WO2022060151A1 - Ptpsigma-fc 융합단백질 및 이를 포함하는 약학 조성물 - Google Patents

Ptpsigma-fc 융합단백질 및 이를 포함하는 약학 조성물 Download PDF

Info

Publication number
WO2022060151A1
WO2022060151A1 PCT/KR2021/012763 KR2021012763W WO2022060151A1 WO 2022060151 A1 WO2022060151 A1 WO 2022060151A1 KR 2021012763 W KR2021012763 W KR 2021012763W WO 2022060151 A1 WO2022060151 A1 WO 2022060151A1
Authority
WO
WIPO (PCT)
Prior art keywords
ptpsigma
fusion protein
protein
derived
domain
Prior art date
Application number
PCT/KR2021/012763
Other languages
English (en)
French (fr)
Inventor
류성언
장혜현
김명빈
박성호
Original Assignee
한양대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020210117865A external-priority patent/KR102666958B1/ko
Application filed by 한양대학교 산학협력단 filed Critical 한양대학교 산학협력단
Priority to JP2023518036A priority Critical patent/JP2023542178A/ja
Priority to US18/044,962 priority patent/US20230365945A1/en
Priority to EP21869773.8A priority patent/EP4215607A1/en
Publication of WO2022060151A1 publication Critical patent/WO2022060151A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774—Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/43—Enzymes; Proenzymes; Derivatives thereof
    • A61K38/46—Hydrolases (3)
    • A61K38/465—Hydrolases (3) acting on ester bonds (3.1), e.g. lipases, ribonucleases
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y301/00—Hydrolases acting on ester bonds (3.1)
    • C12Y301/03—Phosphoric monoester hydrolases (3.1.3)
    • C12Y301/03048—Protein-tyrosine-phosphatase (3.1.3.48)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to a PTPsigma-Fc fusion protein and a pharmaceutical composition comprising the same, and more particularly, to promote blood stem cell growth and prevent or treat PTPsigma-mediated diseases by interfering with the interaction between the ligand and the extracellular domain of PTPsigma. It relates to a PTPsigma-Fc fusion protein that can be used and a pharmaceutical composition comprising the same.
  • protein phosphorylation plays a key role in the regulation of various cellular phenomena such as cell growth, differentiation, immune response, and brain function. Inadequate control of protein phosphorylation is responsible for many diseases, including cancer, diabetes, immune diseases, and neurological diseases.
  • protein kinases and protein phosphatases that control phosphorylation and dephosphorylation of proteins become important target proteins for the development of therapeutic agents for diseases.
  • Inhibitors of protein kinases have already been proven to be effective as therapeutics for diseases in clinical practice, while research on therapeutics targeting protein dephosphorylation enzymes has been actively conducted recently, and no successful therapeutics have been reported in clinical practice.
  • PTP Protein Tyrosine Phosphatase
  • the phosphorylation-dephosphorylation process of tyrosine is used as a very important means in the intracellular signaling system, and in particular, plays a key role in the response of cells to external stimuli, cell growth, differentiation, and death. Therefore, PTP occupies an important position as a therapeutic target protein for diseases such as cancer, vascular disease, immune disease, and neurological disease accompanying changes in cellular state as described above.
  • 10-1194968 discloses a PTP1B-mediated disease such as diabetes by inhibiting the activity of PTP1B using a 1,1'-(1,2-ethyndiyl)bis-benzene derivative. It describes a technique for preventing or treating, and Korean Patent No. 10-1826690 discloses a therapeutic agent for neuroinflammatory diseases using a PTP inhibitor targeting PTP1B, TC-PTP, SHP2, LYP and RPTP ⁇ .
  • PTP active site pocket has a relatively shallow depth and a narrow area capable of strong interaction with the inhibitor compound, and since the enzyme reaction domains between PTPs are similar, it is difficult for the inhibitor compound to have selectivity.
  • the PTP active site pocket has a positive charge, the compounds bound thereto have a negative charge to mimic the phosphate group, which is a substrate of the PTP enzyme.
  • receptor-type PTPs such as PTPsigma can be signal transduced by receptor-ligand interaction between the extracellular domain (ectodomain) and ligand in addition to the active site.
  • the receptor-ligand interaction of PTPsigma is known to be involved in signal transduction such as inhibition of nerve cell regeneration, and Parkinson's disease is known as a PTPsigma-mediated disease.
  • PTPsigma-Fc fusion protein that can inhibit PTPsigma signal transduction and overcome the limitations of conventional PTP inhibitor compounds by interfering with the receptor-ligand interaction that occurs in the extracellular domain of PTPsigma using the interaction between proteins. has been developed.
  • Another object of the present invention is to provide a composition for promoting blood stem cell growth comprising the PTPsigma-Fc fusion protein.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating PTPsigma-mediated diseases comprising the PTPsigma-Fc fusion protein.
  • the present invention provides a PTPsigma-Fc fusion protein in which a protein derived from PTPsigma (Protein Tyrosine Phosphatase sigma) is linked to one or more of the two chains constituting the Fc domain derived from immunoglobulin (Ig).
  • the PTPsigma-derived protein may be a protein derived from the extracellular domain (ectodomain) of PTPsigma.
  • the PTPsigma-derived protein may be a protein derived from the first-second Ig domain (Ig1-2) or the first-third Ig domain (Ig1-3) among the extracellular domains of PTPsigma.
  • the PTPsigma-derived protein may include amino acid residues 30 to 231 of the PTPsigma protein.
  • one or more residues of isoleucine (I), valine (V), leucine (L) and tyrosine (Y) among the PTPsigma-derived proteins are alanine (A), serine (S), threonine (T), asparagine ( N), glutamine (Q), aspartic acid (D), glutamic acid (E), lysine (K), arginine (R) or histidine (H).
  • one or more residues of I36, V104, V108, L125, L143, L145, L155, L187, Y224 and V227 are A, S, T, N, Q, D, E , K, R or H may be substituted.
  • the PTPsigma-derived protein may be in the form of a homodimer or a heterodimer.
  • the chain constituting the Fc domain may include amino acid residues 221 to 447 of an IgG1 heavy chain (based on Kabat EU numbering).
  • one or more amino acids in one chain of the Fc domain are substituted with an amino acid selected from the group consisting of tryptophan (W), arginine (R), phenylalanine (F) and tyrosine (Y), and in the other chain , one or more amino acids may be substituted with an amino acid selected from the group consisting of alanine (A), serine (S), threonine (T) and valine (V).
  • one chain of the Fc domain may contain T366W substitution (based on Kabat EU numbering), and the other chain may contain T366S, L368A and Y407V substitutions (based on Kabat EU numbering).
  • the present invention also provides a composition for promoting blood stem cell growth comprising the PTPsigma-Fc fusion protein.
  • the composition for promoting the growth of blood stem cells may be for regenerating blood stem cells damaged by radiation or administration of an anticancer agent.
  • the present invention also provides a method for promoting blood stem cell growth, comprising administering a pharmaceutical composition comprising a PTPsigma-Fc fusion protein.
  • the present invention also provides a pharmaceutical composition comprising the PTPsigma-Fc fusion protein.
  • the pharmaceutical composition may be for preventing or treating PTPsigma-mediated diseases.
  • the PTPsigma-mediated disease may be a nerve damage disease selected from the group consisting of traumatic brain injury, Alzheimer's disease, and Parkinson's disease.
  • the PTPsigma-mediated disease may be selected from the group consisting of multiple sclerosis and rheumatoid arthritis.
  • the PTPsigma-mediated disease may be a synaptic plasticity-related disease selected from the group consisting of mania, depression, bipolar disorder and memory disorder.
  • the present invention also provides a method for preventing or treating a PTPsigma-mediated disease, comprising administering a pharmaceutical composition comprising a PTPsigma-Fc fusion protein.
  • the reaction between the extracellular domain of PTPsigma and the ligand can be blocked by using a fusion protein in which a protein derived from PTPsigma is bound to the Fc region of an immunoglobulin.
  • a modulator using an interaction between proteins is used, it is possible to overcome limitations such as the strength, selectivity, and cell membrane permeability of conventional inhibitors targeting the active site of PTP.
  • by introducing a mutation into the fusion protein to improve the solubility of aqueous solution it can be treated at a high dose for human and animal treatment.
  • the PTPsigma-Fc fusion protein of the present invention can promote blood stem cell growth by inhibiting PTPsigma-mediated signal transduction, and can be used for the prevention or treatment of PTPsigma-mediated diseases.
  • FIG. 1 shows a schematic design of a homodimer (a) and a heterodimer (b) of the PTPsigma-Fc fusion protein of the present invention.
  • FIG. 2 shows an amino acid sequence map of a PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • Figure 3 shows the amino acid sequence map of the solubility enhancing mutant of the PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • FIG. 4 shows an amino acid sequence encoded by an expression vector for preparing a PTPsigma-Fc homodimer according to an embodiment of the present invention.
  • FIG. 5 shows an amino acid sequence encoded by an expression vector for preparing a PTPsigma-Fc heterodimer according to an embodiment of the present invention.
  • FIG. 6 shows the results of non-reducing SDS-PAGE after preparation of the PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • FIG. 7 is a graph showing the hematopoietic stem cell regeneration effect by the PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • 29 is a graph showing the hematopoietic stem cell regeneration effect by the PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • the present invention relates to a PTPsigma-Fc fusion protein capable of inhibiting PTPsigma signaling by blocking the receptor-ligand interaction of the ligand with the extracellular domain of PTPsigma.
  • PTPsigma Protein Tyrosine Phosphatase sigma is a transmembrane receptor type PTP that penetrates the cell membrane, and consists of three regions: an extracellular domain (ectodomain) region, a cell membrane transverse region, and a cytoplasmic region.
  • the extracellular domain is composed of three Ig-like domains starting from the N-terminal and several fibronectin domains followed. The extracellular domain site undergoes receptor-ligand interactions, and this interaction is transferred to the cytoplasmic site to regulate the enzymatic activity of the PTP active domain.
  • the inventors of the present invention prepared a PTPsigma-Fc fusion protein by fusing the Ig-like domain to the Fc region of an immunoglobulin under the assumption that the Ig-like domain among the extracellular domains of PTPsigma will be involved in the receptor-ligand interaction.
  • the PTPsigma inhibitory ability of the fusion protein was tested. As a result, it was confirmed that when the fusion protein was treated with the radiation-treated blood stem cells, the blood stem cells were effectively regenerated. Accordingly, it was found that the PTPsigma-Fc fusion protein of the present invention can promote the regeneration of PTPsigma blood stem cells.
  • the PTPsigma-Fc fusion protein of the present invention can be used in a composition for promoting blood stem cell growth, and in addition, PTPsigma-mediated diseases such as nerve damage diseases, autoimmune diseases, and synaptic plasticity-related diseases like conventional PTPsigma inhibitors It can be used as a therapeutic agent for diseases.
  • PTPsigma-mediated diseases such as nerve damage diseases, autoimmune diseases, and synaptic plasticity-related diseases like conventional PTPsigma inhibitors It can be used as a therapeutic agent for diseases.
  • amino acid residues that do not change the structure of the hydrophobic amino acids exposed on the surface of the Ig-like domain of PTPsigma are selected and substituted with hydrophilic amino acids. It was confirmed that the blood stem cell regeneration effect was maintained while the solubility was increased.
  • the PTPsigma-Fc fusion protein of the present invention includes a PTPsigma-derived protein and an Fc domain.
  • FIG. 1 shows a schematic design of a PTPsigma-Fc fusion protein according to the present invention.
  • FIG. 1 shows a homodimer structure in which PTPsigma-derived protein is linked to both chains of the Fc domain, and
  • (b) is a heterodimer in which PTPsigma-derived protein is linked to only one chain of the Fc domain. ) represents the structure.
  • the parent of the PTPsigma-derived protein is interpreted to include the standard amino acid sequence of the PTPsigma protein as well as its isoform.
  • the standard sequence of the PTPsigma protein refers to Isoform 1 (Q13332-1) based on Unitprot, and as other isoforms, Isoform PTPS-MEA (Q13332-2), Isoform PTPS-MEB (Q13332-3), Isoform PTPS-MEC (Q13332-4), Isoform PTPS-F4-7 (Q13332-5), Isoform 2 (Q13332-6) and Isoform 3 (Q13332-7), and a preferred parent sequence may be that of PTPsigma Isoform 3.
  • the PTPsigma-derived protein may be a protein derived from the extracellular domain (ectodomain) of PTPsigma.
  • the protein derived from the extracellular domain of PTPsigma means including all or part of the sequence of the extracellular domain of PTPsigma.
  • the protein derived from the extracellular domain of PTPsigma is preferably a protein derived from the Ig-like domain of the extracellular domain, among which the first-second Ig-like domain (Ig1-2), or the first -Third, it is more preferable that it is a protein derived from an Ig-like domain (Ig1-3).
  • the PTPsigma-derived protein is an amino acid sequence derived from Ig1-2 of the PTPsigma extracellular domain, and may include sequences 30 to 231 of the PTPsigma protein.
  • the amino acid sequence number is based on Isoform 3 (Q13332-7) of the PTPsigma protein.
  • the PTPsigma-derived protein may include the amino acid sequence of SEQ ID NO: 1 below as sequences 30 to 231 of the PTPsigma protein.
  • the PTPsigma-derived protein is an amino acid sequence derived from Ig1-3 of the PTPsigma extracellular domain, and may include sequences 30 to 321 of the PTPsigma protein.
  • Sequences 30 to 321 of the PTPsigma protein are sequences in which the amino acid sequence of SEQ ID NO: 1 is followed by sequences 232 to 321 of the PTPsigma protein, and may be represented as follows.
  • a PTPsigma mutant may be formed in the PTPsigma-derived protein to improve the solubility of the fusion protein in aqueous solution.
  • the term “variant” is meant to include substitution, insertion and/or deletion of amino acid residues, and preferably, the variant of the present invention includes substitution of amino acid residues. Substitution of amino acid residues may be indicated in the order of the residues in the parent amino acid sequence, the number of amino acid residues, and the amino acid residues substituted.
  • the fusion protein including an Ig-like domain does not have high solubility in aqueous solution, so it is difficult to treat animals or humans with high doses.
  • amino acids that do not change the structure are selected from among the hydrophobic amino acids exposed on the surface of the Ig-like domain of PTPsigma, and solubility is improved by substituting them with hydrophilic amino acids.
  • the PTPsigma variant for improving the solubility of the fusion protein is one or more residues of isoleucine (I), valine (V), leucine (L) and tyrosine (Y) in the PTPsigma-derived protein alanine (A), serine ( S), threonine (T), asparagine (N), glutamine (Q), aspartic acid (D), glutamic acid (E), lysine (K), arginine (R) or histidine (H) may be substituted.
  • I isoleucine
  • V valine
  • L leucine
  • Y tyrosine
  • At least one residue among I36, V104, V108, L125, L143, L145, L155, L187, Y224 and V227 in sequences 30 to 231 of PTPsigma in terms of not affecting the structure of PTPsigma is A, S, T , N, Q, D, E, K, R or H is preferably substituted, and from the viewpoint of improving solubility, one or more residues of L143, L155, L187, Y224 and V227 are more preferably substituted with A or N.
  • residue 30 in the PTPsigma sequence corresponds to residue 1 of SEQ ID NO: 1
  • residue 30 in the PTPsigma sequence corresponds to residue 1 of SEQ ID NO: 1
  • one or more residues may be substituted with A, S, T, N, Q, D, E, K, R or H, more preferably, L114, L126 in SEQ ID NO: 1
  • one or more residues of L158, Y195 and V198 may be substituted with A or N.
  • the mutation-introduced PTPsigma-Fc fusion protein can be used as a composition for promoting blood stem cell regeneration, and is expected to be capable of high-dose treatment for human and animal treatment.
  • the PTPsigma-derived protein is linked to an immunoglobulin-derived Fc domain to form a PTPsigma-Fc fusion protein.
  • the immunoglobulin-derived Fc domain refers to a C-terminal region including CH2 and CH3 domains (or CH2, CH3 and CH4 domains) among the heavy chain constant regions of immunoglobulin, wild-type It is used in the meaning encompassing the Fc domain and its variants.
  • the immunoglobulin serving as the parent of the Fc domain may be IgG1, IgG2, IgG3, or IgG4, preferably IgG1.
  • each chain of the Fc domain may include a region extending from residue 221 to the C-terminus of a human IgG1 heavy chain, or a region further comprising a hinge in the region.
  • the numbering of amino acid residues in the Fc region is according to Kabat EU numbering, which defines the number of residues in human immunoglobulin heavy chains.
  • each chain of the Fc domain may include sequences 221 to 447 of the heavy chain of IgG1.
  • the heavy chain sequences 221 to 447 of the IgG1 may be represented by the amino acid sequence of SEQ ID NO: 2 below.
