WO2021231925A1 - Vaccines for recurrent respiratory papillomatosis and methods of using the same - Google Patents

Vaccines for recurrent respiratory papillomatosis and methods of using the same Download PDF

Info

Publication number
WO2021231925A1
WO2021231925A1 PCT/US2021/032545 US2021032545W WO2021231925A1 WO 2021231925 A1 WO2021231925 A1 WO 2021231925A1 US 2021032545 W US2021032545 W US 2021032545W WO 2021231925 A1 WO2021231925 A1 WO 2021231925A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleotide sequence
seq
nucleic acid
hpv11
hpv6
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/032545
Other languages
English (en)
French (fr)
Other versions
WO2021231925A8 (en
Inventor
Stephanie RAMOS
Charles Reed
Jewell WALTERS
Jian Yan
Anna SCLAGER
Kate Broderick
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Inovio Pharmaceuticals Inc
Original Assignee
Inovio Pharmaceuticals Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2022568868A priority Critical patent/JP7765407B2/ja
Priority to PH1/2022/553102A priority patent/PH12022553102A1/en
Priority to BR112022022719A priority patent/BR112022022719A2/pt
Priority to MX2022014248A priority patent/MX2022014248A/es
Priority to EP21804155.6A priority patent/EP4149536A4/en
Priority to PE2022002641A priority patent/PE20230349A1/es
Priority to IL297903A priority patent/IL297903A/en
Priority to KR1020227043183A priority patent/KR20230011335A/ko
Priority to AU2021271860A priority patent/AU2021271860B2/en
Priority to CN202180041036.2A priority patent/CN115803051A/zh
Application filed by Inovio Pharmaceuticals Inc filed Critical Inovio Pharmaceuticals Inc
Priority to CA3177949A priority patent/CA3177949A1/en
Publication of WO2021231925A1 publication Critical patent/WO2021231925A1/en
Publication of WO2021231925A8 publication Critical patent/WO2021231925A8/en
Priority to SA522441314A priority patent/SA522441314B1/ar
Anticipated expiration legal-status Critical
Priority to CONC2022/0017989A priority patent/CO2022017989A2/es
Priority to JP2025116664A priority patent/JP2025158979A/ja
Priority to AU2025220899A priority patent/AU2025220899A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/01DNA viruses
    • C07K14/025Papovaviridae, e.g. papillomavirus, polyomavirus, SV40, BK virus, JC virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/525Virus
    • A61K2039/5254Virus avirulent or attenuated
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • A61K2039/55527Interleukins
    • A61K2039/55538IL-12
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/572Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16611Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16634Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20022New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20034Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/20011Papillomaviridae
    • C12N2710/20071Demonstrated in vivo effect

Definitions

  • the present invention relates to human papillomavirus (HPV) vaccines, methods of inducing immune responses, and methods for prophylactically and/or therapeutically immunizing individuals against HPV6 and/or HPV11, and methods of preventing or treating recurrent respiratory papillomatosis (RRP).
  • HPV+ Human Papilloma Virus-associated (HPV+) malignancies are an emerging global epidemic (Gradishar et al., JNCCN 2014;12(4):542-90). HPV-associated aerodigestive precancerous lesions and malignancies may occur in the oropharynx, larynx, and upper respiratory tract.
  • RRP Recurrent respiratory papillomatosis remains a challenging disease afflicting children and adults, resulting in an estimated $120 million per year in United States healthcare-related costs, with annual costs per patient approaching $60,000.
  • RRP human papillomavirus
  • the HPV6 antigenic domain comprises a HPV6 E6 antigenic domain and a HPV6 E7 antigenic domain.
  • the HPV11 antigenic domain comprises a HPV11 E6 antigenic domain and a HPV11 E7 antigenic domain.
  • the nucleic acid molecules provided herein may encode a HPV antigen comprising: the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; an amino acid sequence that is at least 95% homologous to SEQ ID NO:1 or SEQ ID NO: 11; a fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; or an amino acid sequence that is at least 95% homologous to a fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • the nucleic acid molecules comprise: a nucleotide sequence at least 95% homologous to SEQ ID NO:2 or SEQ ID NO: 12; the nucleotide sequence of SEQ ID NO: 2; or the nucleotide sequence of SEQ ID NO 12.
  • the nucleic acid sequence encoding the HPV11 antigenic domain is located 5’ to the nucleic acid sequence encoding the HPV6 antigenic domain.
  • the nucleic acid sequence encoding the HPV6 antigenic domain is located 5’ to the nucleic acid sequence encoding the HPV11 antigenic domain.
  • the nucleic acid molecules may include nucleic acid sequence encoding one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • Suc seque ce(s) ay be cuded betwee t e uce c acd seque ce e cod g t e V6 antigenic domain and the nucleic acid sequence encoding the HPV11 antigenic domain, between the nucleic acid sequence encoding the HPV6 E6 antigenic domain and the nucleic acid sequence encoding the HPV6 E7 antigenic domain, between the nucleic acid sequence encoding the HPV11 E6 antigenic domain and the nucleic acid sequence encoding the HPV11 E7 antigenic domain, or any combination thereof.
