1/100 or less, 1/500 or less, 1/2000 or less, 1 It is preferably / 10,000 or less).
- the PRAME-binding molecule of the present invention may be chemically modified.
- the polypeptide constituting the PRAME-binding molecule of the present invention may have a C-terminal of either a carboxyl group (-COOH), a carboxylate (-COO- ) , an amide (-CONH 2 ) or an ester (-COOR).
- R in the ester is, for example, a C 1-6 alkyl group such as methyl, ethyl, n-propyl, isopropyl, n-butyl; for example, a C 3-8 cycloalkyl group such as cyclopentyl, cyclohexyl; for example, phenyl.
- the polypeptide constituting the PRAME-binding molecule of the present invention may have a carboxyl group (or carboxylate) other than the C-terminal amidated or esterified.
- the ester in this case, for example, the above-mentioned C-terminal ester or the like is used.
- the amino group of the N-terminal amino acid residue is a protective group (for example, C 1-6 such as C 1-6 alkanoyl such as formyl group and acetyl group).
- an acyl group such as an acyl group
- those obtained by pyroglutamine oxidation of the N-terminal glutamine residue that can be cleaved and produced in vivo, and substituents on the side chain of amino acids in the molecule are protected by a suitable protective group (eg, C 1-6 acyl group such as C 1-6 alkanoyl group such as formyl group, acetyl group). What is included is also included.
- the PRAME-binding molecule of the present invention may be added with a protein or peptide such as a known protein tag or signal sequence.
- a protein tag include biotin, His tag, FLAG tag, Halo tag, MBP tag, HA tag, Myc tag, V5 tag, PA tag, fluorescent protein tag and the like.
- the PRAME-binding molecule of the present invention may be in the form of a pharmaceutically acceptable salt with an acid or base.
- the salt is not particularly limited as long as it is a pharmaceutically acceptable salt, and either an acidic salt or a basic salt can be adopted.
- acidic salts include inorganic acid salts such as hydrochloride, hydrobromide, sulfate, nitrate, and phosphate; acetate, propionate, tartrate, fumarate, maleate, and apple.
- Organic acid salts such as acid salts, citrates, methane sulfonates and paratoluene sulfonates; amino acid salts such as asparagates and glutamates can be mentioned.
- basic salts include alkali metal salts such as sodium salt and potassium salt; alkaline earth metal salts such as calcium salt and magnesium salt.
- the PRAME-binding molecule of the present invention may be in the form of a solvate.
- the solvent is not particularly limited as long as it is pharmaceutically acceptable, and examples thereof include water, ethanol, glycerol, acetic acid and the like.
- the PRAME-binding molecule of the present invention is, in a preferred embodiment, an antibody (in the present specification, the PRAME-binding molecule of the present invention, which is an antibody, may be referred to as "the antibody of the present invention").
- the antibody of the present invention is a monoclonal antibody.
- the molecular weight of the antibody of the present invention is not particularly limited, but the lower limit is, for example, 20,000, preferably 50,000, preferably 100,000, more preferably 120,000, and the upper limit is, for example, 1,000,000, preferably 500,000, more preferably 200,000. ..
- the structure of the antibody of the present invention is not particularly limited.
- the antibody of the present invention may contain a constant region or may not contain a constant region. When containing a constant region, it may include all of the constant regions of heavy chains (CH1, CH2, and CH3) and the constant regions of light chains (CL), and any one or more of them. May include a combination of.
- immunoglobulin examples include immunoglobulin, Fab, F (ab') 2 , minibody, scFv-Fc, Fv, scFv, diabody, triabody, and so on. Examples include a tetrabody. Among these, immunoglobulin is preferably mentioned from the viewpoint of the effect of the present invention.
- Immunoglobulin has a structure in which two structures consisting of one heavy chain having a heavy chain variable region and a heavy chain constant region and one light chain having a light chain variable region and a light chain constant region are combined.
- Fab includes a heavy chain fragment containing CH1 in a heavy chain variable region and a heavy chain constant region, and a light chain containing a light chain variable region and a light chain constant region (CL), and includes a heavy chain variable region and a light chain. It has a structure in which the chain variable region is associated with the above-mentioned non-covalent intermolecular interaction or is bound by a disulfide bond.
- CH1 and CL may have a disulfide bond between the thiol groups of the cysteine residues present in each.
- F (ab') 2 has two pairs of the above Fabs, and has a structure in which CH1s are disulfide-bonded to each other by thiol groups of cysteine residues contained therein.
- the minibody is a structure in which two fragments in which CH3 is bound to the heavy chain variable region constituting scFv below are associated with each other by non-covalent intermolecular interaction.
- scFv-Fc With scFv-Fc, the following two antibody fragments containing scFv, CH2, and CH3 are associated with each other by non-covalent intermolecular interaction between CH3s in the same manner as the above minibody, and the cysteine residue contained in each CH3. It is a structure in which thiol groups of groups are disulfide-bonded to each other.
- Fv is also called the smallest structural unit of an antibody, and is a structure in which heavy chain variable regions and light chain variable regions are associated by non-covalent intermolecular interactions.
- the thiol groups of the cysteine residue existing in the heavy chain variable region and the light chain variable region may be disulfide-bonded.
- scFv is a structure in which the C-terminal of the heavy chain variable region and the N-terminal of the light chain variable region are linked by a linker, or the N-terminal of the heavy chain variable region and the C-terminal of the light chain variable region are linked by a linker. It is a structure and is also called a single chain antibody.
- the above scFv forms a dimer, a trimer, and a tetramer, respectively, and like Fv, non-covalent intermolecular interactions between variable regions, etc. Therefore, it is a structurally stable structure.
- the antibody of the present invention is an immunoglobulin
- its class is not particularly limited.
- the class include IgA, IgD, IgE, IgG, IgM, and the like, as well as subclasses thereof.
- Preferred classes include, for example, IgG, IgM, etc., preferably IgG, and more preferably IgG1.
- the origin of the antibody of the present invention is not particularly limited.
- the antibody of the present invention may be, for example, a human-derived antibody, a mouse-derived antibody, a rat-derived antibody, a rabbit-derived antibody, a monkey-derived antibody, a chimpanzee-derived antibody, or the like.