  • the PTPsigma-derived protein may be in a form linked to one or more of the two chains constituting the Fc domain.
  • the PTPsigma-derived protein and the Fc domain may be linked by 0 to 20 amino acid residues. That is, the PTPsigma-derived protein and the Fc domain may be directly linked or linked through a linker consisting of 1 to 20 amino acids. In this case, the PTPsigma-Fc-derived protein may be linked to the N-terminus or the C-terminus of the Fc domain.
  • the PTPsigma-Fc fusion protein of the present invention may be a homodimer in which a PTPsigma-derived protein is linked to both chains of the Fc domain, or a heterodimer in which a PTPsigma-derived protein is linked to only one chain.
  • a recombinant variant for forming a dimer in the Fc domain may be formed.
  • knob-into-hole technique may be used as the recombinant mutant for forming the dimer.
  • the knob-into-hole technology is a technology designed to allow only heterodimers to be formed between the heavy chains of antibody fragments.
  • the knob is designed to have a side chain protruding to the opposite side chain, and is inserted into the hole of the opposite side domain. Due to this, heavy chains cannot be homodimerized due to side chain collision, and only heterodimerization is possible.
  • a structure in which a knob or a hole is formed in each chain of the Fc domain may be referred to as an Fc-knob or an Fc-hole, respectively.
  • the Fc-knob may be formed by substituting one or more amino acids in the chain constituting the Fc domain with a large amino acid selected from the group consisting of tryptophan (W), arginine (R), phenylalanine (F) and tyrosine (Y).
  • the Fc-knob may be one in which the T366W mutation is formed in sequences 221 to 447 of the IgG1-Fc heavy chain.
  • the Fc-hole may be formed by substituting one or more amino acids in the chain constituting the Fc domain with small amino acids selected from the group consisting of alanine (A), serine (S), threonine (T) and valine (V).
  • Fc-holes are T366S, L368A and Y407V in the sequences 221 to 447 of the IgG1-Fc heavy chain. A mutation may be formed.
  • FIG. 2 shows an amino acid sequence map of the polypeptide chain constituting the PTPsigma-Fc fusion protein according to an embodiment of the present invention.
  • the PTPsigma-Fc fusion protein of the present invention may include a polypeptide consisting of a heavy chain signal peptide, sequences 30 to 231 of PTPsigma, and sequences 221 to 447 of an IgG1 heavy chain, thereby forming a homodimeric fusion protein. protein can be formed.
  • the PTPsigma-Fc fusion protein of the present invention comprises a heavy chain signal peptide, a polypeptide consisting of a heavy chain signal peptide, sequences 30 to 231 of PTPsigma, and knob variants of sequences 221 to 447 of an IgG1 heavy chain, a heavy chain signal peptide and sequences 221 to 447 of an IgG1 heavy chain of a hole variant, in this case, a heterodimeric fusion protein can be formed.
  • Figure 3 shows the amino acid sequence map of the solubility enhancing mutant of the PTPsigma-Fc fusion protein, that is, the PTPsigma mutant-Fc fusion protein according to an embodiment of the present invention.
  • the PTPsigma mutant-Fc fusion protein of the present invention may include a heavy chain signal peptide, solubility enhancing variants of sequences 30 to 231 of PTPsigma, and a polypeptide consisting of sequences 221 to 447 of the IgG1 heavy chain, thereby isotype It is possible to form a fusion protein in the form of a dimer.
  • the PTPsigma mutant-Fc fusion protein of the present invention comprises a heavy chain signal peptide, a solubility enhancing variant of sequences 30 to 231 of PTPsigma, and a knob variant of sequences 221 to 447 of an IgG1 heavy chain, a polypeptide consisting of, a heavy chain signal peptide and an IgG1 heavy chain It may include a hole variant of sequences 221 to 447, and in this case, a heterodimeric fusion protein may be formed.
  • the PTPsigma-Fc fusion protein formed according to the present invention can block the reaction between the ligand and the extracellular domain of PTPsigma, so it can be used as an inhibitor to inhibit signal transduction by PTPsigma.
  • the present invention also provides a composition comprising the PTPsigma-Fc fusion protein.
  • the PTPsigma-Fc fusion protein blocks the receptor-ligand interaction of the ligand with the extracellular domain of PTPsigma, thereby inhibiting PTPsigma-induced blood stem cell growth inhibitory signal transduction. Accordingly, the PTPsigma-Fc fusion protein of the present invention can promote the growth of blood stem cells, and specifically can be used to promote the regeneration of blood stem cells whose growth is inhibited by irradiation with radiation and use of chemical anticancer agents.
  • the PTPsigma-Fc fusion protein of the present invention is expected to be effective in helping cancer patients in need of radiation therapy and chemotherapy to recover.
  • cancers such as pancreatic cancer, liver cancer, breast cancer, brain cancer, prostate cancer, colorectal cancer, lung cancer, kidney cancer, neuroblastoma, ovarian cancer, endometrial cancer, germ cell tumor, eye cancer, multiple myeloma, stomach cancer, etc.
  • blood stem cells are damaged by radiation therapy and/or anticancer drugs, they can be used as a therapeutic agent for rapid recovery of cancer patients by helping the regeneration of damaged blood stem cells.
  • the extracellular domain of PTPsigma is known to be involved in nerve cell regeneration interference signal transduction and immune response activation signal transduction through interaction with chondroitin sulfate proteoglycan (CSPG).
  • CSPG chondroitin sulfate proteoglycan
  • the fusion protein may be used in a pharmaceutical composition for preventing or treating PTPsigma-mediated diseases.
  • the PTPsigma-Fc fusion protein of the present invention can be used for the prevention or treatment of PTPsigma-mediated nerve damage diseases such as traumatic brain injury, Alzheimer's disease, Parkinson's disease, and mania, depression, bipolar disorder and It can be used for the prevention or treatment of diseases related to PTPsigma-mediated synaptic plasticity selected from the group consisting of amnesia.
  • the PTPsigma-Fc fusion protein of the present invention can be used for the prevention or treatment of PTPsigma-mediated autoimmune diseases such as rheumatoid arthritis or multiple sclerosis.
  • the PTPsigma-Fc fusion protein of the present invention is used for protein-protein interaction, it is possible to overcome problems such as strength, selectivity, and cell membrane permeability inherent in small molecule inhibitors targeting the active site of PTP. .
  • problems such as strength, selectivity, and cell membrane permeability inherent in small molecule inhibitors targeting the active site of PTP. .
  • it is possible to improve the solubility of aqueous solutions by introducing mutations into the PTPsigma-Fc fusion protein, it is expected that high doses can be treated for human and animal treatment.
  • composition of the present invention may include a pharmaceutically acceptable carrier in addition to the PTPsigma-Fc fusion protein.
  • the pharmaceutically acceptable carriers are those commonly used in formulation, and include lactose, dextrose, sucrose, sorbitol, mannitol, starch, gum acacia, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like.
  • the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetening agent, a flavoring agent, an emulsifying agent, a suspending agent, a preservative, and the like, in addition to the above components.
  • composition comprising the PTPsigma-Fc fusion protein of the present invention may be administered orally or parenterally, and in the case of parenteral administration, intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, It can be administered by intrapulmonary administration and rectal administration.
  • compositions comprising the PTPsigma-Fc fusion protein of the present invention can be prepared according to a conventional method, such as a sterile injection solution, a lyophilized formulation, a pre-filled syringe solution, an oral formulation, an external application or a suppository, etc. It can be formulated in the form of Since the protein or peptide is digested upon oral administration, oral compositions may be formulated to coat the active agent or to protect it from degradation in the stomach.
  • a suitable dose of the PTPsigma-Fc fusion protein of the present invention varies depending on factors such as formulation method, administration method, patient's age, weight, sex, medical condition, food, administration time, administration route, excretion rate, and response sensitivity. can be prescribed.
  • the daily dose of the PTPsigma-Fc fusion protein may be, for example, 0.001 to 100 mg/kg.
  • the present invention also relates to a method for preventing or treating a PTPsigma-mediated disease, wherein the method may include administering a pharmaceutical composition comprising a PTPsigma-Fc fusion protein.
  • the present invention also relates to a method for promoting regeneration of blood stem cells, the method may include administering a pharmaceutical composition comprising a PTPsigma-Fc fusion protein.
  • the method may be for promoting regeneration of blood stem cells damaged by radiation or anticancer drug administration in cancer patients.
  • the administration target may be a subject, specifically, an individual requiring administration of the PTPsigma-Fc fusion protein, and the subject may be an animal, typically a mammal.
  • the expression vector was constructed to have a polyhistidine tag at the C-terminus of the protein based on pcDNA 3.1 / Myc His-A (Invitrogen).
  • the polynucleotide encoding the amino acid sequence of the target protein was amplified by PCR and cloned using restriction enzymes and ligases. Through this, an Fc expression vector expressing sequences 221 to 447 of human immunoglobulin G1 (IgG1) heavy chain including the signal peptide of human immunoglobulin G1 heavy chain was constructed. At this time, the amino acid sequence number of the Fc protein is based on 'EU numbering'.
  • a restriction enzyme recognition sequence was inserted into the vector through mutagenesis, and nucleotides encoding sequences 30 to 231 of Uniprot Q133332-7 PTPsigma were inserted. Through this, a PTPsigma-Fc expression vector was constructed.
  • FIG. 4 The amino acid sequence encoded by the PTPsigma-Fc expression vector is shown in FIG. 4 .
  • a portion indicated by a dotted line corresponds to the PTPsigma-derived protein (SEQ ID NO: 1), and a portion indicated by a straight line underlined corresponds to IgG1 221 to 447 (SEQ ID NO: 2) of the Fc domain.
  • a PTPsigma-Fc-knob expression vector was prepared by changing the nucleotide sequence to form a knob due to the T366W mutation.
  • the nucleotide sequence was changed to form holes due to T366S, L368A, and Y407V mutations in the sequences 221 to 447 of the IgG1 heavy chain, thereby preparing an Fc-hole expression vector encoding the following amino acid sequence.
  • FIG. 5 shows the amino acid sequences encoded by the PTPsigma-Fc-knob expression vector (a) and the Fc-hole expression vector (b).
  • the portion indicated by the dotted line underlined corresponds to the PTPsigma-derived protein (SEQ ID NO: 1)
  • the portion indicated by the straight line underlined corresponds to the knob or hole variant of IgG1 221 to 447 (SEQ ID NO: 2) of the Fc domain.
  • Mutated residues are marked with an asterisk.
  • Each protein was transiently expressed by transfecting the expression vector into ExpiCHOTM cells.
  • the transfection was carried out under the conditions of an initial cell density of 6 x 10 6 cells/mL and an expression vector concentration of 0.8 ⁇ gDNA/mL. was used according to
  • centrifugation was performed to separate the cells into a cell culture medium containing each protein and cells.
  • Affinity chromatography using a Ni-NTA (Qiagen) column was performed to separate target proteins from a culture medium containing each recombinant protein.
  • the Ni-NTA column was filled with a buffer solution containing 50 mM Tris-HCl pH 7.5 and 200 mM NaCl, and the culture solution obtained through centrifugation was filtered with a 0.45 ⁇ m filter paper and added. After completion of the reaction with the culture medium, the column was sequentially washed with a buffer solution containing 50 mM Tris-HCl pH 7.5 and 500 mM NaCl and a buffer solution containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl and 30 mM imidazole.
  • the protein bound to the column was eluted. After elution, the composition of the buffer solution containing the protein was replaced with phosphate buffered saline (PBS) using a HitrapTM Desalting (GE healthcare) column.
  • PBS phosphate buffered saline
  • FIG. 6 shows SDS-PAGE results of homodimer and heterodimer proteins formed in Preparation Example 1.
  • A is the result for the PTPsigma-Fc homodimer
  • B is the result for the PTPsigma-Fc-knob:Fc-hole heterodimer.
  • the yield was about 6 mg/L, and it was confirmed that the PTPsigma-Fc-knob:Fc-hole heterodimer was formed with a purity of about 85%.
  • hematopoietic stem cells As cells for the measurement of colony-forming ability of hematopoietic stem cells, commercially available human CD34+ hematopoietic stem cells (STEMCELL Technologies) were used.
  • StemSpan TM SFEM, StemSpan TM CD34+ Expansion Supplement (10X) (STEMCELL Technologies) was used according to the manufacturer's instructions, and the human CD34+ hematopoietic stem cells were cultured immediately after thawing at 37° C. and a carbon dioxide concentration of 5%.
  • the colony forming ability was measured using a CytoSelect TM 96-Well Hematopoietic Colony Forming Cell Assay (Cell Biolabs) kit product. Specifically, the reagent of the colony formation performance measurement kit was mixed with hematopoietic stem cells cultured at 37°C and carbon dioxide concentration of 5% for 9 days after irradiation, and then at 355nm / 460nm wavelength using a Victor X2 (Perkin-Elmer) plate meter. Fluorescence was measured.
  • the PTPsimga-Fc fusion protein of the present invention can be used to effectively restore damaged hematopoietic stem cells after radiotherapy in cancer patients.
  • the mutation was designed based on the tertiary structure of PTPsigma, and at this time, the mutation did not impair the CSPG binding ability of PTPsigma, so that the inhibitory effect of PTPsigma was not affected.
  • Residues of the Ig1-2 tertiary structure of the PTPsigma extracellular domain were analyzed one by one with the PyMOL program, and residues with a large solvent accessible surface area and hydrophobicity were selected. Among them, residues that can affect the structure when mutations are introduced because they interact with residues in the structure were excluded.
  • FIG. 9 shows that the Ig1-2 and sucrose octasulfate complex structure of PTP-lar and the tertiary structure of PTPsigma Ig1-2 are superimposed.
  • amino acids were changed to hydrophilic amino acids to improve solubility, and a mutant consisting of one or more amino acid combinations among them was used. Mutation to a hydrophilic amino acid was performed by selecting one of A, S, T, N, Q, D, E, K, R and H amino acids, and the mutation positions and residues are shown in Table 1 below. In Table 1, the numbering of amino acid residues is based on the amino acid sequence number of PTPsigma.
  • Variant No. mutant residue One L143N, V145T, Y224N 2 L143A, V145A, Y224A 3 L143N, V145T, Y224N, V104T, V108T, L155N, L187N 4 V104T, V108T, L155N, L187N 5 L143N, V145T, Y224N, V104T 6 L143N, V145T, Y224N, V108T 7 L143N, V145T, Y224N, L155N 8 L143N, V145T, Y224N, L187N 9 L143A, V145A, Y224A, V104A, V108A, L155A, L187A 10 V104A, V108A, L155A, L187A 11 L143A, V145A, Y224A, V104A 12 L143A, V145A, Y224A, V108A 13 L143A, V145A, Y224A, L155A 14 L143A, V145A, Y224A
  • the portion indicated by a dotted line corresponds to each variant sequence of sequences 30 to 231 (SEQ ID NO: 1) of PTPsigma, a protein derived from PTPsigma, and the portion indicated by a straight line underlined Fc domain IgG1 221 to 447 (SEQ ID NO: 2) or a knob variant thereof. Residues mutated in the parent are marked with an asterisk.
  • At least one residue among 136, V104, V108, L125, L143, L145, L155, L187, Y224 and V227 is A, S, T, N, Q, D, E, K, R or In the case of the mutant substituted with H, it was confirmed that the solubility in aqueous solution was improved compared to the wild type, and the tendency to improve the yield was also confirmed.
  • hematopoietic stem cells As cells for the measurement of colony-forming ability of hematopoietic stem cells, commercially available human CD34+ hematopoietic stem cells (STEMCELL Technologies) were used.
  • StemSpan TM SFEM and StemSpan TM CD34+ Expansion Supplement (10X) were used according to the manufacturer's instructions and cultured at 37° C. and a carbon dioxide concentration of 5%.
  • FIG. 29 For the PTPsigma-Fc fusion protein wild type and the PTPsigma-Fc fusion protein containing L155N and L187N mutations, the results of measuring the hematopoietic stem cell damage recovery effect by the anticancer agent by the above method are shown in FIG. 29 .
  • 5FU- indicates a control without the addition of 5FU
  • 5FU + indicates a sample to which 5FU was added
  • 2N is a sample to which 5FU was added
  • wt means a sample treated with PTPsigma-Fc fusion protein (wild type) to a sample to which 5FU is added.
  • hematopoietic stem cells are severely damaged when the anticancer agent (5FU) is treated, but the damaged hematopoietic stem cells when the anticancer agent and the PTPsigma mutant-Fc fusion protein are treated together are similar to the control when the anticancer agent is not treated. recovery was confirmed.
  • the PTPsimga-Fc fusion protein of the present invention can be used to effectively regenerate damaged hematopoietic stem cells after treatment with anticancer drugs in cancer patients.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)