  • expression vectors comprising any of the disclosed nucleic acid molecules.
  • the expression vector is a DNA plasmid.
  • the expression vector may comprise the nucleotide sequence of SEQ ID NO: 3.
  • immunogenic proteins comprising a human papillomavirus (HPV) 6 antigenic domain fused to a HPV11 antigenic domain.
  • HPV6 antigenic domain comprises HPV6 E6 and HPV6 E7;
  • HPV11 antigenic domain comprises HPV11 E6 and HPV11 E7; or both.
  • the HPV11 antigenic domain may be located N-terminal or C-terminal to the HPV6 antigenic domain.
  • the immunogenic proteins may contain one or more post-translational cleavage sites, one or more translational skipping sites, or both. Such sites may be located between the HPV6 and HPV11 antigenic domain, between the HPV6 E6 and HPV6 E7 antigenic domains, between the HPV11 E6 and HPV11 E7 antigenic domains, or any combination thereof.
  • the immunogenic protein comprises: the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; an amino acid sequence that is at least 95% homologous to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; a fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; or an amino acid sequence that is at least 95% homologous to a fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • compositions comprising the nucleic acid molecules, the expression vectors, the immunogenic proteins, or any combination thereof, and a pharmaceutically acceptable carrier.
  • vaccines comprising the nucleic acid molecules, the expression vectors, the immunogenic proteins, or any combination thereof.
  • pharmaceutical compositions comprising the nucleic acid molecules, the expression vectors, the immunogenic proteins, or any combination thereof, and an adjuvant.
  • the adjuvant may be, for example, interleukin 12 (IL12).
  • IL12 is encoded by a nucleic acid molecule, such as an expression vector.
  • the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • the nucleotide sequence encoding the p35 subunit of IL12 may comprise a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6; a fragment of a nucleotide sequence that encodes SEQ ID NO: 6; and a nucleotide sequence that is at least 95% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO: 6.
  • the nucleotide sequence encoding the p40 subunit of IL12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8; a fragment of a nucleotide sequence that encodes SEQ ID NO: 8; and a nucleotide sequence that is at least 95% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO: 8.
  • the nucleotide sequence encoding IL12 comprises a nucleotide sequence selected from the group consisting of: the nucleotide sequence of SEQ ID NO: 4; a nucleotide sequence that is at least 95% homologous to the nucleotide sequence of SEQ ID NO: 4; a fragment of the nucleotide sequence of SEQ ID NO: 4; and a nucleotide sequence that is at least 95% homologous to a fragment of the nucleotide sequence of SEQ ID NO: 4.
  • kits for inducing an immune response in a subject by administering to the subject an effective amount of any of the disclosed nucleic acid molecules, expression vectors, immunogenic proteins, pharmaceutical compositions, or vaccines, to thereby induce the immune response.
  • methods of prophylactically or therapeutically immunizing a subject against HPV6 and/or HPV11 comprising administering to the subject an effective amount of any of the disclosed nucleic acid molecules, expression vectors, immunogenic proteins, pharmaceutical compositions, or vaccines, to thereby induce an immune response against HPV6, HPV11, or both.
  • RRP recurrent respiratory papillomatosis
  • a nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 12 is administered to the subject.
  • an adjuvant is further administered to the subject.
  • the adjuvant may be interleukin-12 (IL12).
  • the IL12 may be encoded by a nucleic acid molecule, such as, for example, an expression vector or plasmid.
  • the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • the nucleotide sequence encoding p35 may comprise a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6; a fragment of a nucleotide sequence that encodes SEQ ID NO: 6; and a nucleotide sequence that is at least 95% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO: 6.
  • the nucleotide sequence encoding p40 may comprise a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8; a fragment of a nucleotide sequence that encodes SEQ ID NO: 8; and a nucleotide sequence that is at least 95% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO: 8.
  • the nucleotide sequence encoding IL12 may comprise a nucleotide sequence selected from the group consisting of: the nucleotide sequence of SEQ ID NO: 4; a nucleotide sequence that is at least 95% homologous to the nucleotide sequence of SEQ ID NO: 4; a fragment of the nucleotide sequence of SEQ ID NO: 4; and a nucleotide sequence that is at least 95% homologous to a fragment of the nucleotide sequence of SEQ ID NO: 4.
  • the nucleic acid molecule comprising a nucleotide sequence encoding IL12 is pGX6010. [0018] In some embodiments, the subject is human.
  • the methods comprise administering pGX3024 and pGX6010 to the subject.
  • the pGX3024 and pGX6010 are administered as a composition, for example, as INO-3107.