- the antibody of the present invention is a chimeric antibody (for example, an antibody obtained by replacing the amino acid sequence of the constant region of an antibody derived from a non-human organism (mouse, etc.) with the amino acid sequence of the constant region of a human-derived antibody), a humanized antibody, and the like. It may be a fully humanized antibody or the like.
- the antibody of the present invention can be produced, for example, by a method including a step of culturing a host transformed with a polynucleotide encoding the antibody of the present invention and recovering a fraction containing the antibody of the present invention.
- the polynucleotide encoding the antibody of the present invention is not particularly limited as long as it contains the antibody of the present invention in an expressible state, and may contain other sequences in addition to the coding sequence of the antibody of the present invention. Examples of other sequences include a secretory signal peptide coding sequence, a promoter sequence, an enhancer sequence, a repressor sequence, an insulator sequence, a replication base point, a drug resistance gene coding sequence, etc., which are arranged adjacent to the antibody coding sequence of the present invention. Be done. Further, the polynucleotide encoding the antibody of the present invention may be a linear polynucleotide or a cyclic polynucleotide (vector or the like).
- polynucleotide examples include (I) a polynucleotide containing a base sequence encoding at least one selected from the group consisting of a heavy chain, a heavy chain variable region, and heavy chain CDRs1-3 of the antibody of the present invention. (II) A polynucleotide containing a base sequence encoding at least one selected from the group consisting of the light chain, the light chain variable region, and the light chain CDRs1-3 of the antibody of the present invention, (III) the antibody of the present invention.
- Examples thereof include a polynucleotide containing a base sequence encoding at least one selected from the group consisting of chain CDRs1-3.
- the host is not particularly limited, and examples thereof include insect cells, eukaryotic cells, and mammalian cells. Among them, from the viewpoint of more efficiently expressing the antibody, mammalian cells such as HEK cells, CHO cells, NS0 cells, SP2 / O cells, and P3U1 cells are preferable.
- mammalian cells such as HEK cells, CHO cells, NS0 cells, SP2 / O cells, and P3U1 cells are preferable.
- the transformation, culturing, and recovery methods are not particularly limited, and known methods for antibody production can be adopted. After recovery, the antibody of the present invention may be purified as needed. Purification can be performed by known methods in antibody production, such as chromatography, dialysis and the like.
- the PRAME-binding molecule of the present invention is, in a preferred embodiment, a chimeric antigen receptor (in the present specification, the PRAME-binding molecule of the present invention, which is a chimeric antigen receptor, is referred to as "chimeric of the present invention”. It may also be referred to as "antigen receptor").
- the chimeric antigen receptor is typically a single-chain antibody (scFv) in which a light chain (VL) and a heavy chain (VH) of a monoclonal antibody variable region are bound in series to determine the binding property to an antigen. It is a chimeric protein that has a T-cell receptor (TCR) ⁇ chain on the C-terminal side as a region to carry. T cells expressing CAR are called CAR-T cells.
- the region responsible for binding to the antigen is a heavy chain CDR1 containing the amino acid sequence represented by SEQ ID NO: 1 and the amino acid sequence represented by SEQ ID NO: 2.
- Heavy chain variable region containing heavy chain CDR2 containing heavy chain CDR2 and heavy chain CDR3 containing the amino acid sequence set forth in SEQ ID NO: 3 and / or light chain CDR1 containing the amino acid sequence set forth in SEQ ID NO: 9, amino acid set forth in SEQ ID NO: 10. It is not particularly limited as long as it includes a light chain variable region containing a light chain CDR2 containing a sequence and a light chain CDR3 containing the amino acid sequence set forth in SEQ ID NO: 11.
- the linker connecting the heavy chain variable region and the light chain variable region is not particularly limited as long as the function as a chimeric antigen receptor is maintained, and is arbitrary.
- Examples of the linker include glycine alone or a linker composed of glycine and serine.
- the number of amino acid residues of the linker is, for example, 5 to 30, preferably 10 to 20, and more preferably 15.
- the chimeric antigen receptor of the present invention usually contains a scFv domain containing a heavy chain variable region and a light chain variable region, a transmembrane domain, and a core region containing an intracellular domain of TCR.
- the scFv domain, the transmembrane domain, and the intracellular domain of the TCR are usually arranged in order from the N-terminal side, either directly or via other domains.
- transmembrane domain is not limited unless it inhibits the function of the chimeric antigen receptor.
- CD28, CD3zeta, CD4, CD8alpha, etc. expressed in T cells or the like can be used. Mutations may be appropriately introduced into these transmembrane domains as long as they do not inhibit the function of the chimeric antigen receptor.
- the intracellular domain of TCR can be, for example, an intracellular domain derived from CD3 or the like, which is also called a TCR ⁇ chain.
- CD3 may be appropriately mutated as long as it does not inhibit the function of the chimeric antigen receptor.
- ITAM immunophilicity-associated activation motif
- the chimeric antigen receptor of the present invention preferably has a spacer sequence arranged between the scFv domain and the transmembrane domain.
- the length of the spacer sequence and the types of amino acid residues that compose it are not limited as long as they do not inhibit the function of the chimeric antigen receptor.
- the spacer sequence can be designed to have about 10 to 200 amino acid residues.
- the core region further contains the intracellular domain of the co-stimulator.
- the intracellular domain of the co-stimulator is not particularly limited as long as it is an intracellular domain derived from the co-stimulator possessed by T cells or the like.
- one or more selected from the group consisting of OX40, 4-1BB, GITR, CD27, CD278, CD28 and the like can be appropriately selected and used. Mutations may be appropriately introduced into the intracellular domains of these co-stimulators as long as they do not inhibit the function of the chimeric antigen receptor.
- the position of the intracellular domain of the co-stimulator is not particularly limited as long as it is on the C-terminal side of the transmembrane domain, and may be either the cell membrane side of the intracellular domain of the TCR or the opposite side to the cell membrane.
- the intracellular domain of the co-stimulator is preferably located on the opposite side of the intracellular domain of the TCR from the cell membrane.