Abstract

본 발명은 PTPsigma(Protein Tyrosine Phosphatase sigma) 유래의 단백질 및 면역글로불린(Immunoglobulin, Ig) 유래의 Fc 도메인을 포함하여, PTPsigma의 세포외도메인과 리간드의 상호작용을 차단함으로써 PTPsigma의 신호전달을 억제할 수 있는 PTPsigma-Fc 융합단백질에 관한 것이다. 본 발명의 PTPsigma-Fc 융합단백질은 PTPsigma 매개의 신호전달을 저해하여 혈액줄기세포 생장을 촉진할 수 있고, PTPsigma 매개성 질환의 예방 또는 치료에 이용될 수 있다. 본 발명에 따른 PTPsigma-Fc 융합단백질은 단백질 간의 상호작용을 이용하여 PTPsigma의 신호전달을 조절하므로 종래 PTP의 활성부위를 타겟으로 하는 저해제들의 문제를 극복할 수 있다. 또한, 융합단백질에 돌연변이를 도입하여 수용액 용해도를 향상시킴으로써 인체 및 동물 치료 시 고용량으로 처리할 수 있다.

Description

PTPSIGMA-FC 융합단백질 및 이를 포함하는 약학 조성물
본 발명은 PTPsigma-Fc 융합단백질 및 이를 포함하는 약학 조성물에 관한 것으로, 보다 상세하게는 PTPsigma의 세포외도메인과 리간드의 상호작용을 방해함으로써 혈액줄기세포 생장 촉진 및 PTPsigma 매개성 질환의 예방 또는 치료에 이용될 수 있는 PTPsigma-Fc 융합단백질 및 이를 포함하는 약학 조성물에 관한 것이다.
단백질은 세포 내 기능 조절을 위한 신호 전달에 매우 중요한 역할을 담당한다. 단밸질에 의한 신호 전달은 단백질의 양 또는 활성 조절을 통해 이루어지며, 단백질의 활성화 또는 비활성화 유도를 위해 인산화(phosphorylation), 당화(glycosylation), 메틸화(methylation), 아세틸화(acetylation) 등 다양한 변형이 일어난다.
이 중에서, 단백질 인산화는 세포성장, 분화, 면역반응, 뇌기능 등의 여러 가지 세포현상의 조절에 핵심적인 역할을 한다. 단백질 인산화의 부적절한 컨트롤은 암, 당뇨병, 면역질환, 신경계질환 등 많은 질병의 원인이 된다.
따라서 단백질의 인산화와 탈인산화를 조절하는 단백질 인산화효소(protein kinases)와 단백질 탈인산화효소(protein phosphatases)는 질병 치료제의 개발에 중요한 표적단백질이 된다. 단백질 인산화효소의 저해제들은 이미 임상에서 질병 치료제로서의 효능이 증명된 한편, 단백질 탈인산화효소를 표적으로 하는 질병 치료제 연구는 최근 활발히 진행되고 있으며, 아직까지 임상에서 성공적인 치료제는 보고되지 않고 있다.
단백질 타이로신 탈인산화효소(Protein Tyrosine Phosphatase, PTP)는 인산화된 타이로신 잔기에 있는 인산기를 가수분해시키는 효소이다. 타이로신의 인산화-탈인산화 과정은 세포내 신호전달 체계에서 매우 중요한 수단으로 이용되며, 특히 세포 외부의 자극에 의한 세포의 반응, 세포의 성장, 분화 및 사멸에 핵심적인 역할을 하고 있다. 따라서, 상기와 같은 세포상태의 변화를 수반하는 암, 혈관질환, 면역질환 및 신경질환 등의 질환의 치료 표적 단백질로 PTP가 중요한 위치를 차지하고 있다. PTP 저해제의 예로서, 대한민국 등록특허공보 제10-1194968호는 1,1'-(1,2-에틴디일)비스-벤젠유도체를 이용하여 PTP1B의 활성을 저해함으로써 당뇨병과 같은 PTP1B 매개성 질환을 예방 또는 치료하는 기술을 기재하고 있으며, 대한민국 등록특허공보 제10-1826690호에서는 PTP1B, TC-PTP, SHP2, LYP 및 RPTPβ를 타겟으로 하는 PTP 억제제를 이용한 신경염증성 질환 치료제를 기재하고 있다.
이러한 종래의 PTP 저해제 개발은 주로 PTP 효소의 활성부위를 표적으로 하였다. 그런데, PTP 활성부위 포켓은 비교적 깊이가 얕고 저해제 화합물과 강한 상호작용을 할 수 있는 부분이 좁으며, PTP 간의 효소 반응 도메인이 유사하기 때문에 저해제 화합물이 선택성을 갖기 어렵다. 또한, PTP 활성부위 포켓은 양전하를 띠고 있으므로 여기에 결합하는 화합물들은 PTP 효소의 기질인 인산기를 모방하기 위해서 음전하를 띠게 되는데, 이와 같이 전하를 갖고 있는 화합물들은 세포막을 통과하는데 어려움이 있다.
즉, PTP 활성부위를 표적으로 하는 종래 PTP 저해제들은 효소기능 저해 강도, 선택성, 세포막 투과성 등의 관점에서 최적화하기 어렵다는 한계가 있었다. 이에 따라, 이러한 한계를 극복할 수 있는 치료제의 개발이 요구되고 있다.
한편, PTPsigma와 같은 수용체 타입 PTP는 활성부위 외에도 세포외도메인(엑토도메인, ectodomain)과 리간드의 수용체-리간드 상호작용에 의해 신호전달이 이루어질 수 있다. PTPsigma의 수용체-리간드 상호작용은 신경세포 재생 억제와 같은 신호전달에 관여하는 것으로 알려져 있으며, PTPsigma 매개성 질환으로서 파킨슨병 등이 알려져 있다.
이러한 상황에서, 본 발명의 발명자들은 종래 PTP 저해제 화합물들의 효소기능 저해 강도, 선택성, 세포막 투과성 등의 한계를 극복할 수 있는 PTPsigma 저해제를 개발하기 위해 연구하였다. 그 결과, 단백질간의 상호작용을 이용하여 PTPsigma의 세포외도메인에서 일어나는 수용체-리간드 상호작용을 방해함으로써 PTPsigma의 신호전달을 억제할 수 있으면서 종래 PTP 저해제 화합물들의 한계를 극복할 수 있는 PTPsigma-Fc 융합단백질을 개발하였다.
본 발명의 목적은 PTPsigma의 세포외도메인과 리간드의 상호작용을 차단함으로써 PTPsigma의 신호전달을 억제할 수 있는 PTPsigma-Fc 융합단백질을 제공하는 것이다.
본 발명의 다른 목적은 상기 PTPsigma-Fc 융합단백질을 포함하는 혈액줄기세포 생장 촉진용 조성물을 제공하는 것이다.
본 발명의 다른 목적은 상기 PTPsigma-Fc 융합단백질을 포함하는 PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물을 제공하는 것이다.
상기 목적을 달성하기 위해, 본 발명은 면역글로불린(Immunoglobulin, Ig) 유래의 Fc 도메인을 구성하는 2개의 사슬 중 하나 이상의 사슬에 PTPsigma(Protein Tyrosine Phosphatase sigma) 유래의 단백질이 연결된, PTPsigma-Fc 융합단백질을 제공한다.
본 발명에서, 상기 PTPsigma 유래 단백질은 PTPsigma의 세포외도메인(ectodomain) 유래의 단백질일 수 있다.
본 발명에서, 상기 PTPsigma 유래 단백질은 PTPsigma의 세포외도메인 중 첫째-둘째 Ig 도메인(Ig1-2) 또는 첫째-셋째 Ig 도메인(Ig1-3) 유래의 단백질일 수 있다.
본 발명에서, 상기 PTPsigma 유래 단백질은 PTPsigma 단백질의 30 내지 231번 아미노산 잔기를 포함할 수 있다.
본 발명에서, 상기 PTPsigma 유래 단백질 중 이소류신(I), 발린(V), 류신(L) 및 타이로신(Y) 중 하나 이상의 잔기가 알라닌(A), 세린(S), 트레오닌(T), 아스파라긴(N), 글루타민(Q), 아스파르트산(D), 글루탐산(E), 리신(K), 아르기닌(R) 또는 히스티딘(H)으로 치환될 수 있다.
본 발명에서, PTPsigma 단백질의 아미노산 서열 번호를 기준으로 I36, V104, V108, L125, L143, L145, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A, S, T, N, Q, D, E, K, R 또는 H로 치환될 수 있다.
본 발명에서, 상기 PTPsigma 유래 단백질은 동형이량체(homodimer) 또는 이형이량체(heterodimer) 형태일 수 있다.
본 발명에서, 상기 Fc 도메인을 구성하는 사슬은 (Kabat EU 넘버링 기준) IgG1 중쇄의 221 내지 447번 아미노산 잔기를 포함할 수 있다.
본 발명에서, 상기 Fc 도메인 중 하나의 사슬에서 하나 이상의 아미노산이 트립토판(W), 아르기닌(R), 페닐알라닌(F) 및 타이로신(Y)으로 구성된 군에서 선택된 아미노산으로 치환되고, 다른 하나의 사슬에서, 하나 이상의 아미노산이 알라닌(A), 세린(S), 트레오닌(T) 및 발린(V)으로 구성된 군에서 선택된 아미노산으로 치환될 수 있다.
본 발명에서, 상기 Fc 도메인 중 하나의 사슬이 (Kabat EU 넘버링 기준) T366W 치환을 포함하고, 다른 하나의 사슬이 (Kabat EU 넘버링 기준) T366S, L368A 및 Y407V 치환을 포함할 수 있다.
본 발명은 또한, 상기 PTPsigma-Fc 융합단백질을 포함하는 혈액줄기세포 생장 촉진용 조성물을 제공한다.
본 발명에서, 상기 혈액줄기세포 생장 촉진용 조성물은 방사선 조사 또는 항암제 투여에 의해 손상된 혈액줄기세포를 재생하기 위한 것일 수 있다.
본 발명은 또한, 혈액줄기세포 생장을 촉진하는 방법으로서, PTPsigma-Fc 융합단백질을 포함하는 약학 조성물을 투여하는 단계를 포함하는 방법을 제공한다.
본 발명은 또한, 상기 PTPsigma-Fc 융합단백질을 포함하는 약학 조성물을 제공한다.
본 발명에서, 상기 약학 조성물은 PTPsigma 매개성 질환의 예방 또는 치료용일 수 있다.
본 발명에서, 상기 PTPsigma 매개성 질환은 외상성 뇌손상(traumatic brain injury), 알츠하이머성 치매 및 파킨슨병으로 구성된 군에서 선택되는 신경손상 질환일 수 있다.
본 발명에서, 상기 PTPsigma 매개성 질환은 다발성 경화증(multiple sclerosis) 및 류마티스 관절염으로 구성된 군에서 선택될 수 있다.
본 발명에서, 상기 PTPsigma 매개성 질환은 조증, 우울증, 조울증 및 기억장애증으로 구성된 군에서 선택되는 시냅스 가소성 관련 질환일 수 있다.
본 발명은 또한, PTPsigma 매개성 질환을 예방 또는 치료하는 방법으로서, PTPsigma-Fc 융합단백질을 포함하는 약학 조성물을 투여하는 단계를 포함하는 방법을 제공한다.
본 발명에서는 PTPsigma의 유래 단백질을 면역글로불린의 Fc 영역에 결합한 융합단백질을 이용함으로써 PTPsigma의 세포외도메인과 리간드의 반응을 차단할 수 있다. 본 발명에 따르면, 단백질 간의 상호작용을 이용한 조절제를 사용하므로 종래 PTP의 활성부위를 타겟으로 하는 저해제들의 효소기능 저해 강도, 선택성, 세포막 투과성 등의 한계를 극복할 수 있다. 또한, 융합단백질에 돌연변이를 도입하여 수용액 용해도를 향상시킴으로써 인체 및 동물 치료 시 고용량으로 처리할 수 있다.
본 발명의 PTPsigma-Fc 융합단백질은 PTPsigma 매개의 신호전달을 저해하여 혈액줄기세포 생장을 촉진할 수 있고, PTPsigma 매개성 질환의 예방 또는 치료에 이용될 수 있다.
도 1은 본 발명의 PTPsigma-Fc 융합단백질의 동형이량체(a) 및 이형이량체(b)의 모식적인 설계를 나타낸 것이다.
도 2는 본 발명의 일 실시 형태에 따른 PTPsigma-Fc 융합단백질의 아미노산 서열 지도를 나타낸 것이다.
도 3은 본 발명의 일 실시 형태에 따른 PTPsigma-Fc 융합단백질의 용해도 향상 돌연변이체의 아미노산 서열 지도를 나타낸 것이다.
도 4는 본 발명의 일 실시예에 따른 PTPsigma-Fc 동형이량체를 제조하기 위한 발현 벡터가 코딩하는 아미노산 서열을 나타낸 것이다.
도 5는 본 발명의 일 실시예에 따른 PTPsigma-Fc 이형이량체를 제조하기 위한 발현 벡터가 코딩하는 아미노산 서열을 나타낸 것이다.
도 6은 본 발명의 일 실시예에 따른 PTPsigma-Fc 융합단백질 제조 후 비환원 SDS-PAGE 결과를 나타낸다.
도 7은 본 발명의 일 실시예에 따른 PTPsigma-Fc 융합단백질에 의한 조혈줄기세포 재생 효과를 나타낸 그래프이다.
도 8은 PTPsigma Ig1-2의 삼차구조에서 돌연변이 대상 잔기들의 위치를 나타낸 것이다.
도 9는 PTP-lar의 Ig1-2와 sucrose octasulfate 복합체 구조 및 PTPsigma Ig1-2의 삼차구조를 중첩한 구조를 나타낸다.
도 10 내지 27은 본 발명의 실시예에 따른 PTPsigma 변이체-Fc 발현 벡터가 코딩하는 아미노산 서열을 나타낸 것이다.
도 28은 본 발명의 일 실시예에 따른 PTPsigma-Fc 융합단백질의 수율 및 용해도를 나타낸 그래프이다.
도 29는 본 발명의 일 실시예에 따른 PTPsigma-Fc 융합단백질에 의한 조혈줄기세포 재생 효과를 나타낸 그래프이다.