  • Some embodiments of the methods comprises administering 6 milligrams pGX3024 and 0.25 milligrams pGX6010 to the subject.
  • the administering comprises intradermal or intramuscular injection.
  • the administering may further comprises electroporation.
  • Figure 1A shows a schematic of antigens encoded in different HPV6 and/or HPV11 plasmids. Individual antigens are separated by a P2A cleavage site for translational skipping and a furin cleavage site for post-translational cleavage of the P2A sequence.
  • DNA plasmid pGX3024 encodes consensus SynCon® E6 and E7 antigens of both HPV6 and HPV11.
  • Figure 1B provides a plasmid map of pGX3024.
  • FIG. 2 illustrates pGX3024 E6 and E7 protein antigen expression in vitro.
  • HEK-293T cells were transfected with either pGX3024 plasmid, positive control pGX3021 or pGX3022 plasmid, or negative control empty pGX0001 plasmid using Lipofectamine 3000 transfection reagent.
  • Cells were harvested 48 hours post-transfection and cell lysates were then probed with anti-HPV11 E7 (left panel) or anti-2A (middle panel) antibodies by Western blot. Blots were stripped and reprobed with anti- ⁇ -actin antibody (right panel) to confirm equal protein loading.
  • FIG. 3 illustrates HPV6- and HPV11-specific cellular responses following pGX3024 immunization of C57BL/6 mice.
  • C57BL/6 mouse splenocytes were collected at one week post-immunization with either pGX3024, control plasmids encoding HPV6 (pGX3021) or HPV11 (pGX3022) antigens, or negative control plasmid (pGX0001).
  • FIG. 4 shows HPV6 and HPV11 humoral responses following pGX3024 immunization of C57BL/6 mice.
  • C57BL/6 mouse serum samples were collected at before immunization (Week 0) and after first (Week 2) and second (Week 3) immunization with either pGX3024 or negative control plasmid (pGX0001).
  • FIG. 5 illustrates HPV6- and HPV11-specific cellular responses following pGX3024 immunization of BALB/c mice.
  • BALB/c mouse splenocytes were collected at one week post-immunization with the indicated dose of either pGX3024 alone or in combination with the indicated dose of plasmid murine IL-12 (pGX6012), or negative control plasmid (pGX0001).
  • pGX6012 plasmid murine IL-12
  • pGX0001 negative control plasmid
  • FIG. 6 illustrates HPV6 and HPV11 humoral responses following pGX3024 immunization of BALB/c mice.
  • BALB/c mouse serum samples were collected before immunization (Week 0) and after first (Week 2) and second (Week 3) immunization with the indicated dose of either pGX3024 alone or in combination with the indicated dose of plasmid murine IL-12 (pGX6012), or negative control plasmid (pGX0001).
  • FIG. 7 illustrates the timecourse of HPV6- and HPV11-specific cellular responses following INO-3107 immunization of NZW rabbits.
  • NZW rabbit peripheral blood mononuclear cells (PBMCs) were collected at the indicated timepoints post-immunization with either INO-3107 or 1X saline-sodium citrate buffer (SSC).
  • NZW rabbit serum samples were collected at the indicated timepoints post-immunization with either INO-3107 or 1X SSC.
  • Specific humoral responses to HPV6 E7 (left panel) and HPV11 E7 (right panel) antigens were measured by IgG binding ELISA. Data are depicted for individual animals.
  • Figure 10 shows timecourse of body weight measurements for NZW rabbits administered INO-3107 (left panel) or 1X SSC (right panel).
  • Figure 11 illustrates the timecourse of HPV6- and HPV11-specific cellular responses following pGX3024 immunization of Hartley guinea pigs.
  • Guinea pigs (n of 5) were immunized on Weeks 0, 2, and 4 with 100 ug pGX3024 administered by CELLECTRA intradermal electroporation. Na ⁇ ve guinea pigs (n of 2) served as negative controls. Guinea pig peripheral blood mononuclear cells (PBMCs) were collected at the indicated timepoints post-immunization with pGX3024, or from na ⁇ ve guinea pigs. Specific cellular responses to HPV6 E6 and E7 peptides and HPV11 E6 and E7 peptides were measured by IFN ⁇ ELISpot assay. Data is depicted as the mean ⁇ SEM for each treatment group. of HPV6 E6 and E7.
  • PBMCs Guinea pig peripheral blood mononuclear cells
  • FIG. 12 shows the timecourse of HPV6- and HPV11-specific humoral responses following pGX3024 immunization of Hartley guinea pigs.
  • Hartley guinea pigs (n of 5) were immunized on Weeks 0, 2, and 4 with 100 ug pGX3024 administered by CELLECTRA intradermal electroporation.
  • Guinea pig serum samples were collected at the indicated timepoints post-immunization with pGX3024 for measurement of specific IgG binding antibodies against HPV6 E7 (left) or HPV11 E7 (right) antigens by ELISA. Data are depicted as the mean ⁇ SEM of five animals.