- the chimeric antigen receptor of the present invention preferably contains various ligand domains such as GITRL domain, 4-1BBL domain, and ICOSL domain via a self-cleaving peptide domain on the C-terminal side of the core region. This makes it possible to further enhance the expression efficiency of the chimeric antigen receptor and the cytotoxic activity of CAR-T cells containing the chimeric antigen receptor.
- self-cleaving peptide means a peptide sequence with cleavage activity that occurs between two amino acid residues in the peptide sequence itself.
- self-cleaving peptides include 2A peptides and 2A-like peptides.
- cleavage occurs between glycine and proline residues on these peptides. This is caused by a "ribosome skip mechanism” in which normal peptide bonds between glycine and proline residues are not formed during translation and do not affect downstream translation.
- the ribosome skip mechanism is known in the art and is used for the expression of multiple proteins encoded by a single molecule of messenger RNA (mRNA).
- the self-cleaving peptide used in the present invention can be obtained from a viral 2A peptide or a 2A-like peptide having an equivalent function thereof.
- F2A foot-and-mouth disease virus
- E2A horse rhinitis A virus
- P2A 2A peptide
- PTV-1 Porcine teschovirus
- TaV Thosea signa virus
- TaV Thosea signa virus
- the self-cleaving peptide domain may be appropriately mutated as long as its activity is not significantly impaired.
- the present invention relates to, in one aspect, the polynucleotides encoding the PRAME-binding molecules of the invention (sometimes referred to herein as "polynucleotides of the invention”). This will be described below.
- the polynucleotide of the present invention may contain other sequences in addition to the coding sequence of the PRAME-binding molecule of the present invention.
- the polynucleotide of the present invention preferably contains the PRAME-binding molecule of the present invention in an expressible state.
- Other sequences include promoter sequences, enhancer sequences, repressor sequences, insulator sequences, replication origins, reporter protein (eg, fluorescent protein, etc.) coding sequences, drug resistance gene coding sequences, and the like.
- the polynucleotide of the present invention may be a linear polynucleotide or a cyclic polynucleotide (vector or the like).
- the vector can be a plasmid vector, or a viral vector (eg, adenovirus, or retrovirus). Further, the vector may be, for example, a cloning vector or an expression vector. Examples of the expression vector include a vector for prokaryotic cells such as Escherichia coli and actinomycetes, and a vector for eukaryotic cells such as yeast cells, insect cells, and mammalian cells.
- the polynucleotide of the present invention includes not only DNA and RNA but also those to which known chemical modifications are applied, as exemplified below.
- Substituting the phosphate residue (phosphate) of each nucleotide with a chemically modified phosphate residue such as phosphorothioate (PS), methylphosphonate, or phosphorodithionate to prevent degradation by hydrolytic enzymes such as nucleases. can be done.
- the hydroxyl group at the 2-position of the sugar (ribose) of each ribonucleotide is converted into -OR (R is, for example, CH3 (2'-O-Me), CH 2 CH 2 OCH 3 (2'-O-MOE), CH.
- the base moiety (pyrimidine, purine) may be chemically modified, for example, introduction of a methyl group or a cationic functional group at the 5-position of the pyrimidine base, or substitution of the carbonyl group at the 2-position with thiocarbonyl.
- examples thereof include those in which the phosphoric acid moiety and the hydroxyl moiety are modified with biotin, an amino group, a lower alkylamine group, an acetyl group and the like, but the present invention is not limited thereto.
- the term "polynucleotide” includes not only natural nucleic acids but also BNA (Bridged Nucleic Acid), LNA (Locked Nucleic Acid), PNA (Peptide Nucleic Acid) and the like.
- the present invention relates, in one aspect, to cells containing the polynucleotides of the invention (sometimes referred to herein as "cells of the invention”). This will be described below.
- the cell from which the cell of the present invention is derived is not particularly limited.
- the derived cells include cells that can be used for protein expression (for example, insect cells, eukaryotic cells, mammalian cells, etc.). Can be mentioned.
- the cells are preferably lymphocyte cells (eg, T cells (eg, CD4-positive CD8-negative T cells, CD4-negative CD8-positive T cells, etc.). T cells, ⁇ -T cells, ⁇ -T cells, etc.), NK cells, NKT cells, etc. prepared from iPS cells).
- the lymphocyte is preferably a cell expressing the chimeric antigen receptor of the present invention, and in a more specific embodiment, the lymphocyte is a cell membrane in which the chimeric antigen receptor of the present invention is expressed. Therefore, preferably, the chimeric antigen receptor of the present invention is expressed in a state where the PRAME-binding region is exposed outside the cell membrane.
- lymphocyte cells expressing the chimeric antigen receptor After recognizing PRAME in the PRAME-binding region, lymphocyte cells expressing the chimeric antigen receptor transmit the recognition signal to the inside of T cells, etc., and activate a signal that induces cytotoxic activity, which is linked to this. The cell can then exert an aggression or cytotoxic activity against other cells or tissues expressing PRAME.
- CAR-T cell When the cell that exerts such a function is CTL, it is called a chimeric antigen receptor T cell (CAR-T cell). Similar to the chimeric antigen receptor T cells, cells having the potential to exert cytotoxic activity such as NK cells can also exert cytotoxic activity by binding the PRAME-binding region to PRAME. Therefore, a host cell containing a polynucleotide encoding a chimeric antigen receptor (particularly, a host cell having cytotoxic activity) is useful as an active ingredient of a pharmaceutical composition.
- lymphocyte cells and the like specifically recognize cancer tissue (tumor tissue), they are useful for the treatment or prevention of cancer and the like.
- the type of cancer is not particularly limited and includes blood cancer and solid cancer.
- Hematological cancers include, for example, various B-cell malignant lymphomas (B-cell acute lymphoblastic leukemia, follicular lymphoma, diffuse lymphoma, mantle-cell lymphoma, MALT lymphoma, intravascular B-cell lymphoma, CD20-positive Hodgkin lymphoma, etc.).