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로, 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명은 PTPsigma의 세포외도메인과 리간드의 수용체-리간드 상호작용을 차단함으로써 PTPsigma의 신호전달을 억제할 수 있는 PTPsigma-Fc 융합단백질에 관한 것이다.
PTPsigma(Protein Tyrosine Phosphatase sigma)는 세포막을 관통하는 수용체형(transmembrane receptor type) PTP로서, 세포외도메인(엑토도메인, ectodomain) 부위, 세포막 통과 부위 및 세포질 부위의 세 부위로 이루어져 있다. 이 중, 세포외도메인은 N-말단(N-terminal)에서 시작하여 3개의 Ig 유사(Ig-like) 도메인과 뒤이은 여러 개의 피브로넥틴 도메인으로 이루어져 있다. 세포외도메인 부위는 수용체-리간드 상호작용을 하고, 이러한 상호작용이 세포질 부위로 전달되어서 PTP 활성 도메인의 효소활성을 조절한다.
본 발명의 발명자들은 PTPsigma의 세포외도메인 중 Ig 유사 도메인이 수용체-리간드 상호작용에 관여할 것이라는 가정 하에, 상기 Ig 유사 도메인을 면역글로불린의 Fc 영역에 융합시켜 PTPsigma-Fc 융합단백질을 제작하고, 상기 융합단백질의 PTPsigma 저해능을 시험하였다. 그 결과, 방사선 처리된 혈액줄기세포에 상기 융합단백질을 처리한 경우 혈액줄기세포가 효과적으로 재생되는 것을 확인하였다. 이로써 본 발명의 PTPsigma-Fc 융합단백질이 PTPsigma의 혈액줄기세포 재생을 촉진할 수 있음을 발견하였다.
이에 따라, 본 발명의 PTPsigma-Fc 융합단백질은 혈액줄기세포 생장 촉진용 조성물에 이용될 수 있으며, 그 외에도 종래의 PTPsigma 저해제와 같이 신경손상질환, 자가면역 질환, 시냅스 가소성 관련 질환 등의 PTPsigma 매개성 질환에 대한 치료제로 이용될 수 있다.
또한, 상기 융합단백질의 용해도를 향상시키기 위하여, 상기 PTPsigma의 Ig-유사 도메인의 표면에 노출되어 있는 소수성 아미노산 중 구조에 변화를 주지 않는 아미노산 잔기를 선정하고 이를 친수성 아미노산으로 치환한 결과, 융합단백질의 용해도가 상승하면서도 혈액줄기세포 재생 효과가 유지되는 것을 확인하였다.
본 발명의 PTPsigma-Fc 융합단백질은 PTPsigma 유래 단백질 및 Fc 도메인을 포함한다.
도 1은 본 발명에 따른 PTPsigma-Fc 융합단백질의 모식적인 설계를 나타낸 것이다. 도 1에서, (a)는 Fc 도메인의 양쪽 사슬에 모두 PTPsigma 유래 단백질이 연결된 동형이량체(homodimer) 구조를 나타내고, (b)는 Fc 도메인의 한쪽 사슬에만 PTPsigma 유래 단백질이 연결된 이형이량체(heterodimer) 구조를 나타낸다.
본 발명에서, 상기 PTPsigma 유래 단백질의 모체는 PTPsigma 단백질의 표준 아미노산 서열 뿐만 아니라 이의 아이소폼(isoform)까지 포함하는 의미로 해석된다. 상기 PTPsigma 단백질의 표준 서열은 Unitprot 기준으로 Isoform 1 (Q13332-1)을 의미하며, 다른 아이소폼으로는 Isoform PTPS-MEA (Q13332-2), Isoform PTPS-MEB (Q13332-3), Isoform PTPS-MEC (Q13332-4), Isoform PTPS-F4-7 (Q13332-5), Isoform 2 (Q13332-6) 및 Isoform 3 (Q13332-7)가 있으며, 바람직한 모체 서열은 PTPsigma Isoform 3의 서열일 수 있다.
본 발명에서, 상기 PTPsigma 유래 단백질은 PTPsigma의 세포외도메인(ectodomain) 유래의 단백질일 수 있다. 이 때, PTPsigma의 세포외도메인 유래의 단백질이란 PTPsigma의 세포외도메인 서열의 전부 또는 일부를 포함하는 것을 의미한다.
특히, 본 발명에서 PTPsigma의 세포외도메인 유래의 단백질은 세포외도메인의 Ig 유사(Ig-like) 도메인 유래의 단백질인 것이 바람직하고, 그 중 첫째-둘째 Ig 유사 도메인(Ig1-2), 또는 첫째-셋째 Ig 유사 도메인(Ig1-3) 유래의 단백질인 것이 더 바람직하다.
본 발명의 일 실시 형태에서, 상기 PTPsigma 유래 단백질은 PTPsigma 세포외도메인의 Ig1-2 유래의 아미노산 서열로서, PTPsigma 단백질의 30 내지 231번 서열을 포함할 수 있다. 이 때, 상기 아미노산 서열 번호는 PTPsigma 단백질의 Isoform 3 (Q13332-7)를 기준으로 한 것이다.
구체적으로, 상기 PTPsigma 유래 단백질은 PTPsigma 단백질의 30 내지 231번 서열로서 아래 서열번호 1의 아미노산 서열을 포함할 수 있다.
[서열번호 1]
EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVA
본 발명의 일 실시 형태에서, 상기 PTPsigma 유래 단백질은 PTPsigma 세포외도메인의 Ig1-3 유래의 아미노산 서열로서, PTPsigma 단백질의 30 내지 321번 서열을 포함할 수 있다.
상기 PTPsigma 단백질의 30 내지 321번 서열은 상기 서열번호 1의 아미노산 서열에 PTPsigma 단백질의 232번 내지 321번 서열이 이어진 서열로, 아래와 같이 나타낼 수 있다.
[PTPsigma 단백질의 30 내지 321번 서열]
EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKA
본 발명의 PTPsigma-Fc 융합단백질에서, PTPsigma 유래 단백질에는 융합단백질의 수용액 용해도를 향상시키기 위한 PTPsigma 변이체(mutant)가 형성될 수 있다.
본 발명에서, 용어 "변이"는 아미노산 잔기의 치환, 삽입 및/또는 결실을 포함하는 의미로, 바람직하게, 본 발명의 변이체는 아미노산 잔기의 치환을 포함한다. 아미노산 잔기의 치환은 모체 아미노산 서열의 잔기, 아미노산 잔기의 번호 및 치환된 아미노산 잔기의 순서로 나타낼 수 있다.
본 발명과 같이 Ig 유사 도메인을 포함하는 융합단백질은 수용액 용해도가 높지 않아, 동물이나 인체에 고용량으로 처리하는데 어려움이 있다. 이러한 문제를 해결하기 위하여, 본 발명에서는 PTPsigma의 Ig 유사 도메인 표면에 노출되어 있는 소수성 아미노산 중에서 구조를 변형시키지 않는 아미노산들을 선정하고, 이들을 친수성 아미노산으로 치환하여 용해도를 향상시켰다.
구체적으로, 융합단백질의 용해도 향상을 위한 PTPsigma 변이체는 상기 PTPsigma 유래의 단백질에서 이소류신(I), 발린(V), 류신(L) 및 타이로신(Y) 중 하나 이상의 잔기가 알라닌(A), 세린(S), 트레오닌(T), 아스파라긴(N), 글루타민(Q), 아스파르트산(D), 글루탐산(E), 리신(K), 아르기닌(R) 또는 히스티딘(H)으로 치환된 것일 수 있다.
그 중에서도, PTPsigma의 구조에 영향을 주지 않는 측면에서 PTPsigma의 30 내지 231번 서열 중 I36, V104, V108, L125, L143, L145, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A, S, T, N, Q, D, E, K, R 또는 H로 치환되는 것이 바람직하며, 용해도 향상 측면에서 L143, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A 또는 N로 치환되는 것이 더 바람직하다.
즉, 본 발명의 서열번호 1의 아미노산 서열을 기준으로 하였을 때, PTPsigma 서열 중 30번 잔기가 서열번호 1의 1번 잔기에 해당하므로, 서열번호 1에서는 I7, V75, V79, L96, L114, L116, L126, L158, Y195 및 V198 중 하나 이상의 잔기가 A, S, T, N, Q, D, E, K, R 또는 H로 치환될 수 있으며, 더 바람직하게는, 서열번호 1에서 L114, L126, L158, Y195 및 V198 중 하나 이상의 잔기가 A 또는 N으로 치환될 수 있다.
본 발명의 실험예에서는 상기 돌연변이에 의해 융합단백질의 수용액 용해도가 최대 6배 수준으로 상승하면서, 혈액줄기세포 재생 촉진 효과가 우수한 것을 확인하였다. 이에 따라, 상기 돌연변이가 도입된 PTPsigma-Fc 융합단백질은 혈액줄기세포 재생 촉진용 조성물로 사용될 수 있으면서, 인체 및 동물 치료 시 고용량 처리가 가능할 것으로 기대된다.
본 발명에서, 상기 PTPsigma 유래 단백질은 면역글로불린 유래의 Fc 도메인에 연결되어, PTPsigma-Fc 융합단백질을 형성한다.
본 발명에서, 상기 면역글로불린 유래의 Fc 도메인이란 면역글로불린의 중쇄불변영역 중 CH2 및 CH3 도메인(또는, CH2, CH3 및 CH4 도메인)을 포함하는 C-말단 영역을 의미하며, 야생형(wild-type) Fc 도메인 및 그의 변이체를 포괄하는 의미로 사용된다. 상기 Fc 도메인의 모체가 되는 면역글로불린은 IgG1, IgG2, IgG3, 또는 IgG4일 수 있으며, 바람직하게는 IgG1일 수 있다.
본 발명에서, 상기 Fc 도메인의 각 사슬은 인간 IgG1 중쇄의 221번 잔기로부터 C-말단에 이르는 영역, 또는 상기 영역에 힌지를 더 포함하는 영역을 포함할 수 있다. Fc 영역에서 아미노산 잔기의 번호는 인간 면역글로불린 중쇄 내의 잔기 번호를 정의하는 Kabat EU 넘버링에 따른다.
본 발명에서, 상기 Fc 도메인의 각 사슬은 IgG1의 중쇄 221 내지 447번 서열을 포함할 수 있다. 상기 IgG1의 중쇄 221 내지 447번 서열은 아래 서열번호 2의 아미노산 서열로 나타낼 수 있다.
[서열번호 2]
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
본 발명에서, 상기 PTPsigma 유래 단백질은 Fc 도메인을 구성하는 2개의 사슬 중 하나 이상의 사슬에 연결된 형태일 수 있다.
이 때, 상기 PTPsigma 유래 단백질과 Fc 도메인은 0 내지 20개의 아미노산 잔기에 의해 연결될 수 있다. 즉, 상기 PTPsigma 유래 단백질과 Fc 도메인은 직접적으로 연결되거나, 1 내지 20개의 아미노산으로 이루어진 링커(linker)를 통해 연결될 수 있다. 이 때, 상기 PTPsigma-Fc 유래 단백질은 Fc 도메인의 N-말단 또는 C-말단에 연결될 수 있다.
본 발명의 PTPsigma-Fc 융합단백질은 Fc 도메인의 양쪽 사슬에 PTPsigma 유래 단백질이 연결된 동형이량체, 또는 한쪽 사슬에만 PTPsigma 유래 단백질이 연결된 이형이량체일 수 있다.
본 발명의 일 실시 형태에서, PTPsigma-Fc 융합단백질이 이형이량체인 경우, Fc 도메인에 이합체를 형성하기 위한 재조합 변이체가 형성될 수 있다.
예를 들어, 상기 이합체를 형성하기 위한 재조합 변이체로는 놉-인투-홀(knobs-into-hole) 기술을 이용할 수 있다.
상기 놉-인투-홀 기술은 항체 단편의 중쇄 사이에 이종이합체 만이 형성되게 하기 위하여 설계된 기술이다. 여기에서, 놉(knob)은 반대측 사슬로 돌출된 측쇄를 가지도록 설계되어, 반대측 도메인의 홀(hole)에 삽입된다. 이로 인하여, 중쇄들은 측쇄 충돌로 인하여 동종이합체화(homodimerization) 될 수 없고, 이종이합체화(heterodimerization) 만이 가능하게 된다. 본 발명에서, Fc 도메인의 각 사슬에 놉 또는 홀이 형성된 구조를 각각 Fc-knob 또는 Fc-hole이라 할 수 있다.
상기 Fc-knob은 Fc 도메인을 구성하는 사슬에서 하나 이상의 아미노산을 트립토판(W), 아르기닌(R), 페닐알라닌(F) 및 타이로신(Y)으로 구성된 군에서 선택되는 큰 아미노산으로 치환함으로써 형성될 수 있다. 예를 들어, Fc-knob은 IgG1-Fc 중쇄 221 내지 447번 서열에 T366W 변이가 형성된 것일 수 있다.
상기 Fc-hole은 Fc 도메인을 구성하는 사슬에서 하나 이상의 아미노산을 알라닌(A), 세린(S), 트레오닌(T) 및 발린(V)으로 구성된 군에서 선택되는 작은 아미노산으로 치환함으로써 형성될 수 있다. 예를 들어, Fc-hole은 IgG1-Fc 중쇄 221 내지 447번 서열에 T366S, L368A 및 Y407V 변이가 형성된 것일 수 있다.
도 2는 본 발명의 일 실시 형태에 따른 PTPsigma-Fc 융합단백질을 구성하는 폴리펩티드 체인의 아미노산 서열 지도를 나타낸 것이다.