  • Figure 13 shows immune responses induced following intradermal delivery of INO-3107 to NZW rabbits.
  • Cellular immune responses were evaluated by IFN ⁇ ELISpot before immunization (Week 0) and two weeks after each immunization (Weeks 2, 5 and 8).
  • the combined immune response to both antigens, HPV6 and HPV11 increased following each immunization, with the T cell responses being more HPV6 E6- and HPV11 E6-specific.
  • DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS [0034]
  • the disclosed nucleic acid molecules, proteins, vaccines, and methods may be understood more readily by reference to the following detailed description taken in connection with the accompanying figures, which form a part of this disclosure.
  • nucleic acid molecules, proteins, vaccines, and methods are not limited to the specific nucleic acid molecules, proteins, vaccines, and methods described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed nucleic acid molecules, proteins, vaccines, and methods.
  • any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed nucleic acid molecules, proteins, vaccines, and methods are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.
  • compositions and methods of using said compositions refer to compositions and methods of using said compositions. Where the disclosure describes or claims a feature or embodiment associated with a composition, such a feature or embodiment is equally applicable to the methods of using said composition. Likewise, where the disclosure describes or claims a feature or embodiment associated with a method of using a composition, such a feature or embodiment is equally applicable to the composition. [0037] It is to be appreciated that certain features of the disclosed nucleic acid molecules, proteins, vaccines, and methods which are, for clarity, described herein in the context of separate embodiments, may also be provided in combination in a single embodiment.
  • nucleic acid molecules, proteins, vaccines, and methods that are, for brevity, described in the context of a single embodiment, may also be provided separately or in any subcombination.
  • all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.
  • the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the numbers 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
  • Some of the quantitative expressions given herein are not qualified with the term “about”. It is understood that, whether the term “about” is used explicitly or not, every quantity given is intended to refer to the actual given value, and it is also meant to refer to the approximation to such given value that would reasonably be inferred based on the ordinary skill in the art, including approximations due to the experimental and/or measurement conditions for such value.
  • Adjuvant as used herein means any molecule added to the immunogenic compositions described herein to enhance the immunogenicity of the antigens and antigen- encoding nucleic acid molecules and sequences described hereinafter.
  • Antigen refers to proteins having an HPV6 E6 domain, HPV6 E7 domain, HPV11 E6 domain, HPV11 E7 domain, or any combination thereof, and preferably a fusion protein of an HPV6 E6 domain, HPV6 E7 domain, HPV11 E6 domain, and HPV11 E7 domain with an endeoproteolytic cleavage site between each domain.
  • Antigens include SEQ homologous to SEQ ID NO: 1 as set forth herein, fragments of variants having lengths set forth herein, and combinations thereof. Antigens may have an IgE leader sequence of SEQ ID NO:10 or may alternatively have such sequence removed from the N-terminal end.
  • an HPV antigen comprising an HPV6 E6 domain, HPV6 E7 domain, HPV11 E6 domain, and HPV11 E7 domain, with or without an endeoproteolytic cleavage site between each domain, may have an IgE leader sequence located N-terminal to the N-terminal HPV domain of the HPV antigen.
  • Antigens may optionally include signal peptides such as those from other proteins.
  • biosimilar refers to a biological product that is highly similar to the reference product notwithstanding minor differences in clinically inactive components with no clinically meaningful differences between the biosimilar and the reference product in terms of safety, purity and potency, based upon data derived from (a) analytical studies that demonstrate that the biological product is highly similar to the reference product notwithstanding minor differences in clinically inactive components; (b) animal studies (including the assessment of toxicity); and/or (c) a clinical study or studies (including the assessment of immunogenicity and pharmacokinetics or pharmacodynamics) that are sufficient to demonstrate safety, purity, and potency in one or more appropriate conditions of use for which the reference product is licensed and intended to be used and for which licensure is sought for the biosimilar.
  • the biosimilar may be an interchangeable product that may be substituted for the reference product at the pharmacy without the intervention of the prescribing healthcare professional.
  • the biosimilar is to be expected to produce the same clinical result as the reference product in any given patient and, if the biosimilar is administered more than once to an individual, the risk in terms of safety or diminished efficacy of alternating or switching between the use of the biosimilar and the reference product is not greater than the risk of using the reference product without such alternation or switch.
  • the biosimilar utilizes the same mechanisms of action for the proposed conditions of use to the extent the mechanisms are known for the reference product.
  • the condition or conditions of use prescribed, recommended, or suggested in the labeling proposed for the biosimilar have been previously approved for the reference product.
  • the route of administration, the dosage form, and/or the strength of the biosimilar re the same as those of the reference product and the biosimilar is manufactured, processed, packed or held in a facility that meets standards designed to assure that the biosimilar continues to be safe, pure and potent.
  • the biosimilar may include minor modifications in the amino acid sequence when compared to the reference product, such as N- or C-terminal truncations that are not expected to change the biosimilar performance.