- Bone marrow proliferative disease myelodystrophy / myeloid proliferative tumor (CMML, JMML, CML, MDS / MPN-UC), myelodystrophy syndrome, acute myeloid leukemia, multiple myeloma, etc.
- solid cancers include lung cancer, colon cancer, ovarian cancer, breast cancer, brain tumor, stomach cancer, liver cancer, tongue cancer, thyroid cancer, kidney cancer, prostate cancer, uterine cancer, and osteosarcoma.
- the cell of the present invention can be obtained by introducing the polynucleotide of the present invention into the cell. If necessary, cells containing the polynucleotide of the present invention may be concentrated, or a specific marker (CD antigen such as CD8) may be used as an index for concentration.
- a specific marker CD antigen such as CD8
- the present invention in one embodiment, comprises a lymphocyte cell containing a polynucleotide encoding a chimeric antigen receptor of the present invention, or a pharmaceutical composition containing an antibody of the present invention (in the present specification, “Pharmaceutical composition”. It may be referred to as “the pharmaceutical composition of the present invention”). This will be described below.
- the content of the above-mentioned cells and antibodies in the pharmaceutical composition takes into consideration the type of the target disease (for example, solid cancer), the target therapeutic effect, the administration method, the treatment period, the age of the patient, the weight of the patient, and the like. Can be set as appropriate.
- the content of the antibody in the pharmaceutical composition can be about 0.001 part by weight to 10 parts by weight, assuming that the entire pharmaceutical composition is 100 parts by weight.
- the content of cells in the pharmaceutical composition can be, for example, about 1 cell / mL to 10 ⁇ 4 cells / mL.
- the administration form of the pharmaceutical composition is not particularly limited as long as the desired effect is obtained, and either oral administration or parenteral administration (for example, intravenous injection, intramuscular injection, subcutaneous administration, rectal administration, transdermal administration, local administration). It can be administered to mammals including humans by the route of administration. Since the active ingredient is a cell, the preferred dosage form is parenteral administration, more preferably intravenous injection. Dosage forms for oral administration and parenteral administration and methods for producing the same are well known to those skilled in the art, and the antibody or cell according to the present invention is mixed with a pharmaceutically acceptable carrier or the like according to a conventional method. Can be manufactured.
- Dosage forms for parenteral administration include injectable preparations (eg, drip injections, intravenous injections, intramuscular injections, subcutaneous injections, intradermal injections), external preparations (eg, ointments, paps, lotions). Agents), suppository inhalants, eye agents, eye ointments, nasal drops, ear drops, liposomes and the like.
- injectable preparations eg, drip injections, intravenous injections, intramuscular injections, subcutaneous injections, intradermal injections
- external preparations eg, ointments, paps, lotions.
- Agents e.g, ointments, paps, lotions
- suppository inhalants eg, eye agents, eye ointments, nasal drops, ear drops, liposomes and the like.
- an injectable product is prepared by dissolving or suspending an antibody or cell in distilled water for injection, and if necessary, a lysis aid
- the pharmaceutical composition may further contain other agents effective in diagnosing, treating, or preventing the disease.
- the pharmaceutical composition may contain components such as a bactericidal agent, an anti-inflammatory agent, a cell activator, vitamins, and amino acids, if necessary.
- Carriers used in the formulation of pharmaceutical compositions include excipients, binders, disintegrants, lubricants, colorants, flavoring agents and, if necessary, stabilizers, emulsifiers and absorptions commonly used in the art.
- Use accelerators, surfactants, pH regulators, preservatives, antioxidants, bulking agents, wetting agents, surface activators, dispersants, buffers, preservatives, solubilizing agents, soothing agents, etc. Can be done.
- the type of disease diagnosed, treated, or prevented using the pharmaceutical composition is not particularly limited as long as the diagnosis, treatment, or prevention can be achieved.
- Specific target diseases include, for example, cancer.
- the type of cancer is not particularly limited and includes blood cancer and solid cancer.
- Hematological cancers include, for example, various B-cell malignant lymphomas (B-cell acute lymphoblastic leukemia, follicular lymphoma, diffuse lymphoma, mantle-cell lymphoma, MALT lymphoma, intravascular B-cell lymphoma, CD20-positive Hodgkin lymphoma, etc.).
- Bone marrow proliferative disease myelodystrophy / myeloid proliferative tumor (CMML, JMML, CML, MDS / MPN-UC), myelodystrophy syndrome, acute myeloid leukemia, multiple myeloma, etc.
- solid cancers include lung cancer, colon cancer, ovarian cancer, breast cancer, brain tumor, stomach cancer, liver cancer, tongue cancer, thyroid cancer, kidney cancer, prostate cancer, uterine cancer, and osteosarcoma.
- the administration target (subject) of the pharmaceutical composition is, for example, an animal suffering from or may be affected by the above-mentioned disease. "May be affected" can be determined by a known diagnostic method.
- the animal is, for example, a mammal, preferably a human.
- the dose of the pharmaceutical composition is, for example, the route of administration, the type of disease, the degree of symptoms, the age, sex, weight, severity of the disease, pharmacokinetic and toxicological characteristics of the patient, and the drug. It can be determined by the clinical physician based on various factors such as the availability of a delivery system and whether it is administered as part of a combination of other drugs.
- the dose of the pharmaceutical composition can be, for example, about 1 microgram / kg (body weight) to 10 g / kg (body weight) per day when the active ingredient is an antibody. When the active ingredient is a cell, it can be about 10 ⁇ 4 cells / kg (body weight) to 10 ⁇ 9 cells / kg (body weight).
- the administration schedule of the pharmaceutical composition can also be determined in consideration of the same factors as the dose thereof. For example, the above daily dose can be administered once a day to January.
- Test example 1 Isolation and evaluation of antibody # 98 that recognizes HLA-A24-PRAME HLA-A24 PRAMEp301-309 (SEQ ID NO: 17) pMHC complex (hereinafter referred to as A24-PRAME) artificially prepared using a self-made human antibody library.
- An antibody library screen was performed targeting (abbreviated), and multiple antibodies recognizing A24-PRAME were isolated.