도 2와 같이, 본 발명의 PTPsigma-Fc 융합단백질은 중쇄 신호 펩티드, PTPsigma의 30 내지 231번 서열, 및 IgG1 중쇄 221 내지 447번 서열로 이루어진 폴리펩티드를 포함할 수 있으며, 이로써 동형이량체 형태의 융합단백질을 형성할 수 있다. 또는, 본 발명의 PTPsigma-Fc 융합단백질은 중쇄 신호 펩티드, PTPsigma의 30 내지 231번 서열, 및 IgG1 중쇄 221 내지 447번 서열의 knob 변이체로 이루어진 폴리펩티드와, 중쇄 신호 펩티드 및 IgG1 중쇄 221 내지 447번 서열의 hole 변이체를 포함할 수 있으며, 이 경우 이형이량체 형태의 융합단백질을 형성할 수 있다.
도 3은 본 발명의 일 실시 형태에 따른 PTPsigma-Fc 융합단백질의 용해도 향상 돌연변이체, 즉 PTPsigma mutant-Fc 융합단백질의 아미노산 서열 지도를 나타낸 것이다.
도 3과 같이, 본 발명의 PTPsigma mutant-Fc 융합단백질은 중쇄 신호 펩티드, PTPsigma의 30 내지 231번 서열의 용해도 향상 변이체, 및 IgG1 중쇄 221 내지 447번 서열로 이루어진 폴리펩티드를 포함할 수 있으며, 이로써 동형이량체 형태의 융합단백질을 형성할 수 있다. 또는, 본 발명의 PTPsigma mutant-Fc 융합단백질은 중쇄 신호 펩티드, PTPsigma의 30 내지 231번 서열의 용해도 향상 변이체, 및 IgG1 중쇄 221 내지 447번 서열의 knob 변이체로 이루어진 폴리펩티드와, 중쇄 신호 펩티드 및 IgG1 중쇄 221 내지 447번 서열의 hole 변이체를 포함할 수 있으며, 이 경우 이형이량체 형태의 융합단백질을 형성할 수 있다.
본 발명에 따라 형성된 PTPsigma-Fc 융합단백질을 이용하면 PTPsigma의 세포외도메인과 리간드의 반응을 차단할 수 있으므로, PTPsigma에 의한 신호전달을 억제하는 저해제로 사용될 수 있다.
이에 따라, 본 발명은 또한, 상기 PTPsigma-Fc 융합단백질을 포함하는 조성물을 제공한다.
본 발명에서는 PTPsigma-Fc 융합단백질이 PTPsigma의 세포외도메인과 리간드의 수용체-리간드 상호작용을 차단하여, PTPsigma에 의한 혈액줄기세포 생장 저해 신호전달을 억제할 수 있다는 것을 확인하였다. 이에 따라, 본 발명의 PTPsigma-Fc 융합단백질은 혈액줄기세포의 생장을 촉진할 수 있고, 구체적으로는 방사선 조사 및 화학항암제 사용에 의하여 생장이 저해된 혈액줄기세포의 재생 촉진에 사용될 수 있다.
따라서, 본 발명의 PTPsigma-Fc 융합단백질은 방사선치료 및 화학항암제가 필요한 암환자들의 회복을 돕는데 효과적일 것으로 기대된다. 예를 들어, 췌장암, 간암, 유방암, 뇌암, 전립선암, 결장직장암, 폐암, 신장암, 신경모세포종, 난소암, 자궁내막암, 배아세포종, 안암, 다발골수종, 위암 등의 암을 앓고 있는 환자의 혈액줄기세포가 방사선치료 및/또는 항암제에 의해 손상되는 경우, 손상된 혈액줄기세포의 재생을 도와 암환자의 빠른 회복을 위한 치료제로 사용될 수 있다.
뿐만 아니라, PTPsigma의 세포외도메인은 콘드로이친 황산 프로테오글리칸(chondroitin sulfate proteoglycan, CSPG)과 상호작용을 통하여 신경세포 재생 방해 신호전달, 면역반응 활성화 신호전달 등에 관여하는 것으로 알려져 있는바, 본 발명의 PTPsigma-Fc 융합단백질은 PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물에 사용될 수 있다.
구체적으로, 본 발명의 PTPsigma-Fc 융합단백질은 외상성 뇌손상(traumatic brain injury), 알츠하이머성 치매, 파킨슨병 등의 PTPsigma 매개성 신경손상 질환의 예방 또는 치료에 사용될 수 있고, 조증, 우울증, 조울증 및 기억장애증으로 구성된 군에서 선택되는 PTPsigma 매개성 시냅스 가소성 관련 질환의 예방 또는 치료에 사용될 수 있다. 또한, 본 발명의 PTPsigma-Fc 융합단백질은 류마티스 관절염, 또는 다발성 경화증(multiple sclerosis)과 같은 PTPsigma 매개성 자가면역질환의 예방 또는 치료에 사용될 수 있다.
본 발명의 PTPsigma-Fc 융합단백질은 단백질-단백질 상호작용에 이용되므로, PTP의 활성부위를 타겟으로 하는 저분자 저해제들이 내재적으로 갖고 있는 효소저해기능 강도, 선택성, 세포막 투과성 등의 문제를 극복할 수 있다. 또한, 본 발명에서는 PTPsigma-Fc 융합단백질에 돌연변이를 도입하여 수용액 용해도를 향상시키는 것이 가능하므로, 인체 및 동물 치료 시 고용량으로 처리할 수 있을 것으로 기대된다.
본 발명의 조성물은 상기 PTPsigma-Fc 융합단백질 외에 약학적으로 허용가능한 담체를 포함할 수 있다.
상기 약학적으로 허용가능한 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다.
본 발명의 PTPsigma-Fc 융합단백질을 포함하는 조성물은 경구 또는 비경구로 투여할 수 있고, 비경구 투여인 경우에는 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 내피 투여, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있다.
본 발명의 PTPsigma-Fc 융합단백질을 포함하는 조성물은, 통상의 방법에 따라 멸균 주사용액, 동결건조(lyophilized) 제형, 사전 충전식 주사(pre-filled syringe) 용액제, 경구형 제형, 외용제 또는 좌제 등의 형태로 제형화될 수 있다. 경구 투여시, 단백질 또는 펩타이드는 소화가 되기 때문에 경구용 조성물은 활성 약제를 코팅하거나 위에서의 분해로부터 보호되도록 제형화 될 수 있다.
본 발명의 PTPsigma-Fc 융합단백질의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하게 처방될 수 있다. 예를 들어, 상기 PTPsigma-Fc 융합단백질의 1일 투여량은 예컨대 0.001 내지 100㎎/㎏일 수 있다.
본 발명은 또한, PTPsigma 매개성 질환을 예방 또는 치료하는 방법에 관한 것으로, 상기 방법은 PTPsigma-Fc 융합단백질을 포함하는 약학 조성물을 투여하는 단계를 포함할 수 있다.
본 발명은 또한, 혈액줄기세포의 재생을 촉진하는 방법에 관한 것으로, 상기 방법은 PTPsigma-Fc 융합단백질을 포함하는 약학 조성물을 투여하는 단계를 포함할 수 있다. 상기 방법은 암 환자에 있어서 방사선 조사 또는 항암제 투여에 의해 손상된 혈액줄기세포의 재생을 촉진하기 위한 것일 수 있다.
본 발명에서, 투여 대상은 개체(subject), 구체적으로는 PTPsigma-Fc 융합단백질 투여를 필요로 하는 개체일 수 있으며, 상기 개체는 동물일 수 있고, 통상적으로 포유동물일 수 있다.
실시예
이하 실시예를 통하여 본 발명을 보다 상세하게 설명한다. 단, 이들 실시예는 본 발명을 예시적으로 설명하기 위하여 일부 실험방법과 조성을 나타낸 것으로, 본 발명의 범위가 이러한 실시예에 제한되는 것은 아니다.
제조예 1: PTPsigma-Fc 융합단백질 제조
1-1. 발현 벡터 제작
발현 벡터는 pcDNA 3.1 / Myc His-A (Invitrogen)을 바탕으로 단백질의 C-말단에 폴리히스티딘 태그를 갖도록 제작되었다.
목표 단백질의 아미노산 서열을 코딩하는 폴리뉴클레오티드를 PCR 기법으로 증폭한 뒤 제한효소와 연결효소를 통해 클로닝하였다. 이를 통해 인간 면역글로불린 G1 중쇄의 신호 펩티드를 포함하여 인간 면역글로불린 G1 (IgG1) 중쇄의 221~447번 서열을 발현하는 Fc 발현 벡터가 제작되었다. 이때 Fc 단백질의 아미노산 서열번호는 'EU numbering'을 기준으로 한다.
해당 벡터에 돌연변이유발을 통해 제한효소 인식 서열을 삽입하여 Uniprot Q133332-7 PTPsigma의 30~231번 서열을 코딩하는 뉴클레오티드를 삽입하였다. 이를 통해 PTPsigma-Fc 발현 벡터가 제작되었다.
상기 PTPsigma-Fc 발현 벡터가 코딩하는 아미노산 서열은 도 4와 같다. 도 4에서, 점선 밑줄로 표시한 부분이 PTPsigma 유래 단백질(서열번호 1)에 해당하며, 직선 밑줄로 표시한 부분이 Fc 도메인의 IgG1 221~447(서열번호 2)에 해당한다.
상기에서 제작된 벡터를 바탕으로 이형이량체 단백질을 생산할 수 있는 놉 및 홀을 형성하기 위한 변이체를 도입하였다.
PTPsigma-Fc 발현 벡터에는 T366W 변이로 인한 놉이 형성되도록 뉴클레오티드 서열을 변경하여, PTPsigma-Fc-knob 발현 벡터를 제작하였다.
Fc 발현 벡터에는 IgG1 중쇄 221 내지 447번 서열 부분에 T366S, L368A 및 Y407V 변이로 인한 홀이 형성되도록 뉴클레오티드 서열을 변경하여, 아래와 같은 아미노산 서열을 코딩하는 Fc-hole 발현 벡터를 제작하였다.
도 5는 상기 PTPsigma-Fc-knob 발현 벡터(a) 및 Fc-hole 발현 벡터(b)가 코딩하는 아미노산 서열을 나타낸 것이다. 도 5에서, 점선 밑줄로 표시한 부분이 PTPsigma 유래 단백질(서열번호 1)에 해당하며, 직선 밑줄로 표시한 부분이 Fc 도메인의 IgG1 221~447(서열번호 2)의 knob 또는 hole 변이체에 해당한다. 변이된 잔기는 별표로 표시하였다.
1-2. 단백질 발현
ExpiCHO™ 세포에 발현 벡터를 트랜스펙션(transfection)하여 일시적으로 각 단백질을 발현하였다.
상기 트랜스펙션은 초기 세포 밀도 6 x 106세포/mL 및 발현 벡터 농도 0.8μgDNA/mL 조건에서 진행되었으며, 이 과정에서 ExpiCHO™ Expression Medium, OptiPRO™ SFM 및 ExpiFectamine™ transfection kit (Gibco)를 제조사 지침에 따라 사용하였다.
트랜스펙션 과정을 거친 세포들을 이산화탄소 인큐베이터에서 8일 간 배양한 후, 원심분리를 통해 각 단백질을 함유하는 세포 배양액과 세포로 분리하였다.
1-3. 정제
각각의 재조합 단백질을 포함하는 배양액에서 목표 단백질들을 분리하기 위해 Ni-NTA (Qiagen) 컬럼을 이용한 친화도 크로마토그래피(affinity chromatography)를 실시하였다.
구체적으로, Ni-NTA 컬럼에 50mM Tris-HCl pH 7.5 및 200mM NaCl을 포함하는 완충용액을 채운 후, 원심분리를 통해 획득된 배양액을 0.45μm 여과지로 여과하여 투입하였다. 배양액과 반응을 마친 뒤, 컬럼을 50mM Tris-HCl pH 7.5 및 500mM NaCl을 포함하는 완충용액과 50mM Tris-HCl pH 7.5, 200mM NaCl 및 30mM imidazole을 포함하는 완충용액으로 순차적으로 세척하였다. 최종적으로 50mM Tris-HCl pH 7.5, 200mM NaCl 및 500mM imidazole을 포함하는 완충용액을 사용하여, 컬럼에 결합한 단백질을 용출하였다. 용출 후, Hitrap™ Desalting (GE healthcare) 컬럼을 이용하여 상기 단백질을 포함하는 완충용액의 조성을 인산염완충식염수(PBS)로 교체하였다.
1-4. 이형이량체 단백질 조합
정제된 PTPsigma-Fc-knob 단백질과 Fc-hole 단백질을 정량한 후, 동일 분자 비율로 혼합하였다. 혼합한 단백질 용액에 최종농도가 0.1M arginine, 5mM L-glutathione (reduced)이 되도록 시약을 추가하여, 37℃에서 2시간 동안 이형이량체 단백질이 형성되도록 반응시켰다. 반응이 끝난 단백질에 SDS-PAGE 실험을 수행하였다.
도 6은 제조예 1로 형성된 동형이량체 및 이형이량체 단백질의 SDS-PAGE 결과를 나타낸 것이다. 도 6에서, A는 PTPsigma-Fc 동형이량체에 대한 결과이고, B는 PTPsigma-Fc-knob:Fc-hole 이형이량체에 대한 결과이다. PTPsigma-Fc 동형이량체의 경우 수율이 약 6mg/L였으며, PTPsigma-Fc-knob:Fc-hole 이형이량체는 약 85% 순도로 형성되었음을 확인하였다.
실험예 1: 집락형성능 측정(Colony-forming cell assay)을 통한 PTPsigma-Fc 융합단백질의 혈액줄기세포 재생 효과 측정
조혈모세포의 집락형성능 측정을 위한 세포로서, 상업적으로 이용 가능한 인간 CD34+ 조혈모세포(STEMCELL Technologies)를 이용하였다.
StemSpanTM SFEM, StemSpanTM CD34+ Expansion Supplement (10X) (STEMCELL Technologies)를 제조사의 지침에 따라 사용하여, 상기 인간 CD34+ 조혈모세포를 해동 직후 37℃, 이산화탄소 농도 5% 조건에서 배양하였다.