  • “Coding sequence” or “encoding nucleic acid” as used herein means the nucleic acids (RNA or DNA molecule) that comprise a nucleotide sequence which encodes a protein.
  • the coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.
  • “Complement” or “complementary” as used herein refers to a nucleic acid molecule that has Watson-Crick (e.g., A-T/U and C-G) or Hoogsteen base pairing between nucleotides or nucleotide analogs with a reference nucleic acid molecule.
  • “Consensus” or “consensus sequence” as used herein means a polypeptide sequence based on analysis of an alignment of multiple sequences for the same gene from different organisms.
  • Nucleic acid sequences that encode a consensus polypeptide sequence can be prepared. Immunogenic compositions comprising proteins that comprise consensus sequences and/or nucleic acid molecules that encode such proteins can be used to induce broad immunity against an antigen.
  • “Electroporation,” “electro-permeabilization,” or “electro-kinetic enhancement” (“EP”) as used interchangeably herein means the use of a transmembrane electric field pulse to induce microscopic pathways (pores) in a bio-membrane; their presence allows biomolecules such as plasmids, oligonucleotides, siRNA, drugs, ions, and water to pass from one side of the cellular membrane to the other.
  • fragment as used herein with respect to nucleic acid sequences means a nucleic acid sequence or a portion thereof, that encodes a polypeptide capable of eliciting an immune response in a mammal that cross reacts with an antigen disclosed herein.
  • the fragments can be DNA fragments selected from at least one of the various nucleotide sequences that encode protein fragments set forth below. Fragments can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% of one or more of the nucleic acid sequences set forth below.
  • fragments can comprise at least 20 nucleotides or more, at least 30 nucleotides or more, at least 40 nucleotides or more, at least 50 nucleotides or more, at least 60 nucleotides or more, at least 70 nucleotides or more, at least 80 nucleotides or more, at least 90 nucleotides or more, at least 100 nucleotides or more, at least 150 nucleotides or more, at least 200 nucleotides or more, at least 250 nucleotides or more, at least 300 nucleotides or more, at least 350 nucleotides or more, at least 400 nucleotides or more, at least 450 nucleotides or more, at least 500 nucleotides or more, at least 550 nucleotides or more, at least 600 nucleotides or more, at least 650 nucleotides or more, at least 700 nucleotides or more, at least 750 nucleotides or more,
  • “Fragment” or “immunogenic fragment” with respect to polypeptide sequences means a polypeptide capable of eliciting an immune response in a mammal that cross reacts with an antigen disclosed herein.
  • the fragments can be polypeptide fragments selected from at least one of the various amino acid sequences below.
  • Fragments of consensus proteins can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or at least 95% of a consensus protein.
  • fragments of consensus proteins can comprise at least 20 amino acids or more, at least 30 amino acids or more, at least 40 amino acids or more, at least 50 amino acids or more, at least 60 amino acids or more, at least 70 amino acids or more, at least 80 amino acids or more, at least 90 amino acids or more, at least 100 amino acids or more, at least 110 amino acids or more, at least 120 amino acids or more, at least 130 amino acids or more, at least 140 amino acids or more, at least 150 amino acids or more, at least 160 amino acids or more, at least 170 amino acids or more, at least 180 amino acids or more of a protein sequence disclosed herein.
  • the term “genetic construct” refers to the DNA or RNA molecules that comprise a nucleotide sequence which encodes a protein.
  • the coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered.
  • the term “expressible form” refers to gene constructs that contain the necessary regulatory elements of the individual, the coding sequence will be expressed.
  • a partially complementary sequence that at least partially inhibits a completely complementary sequence from hybridizing to a target nucleic acid is referred to using the functional term "substantially homologous.”
  • substantially homologous refers to a probe that can hybridize to a strand of the double-stranded nucleic acid sequence under conditions of low stringency.
  • substantially homologous refers to a probe that can hybridize to (i.e., is the complement of) the single-stranded nucleic acid template sequence under conditions of low stringency.
  • Identity as used herein in the context of two or more nucleic acids or polypeptide sequences means that the sequences have a specified percentage of residues that are the same over a specified region.
  • the percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity.
  • the residues of single sequence are included in the denominator but not the numerator of the calculation.
  • INO-3107 refers to an immunogenic composition of two DNA plasmids: a DNA plasmid pGX3024 encoding an HPV antigen comprising SynCon® E6 and E7 antigens of both HPV6 and HPV11 in combination with DNA plasmid pGX6010 encoding human IL-12.
  • the amino acid sequence of the HPV antigen comprising SynCon® E6 and E7 antigens of both HPV6 and HPV11 is provided in SEQ ID NO: 1.
  • the nucleotide sequence encoding the HPV antigen comprising SynCon® E6 and E7 antigens of both HPV6 pGX3024 is set forth in SEQ ID NO: 3.