- the method followed the method shown in Non-Patent Document 7. That is, the antibody was isolated by using the phage display method. In this method, scFvCL is presented as part of the phage coat protein cp3, and clones with high binding to the antigen can be narrowed down by ELISA. After performing the magnet beads screen shown in FIG.
- Non-Patent Document 8 the cell screen shown in FIG. 1b was performed (Non-Patent Document 8), and after picking up about 400 clones, a culture supernatant was prepared, and the obtained scFvCL-CP3 was performed.
- ELISA ELISA for.
- ELISA was performed using multiple peptide-HLA-A24 complexes (pMHC).
- pMHC multiple peptide-HLA-A24 complexes
- FIG. 3 shows the result of ELISA. As a result, it was found that cross recognition was not recognized for # 98 and the recognition was highly specific.
- the results of analyzing the amino acid sequence of antibody # 98 and the base sequence encoding the antibody are shown below.
- the CDR sequence was estimated by IMGIT.
- Heavy chain CDR1 amino acid sequence GGTFSSYA (SEQ ID NO: 1) Heavy chain CDR2 amino acid sequence: IIPIFGTA (SEQ ID NO: 2) Heavy chain CDR3 amino acid sequence: ARHHSNYYYYGMDV (SEQ ID NO: 3) Heavy chain variable amino acid sequence: QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTGTAYMELSSLRSEDTAVYYCARHHSNYYYYGMDVWGQGTTVSR (SEQ ID NO: 4) Heavy chain CDR1 base sequence: GGAGGCACCTTCAGCAGCTATGCT (SEQ ID NO: 5) Heavy chain CDR2 base sequence: ATCATCCCTATCTTTGGTACAGCA (SEQ ID NO: 6) Heavy chain CDR3 base sequence: GCGAGACACCACAGTAACTACTACTACTACGGTATGGACGTC (SEQ ID NO: 7) ⁇ :CA
- Light chain CDR1 amino acid sequence NIGSKN (SEQ ID NO: 9)
- Test example 2 Specific recognition of A24-PRAME by # 98 scFvCL-cp3 LCL cells have high expression of MHC-Class I, so when the peptide is pulsed, the peptide is trapped on HLA-A24 on the LCL cells and presented as pMHC. .. Therefore, # 98 was reacted with LCL cells pulsed with PRAME and CMV peptides and DMSO, and it was confirmed that sufficient recognition occurred by FACS.
- peptides were prepared by substituting one amino acid of PRAME p301-309 (LYVDSLFFL, Table 1, SEQ ID NO: 17) with another amino acid (mainly alanine) (Table). 1 SEQ ID NO: 2-10). Since 2Y and 9L were expected to be anchor amino acids, we also investigated 2F, 2W, 9F, 9I (Table 1 SEQ ID NO: 11-14) that stabilize peptide binding, and antibodies due to peptide changes. We examined changes in perception. Specifically, it is as follows.
- Test example 3 Measurement of binding constant of # 98 scFvCL-pp
- the KD value of # 98 scFvCL-cp3 pp prepared by converting # 98 scFvCL-cp3 into pp form was measured by Biacore X100.
- the KD value in Biacore was determined by measuring the dynamic change in detection sensitivity (resonance, which reflects the mass change on the chip) over time.
- the dissociation rate constant (Kd) and the coupling rate constant (Ka) were obtained from the curve of the dynamic change, and the coupling constant was obtained from the ratio of the two constants. Specifically, it is as follows.
- A24 PRAME p301-309 was immobilized on the sensor chip as a ligand.
- scFv-pp with five levels of concentrations of 500nM, 250nM, 125nM, 62.5nM, and 31.25nM were reacted in order, and association and dissociation were measured. Global fit was performed on this, and Kon, Koff, and KD were calculated.
- the binding constant of # 98 scFvCL-pp was 5.3 nM (Fig. 6).
- Test example 4 Preparation of retrovirus vector, introduction into PBMC, expression study Gene transfer by retrovirus was performed for constitutive CAR expression.
- a CAR-introduced retrovirus vector was constructed (Fig. 7), a retrovirus was prepared by packing cell Plat-A, and CAR-T cells were prepared by infecting with PBMC.
- the expression of CAR was confirmed by tetramer staining. Specifically, it is as follows. Human PBMC was stimulated with OKT3 and retronectin and cultured, and the retrovirus prepared on day 3 and day 4 was infected and cultured to prepare CAR T cells (Fig. 8). These cells were stained with PRAME tetramer, anti-CD4 antibody, and anti-CD8 antibody, and measured by FACS CANT. As a result, the CAR positive rate of CAR-T cells was 52.0% for CD8 and 51.7% for CD4 (Fig. 8).
- Test example 5 Examination of alanine scan on # 98 zG CAR T cells, risk evaluation Using T2A24 cells pulsed with the alanine scan peptide described in Test Example 2, this and # 98 zG CAR T cells were co-cultured, and the culture supernatant was obtained. The amount of IFNg secreted into the cells was measured by ELISA (Fig. 9). Specifically, it is as follows. For # 98 CAR, the amino acid-substituted peptide pulse A24-LCL 1x10 ⁇ 5 shown in Fig. 5 and the same number of CAR T cells were co-cultured, and the amount of IFNg produced in 24 hours was detected by ELISA. And compared.
- the pattern was similar to alanine scan with scFvCL-cp3 in that there was a clear recognition of 1A, 5A, 9F, 9I. Therefore, we performed a BLAST search using the motifs of xYVDxLFFL, xYVDxLFFF, and xYVDxLFFI. As a result, peptides matching these motifs were not extracted.
- Table 2 shows the genes in which the amino acid sequences of PRAMEp301-309 differ by 3 in the BLAST search. These peptides, CMV and DMSO were pulsed to T2A24 and co-cultured with # 98 CAR-T cells. The amount of IFNg secreted in the culture supernatant was measured by ELISA. In addition, e alone indicates only effector cells (Fig. 16). No response of # 98 CAR-T cells was observed to the peptides shown in Table 2.