배양된 인간 CD34+ 조혈모세포를 96웰 마이크로플레이트(SPL Life Science)에 2 x 103 세포/웰의 세포 농도로 파종하였다. 이때 집락형성능 측정을 위해 MethoCultTM H4434 Classic (STEMCELL Technologies) 배양액을 사용하였다. 파종 직후 각각의 웰에 제조예 1의 융합단백질 및 PBS를 적용하였다. 파종 24시간 후 Cs-137 방사선조사기를 이용하여 조혈모세포에 300cGy의 방사선을 조사하여 손상을 주었다.
방사선 조사 후, CytoSelectTM 96-Well Hematopoietic Colony Forming Cell Assay (Cell Biolabs) 키트 제품을 이용하여 집락형성능을 측정하였다. 구체적으로, 방사선 조사 후 9일 간 37℃, 이산화탄소 농도 5% 조건에서 배양된 조혈모세포에 집락형성능 측정 키트의 시약을 섞은 뒤, Victor X2 (Perkin-Elmer) 플레이트 측정기를 이용하여 355nm / 460nm 파장으로 형광을 측정하였다.
도 7은 집락형성능 측정 결과를 나타낸 것이다. 조혈모세포에 방사선을 조사한 경우 집락형성능이 매우 저하되는 것을 볼 수 있다. 그러나 조혈모세포에 본 발명에 따른 PTPsigma-Fc의 동형이량체를 처리한 경우에는, 집락형성능이 거의 방사선 미처리군(control)과 같이 복원되는 결과를 확인하였다. PTPsigma-Fc-knob:Fc-hole 로 이루어진 이형이량체를 처리한 경우에도 비슷한 결과가 나타났다.
이로써, 본 발명의 PTPsimga-Fc 융합단백질이 암환자의 방사선치료 후 손상된 조혈모세포를 효과적으로 복원하는데 사용될 수 있음을 확인하였다.
제조예 2: PTPsigma-Fc 융합단백질의 변이체 제조
융합단백질의 용해도 향상을 위하여, PTPsigma 유래 단백질에 변이체를 설계하였다.
구체적으로, PTPsigma의 삼차구조에 기반하여 돌연변이를 설계하였으며, 이 때 돌연변이가 PTPsigma의 CSPG 결합능을 손상시키지 않도록 하여, PTPsigma 저해 효과가 영향을 받지 않도록 설계하였다.
PTPsigma 세포외도메인의 Ig1-2 삼차구조의 잔기들을 PyMOL 프로그램으로 하나씩 분석하여, 용매에 접근가능한 표면(solvent accessible surface) 면적이 넓으면서 소수성을 갖고 있는 잔기들을 골라내었다. 이 중에서, 구조상 주변 잔기들과 상호작용을 하고 있어서 돌연변이를 도입했을 때 구조에 영향을 줄 수 있는 잔기들은 제외하였다.
그 후, CSPG 결합에 영향을 주지 않도록 하기 위하여, PTPsigma와 상동성을 갖는(homologous) PTP-lar와, CSPG 유사체인 sucrose octasulfate의 복합체 구조를 PTP-sulfate 상호작용 정보로 사용하였다. 우선, PTPsigma Ig1-2 구조와 PTP-lar의 Ig1-2 구조를 중첩시킨 후, sucrose octasulfate가 상호작용하는 부위에 있는 PTPsigma Ig1-2의 잔기들은 돌연변이 대상 잔기들로부터 제외하였다.
그 결과, 돌연변이 대상 아미노산의 위치는 PTPsigma 서열 중 I36, V104, V108, L125, L143, L145, L155, L187, Y224, V227인 것을 확인하였으며, 도 8에 PTPsigma Ig1-2의 삼차구조에서 상기 잔기들의 위치를 나타내었다. 또한, 도 9에 PTP-lar의 Ig1-2와 sucrose octasulfate 복합체 구조 및 PTPsigma Ig1-2의 삼차구조를 중첩한 것을 나타내었다.
이들 아미노산을 친수성 아미노산으로 변경하여 용해도를 향상시켰고, 이들 중 한 개 혹은 그 이상의 아미노산 조합들로 이루어지는 돌연변이체를 사용하였다. 친수성 아미노산으로의 돌연변이는 A, S, T, N, Q, D, E, K, R 및 H 아미노산 중 하나를 선택하여 수행하였으며, 돌연변이 위치 및 잔기를 아래 표 1에 나타내었다. 표 1에서, 아미노산 잔기의 번호는 PTPsigma의 아미노산 서열 번호를 기준으로 한다.
돌연변이 위치 돌연변이 잔기
I36 A, S, T, N, Q, D, E, K, R, H
V104 A, S, T, N, Q, D, E, K, R, H
V108 A, S, T, N, Q, D, E, K, R, H
L125 A, S, T, N, Q, D, E, K, R, H
L143 A, S, T, N, Q, D, E, K, R, H
V145 A, S, T, N, Q, D, E, K, R, H
L155 A, S, T, N, Q, D, E, K, R, H
L187 A, S, T, N, Q, D, E, K, R, H
Y224 A, S, T, N, Q, D, E, K, R, H
V227 A, S, T, N, Q, D, E, K, R, H
상기 돌연변이 위치 및 잔기를 바탕으로, 수용액 용해도가 향상된 돌연변이를 포함한 PTPsigma Ig1-2의 아미노산 돌연변이의 대표서열을 아래 표 2와 같이 설계하였다.
변이체 No. 돌연변이 잔기
1 L143N, V145T, Y224N
2 L143A, V145A, Y224A
3 L143N, V145T, Y224N, V104T, V108T, L155N, L187N
4 V104T, V108T, L155N, L187N
5 L143N, V145T, Y224N, V104T
6 L143N, V145T, Y224N, V108T
7 L143N, V145T, Y224N, L155N
8 L143N, V145T, Y224N, L187N
9 L143A, V145A, Y224A, V104A, V108A, L155A, L187A
10 V104A, V108A, L155A, L187A
11 L143A, V145A, Y224A, V104A
12 L143A, V145A, Y224A, V108A
13 L143A, V145A, Y224A, L155A
14 L143A, V145A, Y224A, L187A
15 L155A
16 L155A, L187A, Y224A
17 L155N, L187N
18 L143A, L145A, L155A, L187A
도 10 내지 27은 상기 표 2의 돌연변이 대표서열에 대해, 각 PTPsigma mutant와 Fc 도메인의 융합단백질을 형성하기 위한 벡터가 코딩하는 아미노산 서열을 나타낸 것이다. 각 서열에서, (a)는 PTPsigma 변이체-Fc의 동형이량체 융합단백질을 형성하기 위한 서열을 나타내고, (b)는 비대칭형 이형이량체를 형성하기 위한 PTPsigma 변이체-Fc knob의 서열을 나타낸 것이다.
도 10 내지 27에서, 점선 밑줄로 표시한 부분이 PTPsigma 유래 단백질인 PTPsigma의 30~231번 서열(서열번호 1)의 각 변이체 서열에 해당하며, 직선 밑줄로 표시한 부분이 Fc 도메인의 IgG1 221~447(서열번호 2) 또는 그의 knob 변이체에 해당한다. 모체에서 변이된 잔기는 별표로 표시하였다.
실험예 2: PTPsigma-Fc 융합단백질 변이체의 수율 및 용해도 측정
제조예 2와 같은 방법으로 설계한 돌연변이 융합단백질에 대하여, 수율 및 용해도를 측정하고, 제조예 1의 융합단백질(wild type)의 수율 및 용해도와 비교하였다.
돌연변이체가 포함된 PTPsigma-Fc 융합단백질의 수율을 측정하기 위하여, 정제 (purification) 직후 elution 8ml를 1ml에 근접하게 농축한 뒤, 원심분리(centrifugate) 과정을 거쳐 불용성 내용물을 가라앉힌 다음, 상등액(supernatant) 샘플을 채취하였다. 이후 Detergent Compatible assay (DC assay)를 활용하여 상등액 샘플의 농도를 측정하고, 농도와 부피를 토대로 용해성 단백질의 양을 계산하였다.
또한, 돌연변이체가 포함된 PTPsigma-Fc 융합단백질의 수용액 용해도를 측정하기 위하여, 단백질 정제 직후 단백질 부피 8ml를 1ml가 되도록 농축하고, 원심분리 후 상등액 농도를 DC assay로 측정하였다. 이를 400μl로 농축한 후 동일한 과정을 반복하여 상등액의 농도를 측정한 다음, 각 농도에 부피를 곱하는 방식으로 용해성 단백질의 양을 계산하고, 이를 비율(%)로 환산하였다.
상기 방법으로 계산한 수율 및 용해도 결과를 하기 표 3 및 도 28에 나타내었다.
돌연변이 set 수율(yield) 용해도(solubility)
Wild type 1.0 21%
L125A 0.7 30%
I36A 1.5 21%
L155A 1.9 44%
Y224A 1.3 34%
Y224A, V227A 1.0 43%
L155A, L187A 1.1 34%
L155A, L187A, Y224A 3.2 66%
L155A, L187A, Y224A, V227A 0.6 93%
L155N, L187A 1.3 111%
L155N, L187N, Y224A 11.3 79%
L143A, L155A, L187A, Y224A, V227A 7.9 34%
L155N, L187A, Y224A 6.2 73%
L155N, L187A, Y224A, V227A 5.9 67%
L143A, L155A, L187A 8.1 89%
L155N, L187N 8.8 115%
L143A, L145A, L155N, L187N 14.7 101%
상기 수율 및 용해도 측정 결과로부터, I36, V104, V108, L125, L143, L145, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A, S, T, N, Q, D, E, K, R 또는 H로 치환된 변이체의 경우 wild type에 비하여 수용액 용해도가 향상되는 결과를 확인하였으며, 수율 또한 개선되는 경향을 확인하였다.
특히, 상기 실험으로부터 L143, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A 또는 N으로 치환된 변이체가 수율 및 용해도 측면에서 우수한 결과를 확인하였다.
이에 따라, 본 발명의 융합단백질에서 PTPsigma 유래 단백질에 특정 돌연변이를 도입하여 용해도를 향상시킴으로써, 동물 및 인체에 고용량으로 처리할 수 있는 가능성을 확인하였다.
실험예 3: PTPsigma-Fc 융합단백질 변이체의 혈액줄기세포 재생 효과 측정
조혈모세포의 집락형성능 측정을 위한 세포로서, 상업적으로 이용 가능한 인간 CD34+ 조혈모세포(STEMCELL Technologies)를 이용하였다.
상기 인간 CD34+ 조혈모세포를 해동한 직후, StemSpanTM SFEM, StemSpanTM CD34+ Expansion Supplement (10X) (STEMCELL Technologies)를 제조사의 지침에 따라 사용하여 37℃, 이산화탄소 농도 5% 조건에서 배양하였다.
배양된 인간 CD34+ 조혈모세포를 96웰 마이크로플레이트(SPL Life Science)에 1.4 x 103 세포/웰의 세포 농도로 파종하였다. 이때 집락형성능 측정을 위해 MethoCultTM H4434 Classic (STEMCELL Technologies) 배양액을 사용하였다. 파종 직후 각각의 웰에 PTPsigma-Fc 융합단백질 및 PBS를 적용하였다. 파종 24시간 후 5μM 농도의 5-fluorouracil (5FU)을 융합단백질과 함께 투여하였다. 5FU 처리 14일 후 manual counting 방식으로 콜로니 숫자를 측정하였다.
PTPsigma-Fc 융합단백질 wild type 및 L155N 및 L187N 돌연변이를 포함하는 PTPsigma-Fc 융합단백질에 대해서, 상기 방법으로 항암제에 의한 조혈모세포 손상 회복 효과를 측정한 결과를 도 29에 나타내었다. 도 29에서, 5FU-는 5FU를 첨가하지 않은 control을 나타내고, 5FU+는 5FU를 첨가한 샘플을 나타내며, 2N은 5FU를 첨가한 샘플에 PTPsigma-Fc 융합단백질 변이체(L155N 및 L187N)를 처리한 샘플을 의미하고, wt는 5FU를 첨가한 샘플에 PTPsigma-Fc 융합단백질(wild type)을 처리한 샘플을 의미한다.
도 29를 참조하면, 항암제(5FU)를 처리하였을 때 조혈모세포가 심각하게 손상되나, 항암제와 PTPsigma mutant-Fc 융합단백질을 같이 처리하였을 때 손상된 조혈모세포가 항암제를 처리하지 않았을 때의 control 과 비슷한 정도로 회복되는 것을 확인하였다.
이로써, 본 발명의 PTPsimga-Fc 융합단백질이 암환자의 항암제 치료 후 손상된 조혈모세포를 효과적으로 재생하는데 사용될 수 있음을 확인하였다.
이상으로 본 발명의 내용의 특정부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.