  • the sequence of DNA plasmid pGX6010 is set forth in SEQ ID NO: 4.
  • “INO-3107” may further include saline-sodium citrate buffer.
  • “INO-3107 drug product” refers to an immunogenic composition containing 6.25 mg total plasmid/mL (6 mg/mL pGX3024, 0.25 mg/mL pGX6010) in 150 mM sodium chloride and 15 mM sodium citrate, pH 7.
  • Immuno response means the activation of a host’s immune system, e.g., that of a mammal, in response to the introduction of antigen.
  • the immune response can be in the form of a cellular or humoral response, or both.
  • Nucleic acid or “oligonucleotide” or “polynucleotide” as used herein means at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand.
  • nucleic acid can be used for the same purpose as a given nucleic acid.
  • a nucleic acid also encompasses substantially identical nucleic acids and complements thereof.
  • a single strand provides a probe that can hybridize to a target sequence under stringent hybridization conditions.
  • a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.
  • Nucleic acids can be single stranded or double-stranded or can contain portions of both double-stranded and single-stranded sequence.
  • the nucleic acid can be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid can contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids can be obtained by chemical synthesis methods or by recombinant methods. [0059] “Operably linked” as used herein means that expression of a gene is under the control of a promoter with which it is spatially connected.
  • a promoter can be positioned 5' (upstream) or 3' (downstream) of a gene under its control.
  • the distance between the promoter and a gene can be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance can be accommodated without loss of promoter function.
  • Promoter means a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell.
  • a promoter can comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same.
  • a promoter can also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.
  • a promoter can be derived from sources including viral, bacterial, fungal, plants, insects, and animals.
  • a promoter can regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents.
  • promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, SV40 late promoter, SV40 early promoter, RSV-LTR promoter, CMV IE promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.
  • Signal peptide and leader sequence are used interchangeably herein and refer to an amino acid sequence that can be linked at the amino terminus of a protein set forth herein.
  • Signal peptides/leader sequences typically direct localization of a protein.
  • Signal peptides/leader sequences used herein can facilitate secretion of the protein from the cell in which it is produced.
  • Signal peptides/leader sequences are often cleaved from the remainder of the protein, often referred to as the mature protein, upon secretion from the cell.
  • Signal peptides/leader sequences are linked at the amino terminus (i.e., N terminus) of the protein.
  • “Substantially complementary” as used herein means that a first sequence is at least 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540, or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.
  • “Substantially identical” as used herein means that a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 180, 270, 360, 450, 540 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.
  • a subject in need thereof means a human or non- human mammal that exhibits one or more symptoms or indications of recurrent respiratory papillomatosis (RRP), and/or who has been diagnosed with RRP, and who needs treatment for the same.
  • RRP recurrent respiratory papillomatosis
  • the term "subject” may be interchangeably used with the term “patient”.
  • a human subject may be diagnosed with RRP and/or with one or more symptoms or indications including, but not limited to, hoarseness, weak cry, chronic coughing, breathing problems, dyspnea, recurrent upper respiratory tract infections, pneumonia, dysphagia, stridor, failure to thrive, and/or respiratory tumors.
  • the expression includes subjects who have been newly diagnosed.
  • the expression includes subjects for whom treatment in accordance with the disclosed methods is an initial treatment (e.g.,“first line” treatment, wherein the patient has not received prior systemic treatment for RRP).
  • the expression includes subjects for whom treatment in accordance with the disclosed methods is “second- line” treatment, wherein the patient has been previously treated with “standard-of-care” therapy including, but not limited to surgery, antiviral therapy, and tracheostomy.
  • the term “treat”, “treating”, or the like means to alleviate symptoms, eliminate the causation of symptoms either on a temporary or permanent basis, to delay or inhibit tumor growth, to reduce tumor cell load or tumor burden, to promote tumor regression, to cause tumor shrinkage, necrosis and/or disappearance, to prevent tumor recurrence, to prevent or inhibit malignant transformation, and/or to increase duration of survival of the subject.
  • the term “clinically proven” (used independently or to modify the terms "safe” and/or “effective”) shall mean that it has been proven by a clinical trial wherein the clinical trial has met the approval standards of U.S. Food and Drug Administration, EMA or a corresponding national regulatory agency.
  • proof may be provided by the clinical trial(s) described in the examples provided herein.
  • the term "clinically proven safe”, as it relates to a dose, dosage regimen, treatment or method with a human papillomavirus (HPV) antigen refers to a favorable risk:benefit ratio with an acceptable frequency and/or acceptable severity of treatment-emergent adverse events (referred to as TEAEs) compared to the standard of care or to another comparator.
  • HPV human papillomavirus
  • An adverse event is an untoward medical occurrence in a patient administered a medicinal product.
  • NCI National Cancer Institute
  • AE adverse events graded per Common Toxicity Criteria for Adverse Events CTCAE v5.0.