- Test example 6 Recognition avidity evaluation of # 98 zG CAR T
- pulse with different concentrations of PRAME peptide was performed, and this was co-cultured with # 98 zG CAR T cells to perform intracellular staining of IFNg, and # 98 zG CAR T. Cell recognition was measured. This is avidity. Specifically, it is as follows. Peptide pulses were performed on T2A24 cells with 10, 1, 0.1, 0.01, 0.001 micro meters of PRAME p301-309, CMV 10 micro mice, DMSD, and # 98 CAR T cells were reacted with this for 6 hours.
- CAR T cells labeled with PEcy7-labeled CD8 + RPE-labeled tetramer + were stained with APC-labeled anti-IFNg antibody, and CAR T cells reacted with FACS CANT were measured. It was found that the IC50 was about 10 nM and had sufficient cognitive activity (Fig. 10).
- Test example 7 Specific recognition of A24 + PRAME + target cells by # 98 zG CAR T cells by # 98 zG CAR T cells
- PRAME expression was as follows. Total RNA was extracted from cultured cells using an RNA extraction kit (Promega), and then a reverse transcription reaction was performed. For RT-PCR, PRAME (Hs01022301_m1) and GAPDH CONTROL MIX (REF 4325792), which are TaqMan gene expression assay reagents sold by Applied Biosystems, were used. The expression level of PRAME was normalized by the expression level of GAPDH.
- HLA-A24 in the target cells used in this test was analyzed. Specifically, it is as follows. b) T2A24, SK-MEL-124 and NW-MEL-38 are Bulk Monoclonal Antibody A23,24 IgG2b (ONE LAMBDA.INC) as the primary antibody and Alexa Fluor 488 goat anti-mouse IgG (H + L) as the secondary antibody. Stained with (Invitrogen). Measured by Flow cytometry.
- CAR-T cells gene-introduced with retrovirus and target cells subjected to peptide pulse were co-cultured for 24 hours, and IFN- ⁇ contained in the culture supernatant was measured. -The production of ⁇ has increased. No IFN- ⁇ production was observed in co-culture with CMV pulsed T2A24 cells, which is a negative control (Fig. 12). In addition, tumor-specific IFN- ⁇ production was observed in the target cells A24-positive PRAME-positive SK-MEL-124 and A24 gene-introduced NW-MEL-38, and the off-target NW-MEL-38. A clear difference was observed (Fig. 12). Therefore, it was confirmed that the introduction of the CAR gene by the retroviral vector expresses CAR, specifically recognizes the tumor, and produces IFN- ⁇ .
- Test example 8 Specific recognition of target cancer cells by CAR-T cells gene-introduced with PRAME # 98 CAR # 98 CAR T cells were positive for IFNg production when co-cultured with T2A24 cells peptide-pulsed with PRAME p301-309. It was shown that awareness of the target was occurring. On the other hand, co-culture with CMV peptide pulsed T2A24 cells and T2A24 cells without peptide pulse showed no IFNg production and therefore no recognition of these negative targets (Fig. 12).
- the PRAME expression of the cultured cells used is shown in FIG. 11a
- the HLA-A24 expression is shown in FIG. 11b.
- NW-MEL-38-HLA-A24 HLA-A24 gene introduced into NW-MEL-38 cells by retrovirus and HLA-A24 forcibly expressed, PRAME positive HLA-A24 positive
- SK-MEL -124 PRAME-positive HLA-A24 positive
- NW-MEL-38 PRAME-positive HLA-A24 negative
- the # 98 CART cells showed IFNg production in co-culture with positive cells, and no IFNg production was observed in co-culture with negative cells. Therefore, it was shown that the recognition of the target cells was performed specifically.
- Test example 9 Specific recognition of target cancer cells by CAR-T cells gene-introduced with PRAME # 98 CAR NW-MEL-38-HLA-A24 (HLA-A24 gene retrovirus against NW-MEL-38 cells) Introduced by HLA-A24 forcibly expressed, PRAME-positive HLA-A24 positive), SK-MEL-124 (PRAME-positive HLA-A24-positive), NW-MEL-38 (PRAME-positive HLA-) as negative target cells (A24 negative) was sown on an E-plate, and after 24.5 hours, # 98 CAR T cell was allowed to act as an effector cell, and the index change due to xCelligence was observed. Specifically, it is as follows.
- NW-MEL-38 (A24-PRAME +) were cultured on the E-plate for 24.5 hours, 100,000 effector cells were added and cultured, and the cell index was followed over time.
- the Cell index reflects the number of A24 NW-MEL-38 cells on the E-plate.
- SK-MEL-124 cells (A24 + PRAME +) were cultured on the E-plate for 24.5 hours, 100,000 effector cells were added and cultured, and the cell index was followed over time.
- the Cell index reflects the number of SK-MEL-124 cells on the E-plate.
- the Normalized cell index was standardized with the number of A24NW-MEL-38 cells immediately before co-culturing with effector cells as 1. The results are shown in Figure 13c.
- Test Example 10 # 98 zG CAR Cancer suppression by T cells 1 Since NOG mice lack the common ⁇ receptor, there are no NK cells. Therefore, the engraftability of human cells and human tissues is significantly higher than that of NOD-SCID mice, and human cancer and normal human tissues can be engrafted at a high rate. In addition, since the differentiation of human T cells is observed after transplantation of human hematopoietic stem cells, the demand as a human immune system model mouse is increasing. NOG mice are characterized by T cell and B cell deficiency, natural killer (NK) cell deficiency, dendritic cell dysfunction, macrophage dysfunction, complement activity deficiency, aging-related T cells and No B cell leakage (leakiness) is observed.
- NK natural killer
- RPE-labeled anti-rabbit antibody was reacted after anti-lambda antibody reaction, sorted by anti-PE beads, and purified effector cells were infused intravenously 7 days after infusion of target cells.
- the control used was one that did not infuse anything.
- Test Example 11 # 98 zG CAR Cancer suppression by T cells 2 Test Example 10. # 98 zG CAR T cells or cancer suppression NOG mice lack the common ⁇ receptor, so NK cells are absent. Therefore, the engraftment of human cells and human tissues is significantly higher than that of NOD-SCID mice, and human cancer and normal human tissues can be engrafted at a high rate. In addition, since human T cell differentiation is observed after transplantation of human hematopoietic stem cells, demand as a human immune system model mouse is increasing. NOG mice are characterized by T cell and B cell deficiencies, natural killer (NK) cell deficiencies, dendritic cell dysfunction, macrophage dysfunction, complement activity deficiencies, aging-related T cells and No B cell leakage is observed.