Claims (16)

  1. 면역글로불린(Immunoglobulin, Ig) 유래의 Fc 도메인을 구성하는 2개의 사슬 중 하나 이상의 사슬에 PTPsigma(Protein Tyrosine Phosphatase sigma) 유래의 단백질이 연결된, PTPsigma-Fc 융합단백질.
  2. 제 1 항에 있어서,
    상기 PTPsigma 유래 단백질이 PTPsigma의 세포외도메인(ectodomain) 유래의 단백질인, PTPsigma-Fc 융합단백질.
  3. 제 1 항에 있어서,
    상기 PTPsigma 유래 단백질이 PTPsigma의 세포외도메인 중 첫째-둘째 Ig 도메인(Ig1-2) 또는 첫째-셋째 Ig 도메인(Ig1-3) 유래의 단백질인, PTPsigma-Fc 융합단백질.
  4. 제 1 항에 있어서,
    상기 PTPsigma 유래 단백질이 PTPsigma 단백질의 30 내지 231번 아미노산 잔기, 또는 30 내지 321번 아미노산 잔기를 포함하는, PTPsigma-Fc 융합단백질.
  5. 제 1 항에 있어서,
    상기 PTPsigma 유래 단백질에서, 이소류신(I), 발린(V), 류신(L) 및 타이로신(Y) 중 하나 이상의 잔기가 알라닌(A), 세린(S), 트레오닌(T), 아스파라긴(N), 글루타민(Q), 아스파르트산(D), 글루탐산(E), 리신(K), 아르기닌(R) 또는 히스티딘(H)으로 치환된, PTPsigma-Fc 융합단백질.
  6. 제 1 항에 있어서,
    상기 PTPsigma 유래 단백질에서, PTPsigma 단백질의 아미노산 서열 번호를 기준으로 I36, V104, V108, L125, L143, L145, L155, L187, Y224 및 V227 중 하나 이상의 잔기가 A, S, T, N, Q, D, E, K, R 또는 H로 치환된, PTPsigma-Fc 융합단백질.
  7. 제 1 항에 있어서,
    상기 PTPsigma-Fc 융합단백질이 동형이량체(homodimer) 또는 이형이량체(heterodimer)인, PTPsigma-Fc 융합단백질.
  8. 제 1 항에 있어서,
    상기 Fc 도메인을 구성하는 사슬이 (Kabat EU 넘버링 기준) IgG1 중쇄의 221 내지 447번 아미노산 잔기를 포함하는, PTPsigma-Fc 융합단백질.
  9. 제 8 항에 있어서,
    상기 Fc 도메인 중 하나의 사슬에서, 하나 이상의 아미노산이 트립토판(W), 아르기닌(R), 페닐알라닌(F) 및 타이로신(Y)으로 구성된 군에서 선택된 아미노산으로 치환되고,
    다른 하나의 사슬에서, 하나 이상의 아미노산이 알라닌(A), 세린(S), 트레오닌(T) 및 발린(V)으로 구성된 군에서 선택된 아미노산으로 치환된, PTPsigma-Fc 융합단백질.
  10. 제 8 항에 있어서,
    상기 Fc 도메인 중 하나의 사슬이 (Kabat EU 넘버링 기준) T366W 치환을 포함하고,
    다른 하나의 사슬이 (Kabat EU 넘버링 기준) T366S, L368A 및 Y407V 치환을 포함하는, PTPsigma-Fc 융합단백질.
  11. 제 1 항 내지 제 10 항 중 어느 한 항의 PTPsigma-Fc 융합단백질을 포함하는 혈액줄기세포 생장 촉진용 조성물.
  12. 제 11 항에 있어서,
    상기 혈액줄기세포 생장 촉진용 조성물이 방사선 조사 또는 항암제 투여에 의해 손상된 혈액줄기세포를 재생하기 위한 것인, 혈액줄기세포 생장 촉진용 조성물.
  13. 제 1 항 내지 제 10 항 중 어느 한 항의 PTPsigma-Fc 융합단백질을 포함하는 PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물.
  14. 제 13 항에 있어서,
    상기 PTPsigma 매개성 질환이 외상성 뇌손상(traumatic brain injury), 알츠하이머성 치매 및 파킨슨병으로 구성된 군에서 선택되는 신경손상 질환인, PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물.
  15. 제 13 항에 있어서,
    상기 PTPsigma 매개성 질환이 다발성 경화증(multiple sclerosis) 및 류마티스 관절염으로 구성된 군에서 선택되는, PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물.
  16. 제 13 항에 있어서,
    상기 PTPsigma 매개성 질환이 조증, 우울증, 조울증 및 기억장애증으로 구성된 군에서 선택되는 시냅스 가소성 관련 질환인, PTPsigma 매개성 질환의 예방 또는 치료용 약학 조성물.
PCT/KR2021/012763 2020-09-18 2021-09-17 Ptpsigma-fc 융합단백질 및 이를 포함하는 약학 조성물 WO2022060151A1 (ko)