  • Efficacy can be measured based on change in the course of the disease in response to an agent of the present invention.
  • a human papillomavirus (HPV) antigen for example, a HPV antigen administered as pGX3024 or INO-3107 drug product or a biosimilar thereof
  • HPV human papillomavirus
  • a HPV antigen administered as pGX3024 or INO-3107 drug product or a biosimilar thereof is administered to a patient in an amount and for a time sufficient to induce an improvement, preferably a sustained improvement, in at least one indicator that reflects the severity of the disorder that is being treated.
  • Various indicators that reflect the extent of the subject's illness, disease or condition may be assessed for determining whether the amount and time of the treatment is sufficient.
  • Such indicators include, for example, clinically recognized indicators of disease severity, symptoms, or manifestations of the disorder in question.
  • the degree of improvement generally is determined by a physician, who may make this determination based on signs, symptoms, biopsies, or other test results, and who may also employ questionnaires that are administered to the subject, such as quality-of-life questionnaires developed for a given disease. Improvement may be indicated by an improvement in an index of disease activity, by amelioration of clinical symptoms or by any other measure of disease activity.
  • human papillomavirus (HPV) antigen for example, a HPV antigen administered as pGX3024 or INO-3107 drug product or a biosimilar thereof
  • HPV HPV antigen
  • a change in RRP Staging Assessment score increased intersurgical interval
  • HPV clearance or reduced disease burden HPV clearance or reduced disease burden.
  • “Variant” used herein with respect to a nucleic acid means (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or a sequences substantially identical thereto.
  • a variant may be a nucleic acid sequence that is substantially identical over the full length of the full gene sequence or a fragment thereof.
  • the nucleic acid sequence may be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the gene sequence or a fragment thereof.
  • “Variant” with respect to a polypeptide is one that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retains at least one biological activity of the reference polypeptide.
  • Variant can also mean a protein with an amino acid sequence that is substantially identical to a reference protein with an amino acid sequence that retains at least one biological activity.
  • a variant may be an amino acid sequence that is substantially identical over the full length of the amino acid sequence or fragment thereof.
  • the amino acid sequence may be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the amino acid sequence or a fragment thereof.
  • “Vector” as used herein means a nucleic acid sequence containing an origin of replication.
  • a vector can be a viral vector, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome.
  • a vector can be a DNA or RNA vector.
  • a vector can be a self- replicating extrachromosomal vector, and in one embodiment, is an expression plasmid.
  • the vector can contain or include one or more heterologous nucleic acid sequences.
  • the phrase “in combination with” means that the HPV6 E6 and E7 antigens and HPV11 E6 and E7 antigens are administered to the subject at the same time as, just before, or just after administration of the adjuvant. In certain embodiments, the HPV6 E6 and E7 antigens and HPV11 E6 and E7 antigens are administered as a co- formulation with the adjuvant.
  • the term "clinically proven” (used independently or to modify the terms “safe” and/or “effective”) shall mean that it has been proven by a clinical trial wherein the clinical trial has met the approval standards of U.S. Food and Drug Administration, EMA or a corresponding national regulatory agency. For example, proof may be provided by the clinical trial described in the example provided herein.
  • An adverse event is an untoward medical occurrence in a subject administered a medicinal product.
  • Efficacy can be measured based on change in the course of the disease in response to an agent of the present invention.
  • a combination of HPV6 E6 and E7 antigens and HPV11 E6 and E7 antigens (for example, administered as pGX3024) with an adjuvant, such as IL-12 (for example, administered as pGX6010) is administered to a subject in an amount and for a time sufficient to induce an improvement, preferably a sustained improvement, in at least one indicator that reflects the severity of the disorder that is being treated.
  • indicators that reflect the extent of the subject's illness, disease or condition may be assessed for determining whether the amount and time of the treatment is sufficient.
  • Such indicators include, for example, clinically recognized indicators of disease severity, symptoms, or manifestations of the disorder in question.
  • the degree of improvement generally is determined by a physician, who may make this determination based on signs, symptoms, biopsies, or other test results, and who may also employ questionnaires that are administered to the subject, such as quality-of- life questionnaires developed for a given disease.
  • the combination of HPV6 E6 and E7 antigens and HPV11 E6 and E7 antigens may be administered to achieve an improvement in a patient's condition related to RRP. Improvement may be indicated by an improvement in an index of disease activity, by amelioration of clinical symptoms or by any other measure of disease activity.
  • nucleic acid molecules, proteins, immunogenic compositions, including vaccines, and methods of their use to induce an immune response and/or prevent or treat RRP may be administered to achieve an improvement in a patient's condition related to RRP. Improvement may be indicated by an improvement in an index of disease activity, by amelioration of clinical symptoms or by any other measure of disease activity.