- NK natural killer
- SK-MEL-1 24 (A24 positive PRAME positive) was transplanted to the right side of the body.
- NGM and PRAME # 98 CAR-T cells were infused from the tail vein with a cell count of 4 ⁇ 10 ⁇ 6 cells / animal. Specifically, it is as follows (the outline is shown in Fig. 15a).
- a 7-week-old female NOG mouse was purchased and trained for 3 weeks, and SK-MEL-124 cells 4x10 ⁇ 6 were transplanted subcutaneously.
- the cells were infused intravenously. NGM was infused for control.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Wood Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Neurology (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202180083394.XA CN116710136A (zh) | 2020-12-10 | 2021-12-07 | Prame结合性分子 |
| US18/266,340 US20240024480A1 (en) | 2020-12-10 | 2021-12-07 | Prame binding molecule |
| KR1020237021432A KR20230118874A (ko) | 2020-12-10 | 2021-12-07 | Prame 결합성 분자 |
| JP2022568277A JP7785361B2 (ja) | 2020-12-10 | 2021-12-07 | Prame結合性分子 |
| EP21901679.7A EP4260870A4 (en) | 2020-12-10 | 2021-12-07 | Prame binding molecule |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2020-205384 | 2020-12-10 | ||
| JP2020205384 | 2020-12-10 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022124282A1 true WO2022124282A1 (ja) | 2022-06-16 |
Family
ID=81974443
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2021/044807 Ceased WO2022124282A1 (ja) | 2020-12-10 | 2021-12-07 | Prame結合性分子 |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20240024480A1 (https=) |
| EP (1) | EP4260870A4 (https=) |
| JP (1) | JP7785361B2 (https=) |
| KR (1) | KR20230118874A (https=) |
| CN (1) | CN116710136A (https=) |
| WO (1) | WO2022124282A1 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025044998A1 (zh) * | 2023-08-25 | 2025-03-06 | 立凌生物制药(苏州)有限公司 | 靶向prame多肽的单域抗体及其用途 |
| WO2025047925A1 (ja) * | 2023-08-31 | 2025-03-06 | 国立大学法人三重大学 | ハイブリッドt細胞受容体 |
| WO2025137640A1 (en) | 2023-12-22 | 2025-06-26 | Gilead Sciences, Inc. | Azaspiro wrn inhibitors |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016191246A2 (en) * | 2015-05-22 | 2016-12-01 | Memorial Sloan-Kettering Cancer Center | T cell receptor-like antibodies specific for a prame peptide |
| CN106478809A (zh) * | 2015-11-06 | 2017-03-08 | 广州市香雪制药股份有限公司 | 识别prame抗原短肽的tcr |
-
2021
- 2021-12-07 JP JP2022568277A patent/JP7785361B2/ja active Active
- 2021-12-07 KR KR1020237021432A patent/KR20230118874A/ko active Pending
- 2021-12-07 US US18/266,340 patent/US20240024480A1/en active Pending
- 2021-12-07 EP EP21901679.7A patent/EP4260870A4/en active Pending
- 2021-12-07 CN CN202180083394.XA patent/CN116710136A/zh active Pending
- 2021-12-07 WO PCT/JP2021/044807 patent/WO2022124282A1/ja not_active Ceased
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016191246A2 (en) * | 2015-05-22 | 2016-12-01 | Memorial Sloan-Kettering Cancer Center | T cell receptor-like antibodies specific for a prame peptide |
| CN106478809A (zh) * | 2015-11-06 | 2017-03-08 | 广州市香雪制药股份有限公司 | 识别prame抗原短肽的tcr |
Non-Patent Citations (12)
| Title |
|---|
| C. PELLAT-DECEUNYNCKM.P. MELLERINN. LABARRIEREG. JEGOA. MOREAU-AUBRYJ.L. HAROUSSEAUF. JOTEREAUR. BATAILLE: "The cancer germ-line genes MAGE-1, MAGE-3 and PRAME are commonly expressed by human myeloma cells", EUR. J. IMMUNOL., vol. 30, 2000, pages 803 - 809 |
| CONCETTA QUINTARELLIGIANPIETRO DOTTISAYYEDA T. HASANBIAGIO DE ANGELISVALENTINA HOYOSSANTA ERRICHIELLOMARTHA MIMSLUIGIA LUCIANOJESS: "High-avidity cytotoxic T lymphocytes specific for a new PRAME-derived peptide can target leukemic and leukemic precursor cells", BLOOD, vol. 117, no. 12, 2011, pages 3353 - 3362, XP055498929, DOI: 10.1182/blood-2010-08-300376 |
| E. NEUMANN, A. ENGELSBERG, J. DECKER, S. STORKEL, E. JAEGER, C. HUBER, B. SELIGER: "Heterogeneous expression of the tumor-associated antigens RAGE-1, PRAME, and glycoprotein 75 in human renal cell carcinoma candidates for T-cell-based immunotherapies?", CANCER RES., vol. 58, 1998, pages 4090 - 4095 |
| HIDEYUKI IKEDABERNARD LETHEFREDERIC LEHMANNNICOLAS VAN BARENJEAN-FRANCOIS BAURAINCHARLES DE SMETHERVE CHAMBOSTMASSIMO VITALEALESSA: "Characterization of an Antigen That is Recognized on a Melanoma Showing Partial HLA Loss by CTL Expressing an NK Inhibitory Receptor", IMMUNITY, vol. 6, 1997, pages 199 - 208, XP002216277, DOI: 10.1016/S1074-7613(00)80426-4 |
| HIRATSUKA, HIROYUKI: "Y3-4 Development of TCR-like CAR-T cells targeting the cancer testis antigen PRAME p 301-309 /HLA-A*24:02", THE 25TH ANNUAL MEETING OF THE JAPANESE CANCER IMMUNOLOGY SOCIETY PROGRAM; JULY 1-3, 2021, JAPANESE CANCER IMMUNOLOGY SOCIETY, JP, vol. 25, 2 July 2021 (2021-07-02) - 3 July 2021 (2021-07-03), JP, pages 1, XP009538140 * |