Priority Applications (3)

Application Number Priority Date Filing Date Title
JP2023518036A JP2023542178A (ja) 2020-09-18 2021-09-17 ＰＴＰｓｉｇｍａ－Ｆｃ融合タンパク質およびそれを含む薬学組成物
US18/044,962 US20230365945A1 (en) 2020-09-18 2021-09-17 Ptpsigma-fc fusion protein and pharmaceutical composition comprising same
EP21869773.8A EP4215607A1 (en) 2020-09-18 2021-09-17 Ptpsigma-fc fusion protein and pharmaceutical composition comprising same

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20200120887 2020-09-18
KR10-2020-0120887 2020-09-18
KR10-2021-0117865 2021-09-03
KR1020210117865A KR102666958B1 (ko) 2020-09-18 2021-09-03 PTPsigma-Fc 융합단백질 및 이를 포함하는 약학 조성물

Publications (1)

Publication Number Publication Date
WO2022060151A1 true WO2022060151A1 (ko) 2022-03-24

Family

ID=80776284

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/012763 WO2022060151A1 (ko) 2020-09-18 2021-09-17 Ptpsigma-fc 융합단백질 및 이를 포함하는 약학 조성물

Country Status (4)

Country Link
US (1) US20230365945A1 (ko)
EP (1) EP4215607A1 (ko)
JP (1) JP2023542178A (ko)
WO (1) WO2022060151A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101194968B1 (ko) 2004-04-07 2012-10-25 메르크 세로노 에스.에이. Ｐｔｐ 1-ｂ 저해제로서의 1,1’-(1,2-에틴디일)비스-벤젠유도체
KR101826690B1 (ko) 2015-11-06 2018-03-22 경북대학교 산학협력단 단백질 타이로신 탈인산화효소 억제제를 포함하는 신경염증성 질환의 예방 또는 치료용 조성물
WO2019246071A1 (en) * 2018-06-18 2019-12-26 Denali Therapeutics Inc. Fusion proteins comprising progranulin

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101194968B1 (ko) 2004-04-07 2012-10-25 메르크 세로노 에스.에이. Ｐｔｐ 1-ｂ 저해제로서의 1,1’-(1,2-에틴디일)비스-벤젠유도체
KR101826690B1 (ko) 2015-11-06 2018-03-22 경북대학교 산학협력단 단백질 타이로신 탈인산화효소 억제제를 포함하는 신경염증성 질환의 예방 또는 치료용 조성물
WO2019246071A1 (en) * 2018-06-18 2019-12-26 Denali Therapeutics Inc. Fusion proteins comprising progranulin

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
KO JI SEUNG, PRAMANIK GOPAL, UM JI WON, SHIM JI SEON, LEE DONGMIN, KIM KEE HUN, CHUNG GUG-YOUNG, CONDOMITTI GIUSEPPE, KIM HO MIN, : "PTPσ functions as a presynaptic receptor for the glypican-4/LRRTM4 complex and is essential for excitatory synaptic transmission", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, vol. 112, no. 6, 10 February 2015 (2015-02-10), pages 1874 - 1879, XP055912352, ISSN: 0027-8424, DOI: 10.1073/pnas.1410138112 *
Y. SHEN, A. P. TENNEY, S. A. BUSCH, K. P. HORN, F. X. CUASCUT, K. LIU, Z. HE, J. SILVER, J. G. FLANAGAN: "PTP Is a Receptor for Chondroitin Sulfate Proteoglycan, an Inhibitor of Neural Regeneration", SCIENCE, AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, vol. 326, no. 5952, 23 October 2009 (2009-10-23), pages 592 - 596, XP055123975, ISSN: 00368075, DOI: 10.1126/science.1178310 *
ZHANG YURUN, ROOS MARTINA, HIMBURG HEATHER, TERMINI CHRISTINA M., QUARMYNE MAMLE, LI MICHELLE, ZHAO LIMAN, KAN JENNY, FANG TIANCHE: "PTPσ inhibitors promote hematopoietic stem cell regeneration", NATURE COMMUNICATIONS, vol. 10, no. 1, 1 December 2019 (2019-12-01), XP055912350, DOI: 10.1038/s41467-019-11490-5 *

Also Published As

Publication number Publication date
US20230365945A1 (en) 2023-11-16
JP2023542178A (ja) 2023-10-05
EP4215607A1 (en) 2023-07-26

Similar Documents

Publication Publication Date Title
WO2015156649A1 (ko) 섬유증 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
Mustelin et al. Regulation of the p59fyn protein tyrosine kinase by the CD45 phosphotyrosine phosphatase
Aktories et al. Clostridium botulinum C3 ADP-ribosyltransferase
WO2013169077A1 (ko) 악액질 예방 또는 치료용 조성물
BG63634B1 (bg) Инхибитори на интерлевкин 1 бета-конвертиращ ензим
WO2012050402A2 (ko) 세포투과성 parkin 재조합 단백질 및 이를 함유하는 퇴행성 뇌질환 치료용 약학적 조성물
WO2019004799A1 (ko) Vegf-grab 단백질과 약물의 결합체 및 이의 용도
WO2019209078A1 (ko) 신규한 융합 단백질 및 이를 포함하는 암의 예방 또는 치료용 약학적 조성물
WO2022060151A1 (ko) Ptpsigma-fc 융합단백질 및 이를 포함하는 약학 조성물
WO2022005174A1 (ko) 항-lag-3 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2019216675A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2016027990A1 (ko) Ｄｕｓｐ５를 유효성분으로 모두 포함하는 골대사성 질환의 예방 또는 치료용 약학적 조성물
WO1994003610A2 (en) Isolation and cloning of a protein with tyrosine-phosphatase activity
WO2020032324A1 (ko) 폐렴구균의 독소-항독소 체계를 표적으로 하는 항생 펩타이드 및 이의 용도
WO2022131889A1 (ko) Taci 단백질의 용도
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2022015113A1 (ko) Ptk7에 특이적으로 결합하는 항체 및 이의 용도
WO2021194186A1 (ko) Vgll1 펩타이드를 포함하는 암 치료용 조성물
KR102666958B1 (ko) PTPsigma-Fc 융합단백질 및 이를 포함하는 약학 조성물
WO2020251163A1 (ko) 생산성이 향상된 비독성 프로테아제
Xu et al. Tyrosine phosphatases SHP-1 and SHP-2 are associated with distinct tyrosine-phosphorylated proteins
WO2021090985A1 (ko) Ceacam1의 입체 에피토프 및 이에 특이적으로 결합하는 항-ceacam1 항체 또는 이의 단편
JPH08504602A (ja) Ｔｉａ−１結合タンパク質及びそれをコードする分離された相補的ｄｎａ
KR20220037962A (ko) PTPsigma-Fc 융합단백질 및 이를 포함하는 약학 조성물
WO2019235856A1 (ko) Tie2에 결합하는 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21869773

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2023518036

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021869773

Country of ref document: EP

Effective date: 20230418