| JAN H. KESSLERNICO J. BEEKMANSANDRA A. BRES-VLOEMANSPAULINE VERDIJKPETER A. VAN VEELENANTOINETTE M. KLOOSTERMAN-JOOSTENDEBBY C.J. : "Efficient Identification of Novel Hla-A*0201-Presented Cytotoxic T Lymphocyte Epitopes in the Widely Expressed Tumor Antigen Prame by Proteasome-Mediated Digestion Analysis", JEM, vol. 193, no. 1, 2001, XP002339970, DOI: 10.1084/jem.193.1.73 |
| KARLIN SALTSCHUL SF: "Applications and statistics for multiple high-scoring segments in molecular sequences", PROC NATL ACAD SCI USA., vol. 90, 1993, pages 5873 - 7, XP001030852, DOI: 10.1073/pnas.90.12.5873 |
| KARLIN SALTSCHUL SF: "Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes", PROC NATL ACAD SCI USA, vol. 87, 1990, pages 2264 - 2268, XP001030853, DOI: 10.1073/pnas.87.6.2264 |
| N. VAN BAREN, H. CHAMBOST, A. FERRANT, L. MICHAUX, H. IKEDA, I. MILLARD, D. OLIVE, T. BOON, P.G. COULIE: "PRAME a gene encoding an antigen recognized on a human melanoma by cytolytic T cells, is expressed in acute leukaemia cells ", BR. J. HAEMATOL., vol. 102, 1998, pages 1376 - 1379, XP071096826, DOI: 10.1046/j.1365-2141.1998.00982.x |
| See also references of EP4260870A4 |
| YASUSHI AKAHORIGENE KUROSAWAMARIKO SUMITOMOMIWA MORITACHIHO MURAMATSUKEIKO EGUCHIMIHO TANAKAKAZUHIRO SUZUKIMOTOTAKA SUGIURAYOSHITA: "Isolation of antigen/antibody complexes through organic solvent (ICOS) method", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 11, 2008, pages 129 |
| YASUSHI AKAHORILINAN WANGMOTOHIRO YONEYAMANAOHIRO SEOSATOSHI OKUMURAYOSHIHIRO MIYAHARAYASUNORI AMAISHISACHIKO OKAMOTOJUNICHI MINEN: "Antitumor activity of CAR-T cells targeting the intracellular oncoprotein WT1 can be enhanced by vaccination", BLOOD, vol. 132, no. 11, 2018, pages 1134 - 1145 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025044998A1 (zh) * | 2023-08-25 | 2025-03-06 | 立凌生物制药(苏州)有限公司 | 靶向prame多肽的单域抗体及其用途 |
| WO2025047925A1 (ja) * | 2023-08-31 | 2025-03-06 | 国立大学法人三重大学 | ハイブリッドt細胞受容体 |
| WO2025137640A1 (en) | 2023-12-22 | 2025-06-26 | Gilead Sciences, Inc. | Azaspiro wrn inhibitors |
Also Published As
| Publication number | Publication date |
|---|---|
| CN116710136A (zh) | 2023-09-05 |
| JPWO2022124282A1 (https=) | 2022-06-16 |
| US20240024480A1 (en) | 2024-01-25 |
| EP4260870A1 (en) | 2023-10-18 |
| JP7785361B2 (ja) | 2025-12-15 |
| KR20230118874A (ko) | 2023-08-14 |
| EP4260870A4 (en) | 2024-11-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20250084176A1 (en) | Fc binding fragments comprising a cd137 antigen-binding site | |
| CN114981305A (zh) | Claudin18.2结合部分及其用途 | |
| JP2020036595A (ja) | 抗ヒト4−1bb抗体およびその使用 | |
| CN112423845A (zh) | 结合pd-l1和cd137的抗体分子 | |
| KR20240156612A (ko) | 항b7-h3의 모노클로널 항체 및 그가 세포 치료 중에서의 응용 | |
| JP7785361B2 (ja) | Prame結合性分子 | |
| CN115052901A (zh) | 靶向bcma的单结构域抗体和嵌合抗原受体及其使用方法 | |
| US20250144141A1 (en) | Mage-a4 peptide dual t cell engagers | |
| CN112566939A (zh) | 三聚体多肽复合物及其用途 | |
| EP4242309A1 (en) | Chimeric antigen receptor | |
| KR20230171465A (ko) | 항cldn4-항cd137 이중특이성 항체 | |
| CN116615443A (zh) | 针对cd33的单结构域抗体 | |
| US20240207407A1 (en) | Egfrviii binding proteins | |
| EP4008347B1 (en) | GD2-BINDING MOLECULE | |
| US20230372484A1 (en) | Chimeric antigen receptors for treatment of cancer | |
| CA3216175A1 (en) | Diagnosis and treatment of myeloid disorders and acute leukemias using novel tumor specific antigens | |
| US20240309070A1 (en) | Anti-vaccinia virus antigen antibodies and related compositions and methods | |
| KR20230132806A (ko) | 키메라 표적 인자 수용체 | |
| US20250333514A1 (en) | Antigen binding proteins targeting an hla-restricted prame peptide | |
| JP2026014549A (ja) | Prame結合性分子 | |
| WO2025210181A1 (en) | Antigen binding proteins targeting an hla-restricted kk-lc-1 peptide | |
| WO2025091756A1 (zh) | 结合hla-a24/prame复合体的多种抗体及其用途 | |
| HK40075690A (en) | Single domain antibodies and chimeric antigen receptors targeting bcma and methods of use thereof | |
| HK40100269A (en) | Chimeric antigen receptor | |
| HK40075456A (en) | Claudin18.2 binding moieties and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21901679 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022568277 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202180083394.X Country of ref document: CN Ref document number: 18266340 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 20237021432 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021901679 Country of ref document: EP Effective date: 20230710 |