  • the immunogenic compositions preferably include a human papillomavirus (HPV) antigen comprising a HPV6 E6 antigenic domain, a HPV6 E7 antigenic domain, a HPV11 E6 antigenic domain, and a HPV11 E7 antigenic domain.
  • HPV human papillomavirus
  • the disclosed immunogenic compositions arise from a multi-phase strategy in which modified consensus sequences were generated and genetic modifications, including codon optimization, RNA optimization, and the addition of a high efficient immunoglobin leader sequence, were made.
  • the immunogenic compositions can be used to protect against multiple strains of HPV, thereby treating, preventing, and/or protecting against HPV-based pathologies.
  • the immunogenic compositions can be used to prevent or treat HPV6- and/or HPV11-based pathologies.
  • the immunogenic compositions can significantly induce an immune response of a subject administered the immunogenic composition, thereby protecting against and treating HPV6 infection, HPV11 infection, or both.
  • the vaccine can be a DNA vaccine, a peptide vaccine, or a combination DNA and peptide vaccine.
  • the DNA vaccine can include a nucleic acid sequence encoding the HPV antigen.
  • the nucleic acid sequence can be DNA, RNA, cDNA, a variant thereof, a fragment thereof, or a combination thereof.
  • the nucleic acid sequence can also include additional sequences that encode linker, leader, or tag sequences that are linked to the HPV antigen by a peptide bond.
  • the peptide vaccine can include a HPV antigenic peptide, a HPV antigenic protein, a variant thereof, a fragment thereof, or a combination thereof.
  • the combination DNA and peptide vaccine can include the above described nucleic acid sequence encoding the HPV antigen and the HPV antigenic peptide or protein, in which the HPV antigenic peptide or protein and the encoded HPV antigen have the same amino acid sequence.
  • the vaccine can induce a humoral immune response in the subject administered the vaccine.
  • the induced humoral immune response can be specific for the HPV6 E6 antigenic domain, the HPV6 E7 antigenic domain, the HPV11 E6 antigenic domain, the HPV11 E7 antigenic domain, or any combination thereof.
  • the induced humoral immune response can be reactive with the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • the humoral immune response can be induced in the subject administered the vaccine by about 1.5-fold to about 16-fold, about 2-fold to about 12-fold, or about 3-fold to about 10-fold.
  • the humoral immune response can be induced in the subject administered the vaccine by at least about 1.5-fold, at least about 2.0-fold, at least about 2.5-fold, at least about 3.0-fold, at least about 3.5-fold, at least about 4.0-fold, at least about 4.5-fold, at least about 5.0-fold, at least about 5.5-fold, at least about 6.0-fold, at least about 6.5-fold, at least about 7.0-fold, at least about 7.5-fold, at least about 8.0-fold, at least about 8.5-fold, at least about 9.0-fold, at least about 9.5-fold, at least about 10.0-fold, at least about 10.5-fold, at least about 11.0-fold, at least about 11.5- fold, at least about 12.0-fold, at least about 12.5-fold, at least about 13.0-fold, at least about 13.5-fold, at least about 14.0-fold, at least about 14.5-fold, at least about 15.0-fold, at least about 15.5-fold, or at least about 16.0-fold.
  • the humoral immune response induced by the vaccine can include an increased level of IgG antibodies associated with the subject administered the vaccine as compared to a subject not administered the vaccine.
  • IgG antibodies can be specific for the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • These IgG antibodies can be reactive with the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • the level of IgG antibody associated with the subject administered the vaccine can be increased by about 1.5-fold to about 16-fold, about 2-fold to about 12-fold, or about 3-fold to about 10-fold as compared to the subject not administered the vaccine.
  • the level of IgG antibody associated with the subject administered the vaccine can be increased by at least about 1.5-fold, at least about 2.0-fold, at least about 2.5-fold, at least about 3.0-fold, at least about 3.5-fold, at least about 4.0-fold, at least about 4.5-fold, at least about 5.0-fold, at least about 5.5-fold, at least about 6.0-fold, at least about 6.5-fold, at least about 7.0-fold, at least about 7.5-fold, at least about 8.0-fold, at least about 8.5-fold, at least about 9.0-fold, at least about 9.5-fold, at least about 10.0-fold, at least about 10.5-fold, at least about 11.0-fold, at least about 11.5-fold, at least about 12.0-fold, at least about 12.5-fold, at least about
  • the vaccine can induce a cellular immune response in the subject administered the vaccine.
  • the induced cellular immune response can be specific for the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • the induced cellular immune response can be reactive to the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • the induced cellular immune response can include eliciting a T cell response.
  • the elicited T cell response can be reactive with the HPV6 E6 antigen, the HPV6 E7 antigen, the HPV11 E6 antigen, the HPV11 E7 antigen, or any combination thereof.
  • the elicited T cell response can be polyfunctional.
  • the induced cellular immune response can include eliciting a T cell response, in which the T cells produce interferon-gamma (IFN- ⁇ ).
  • the induced cellular immune response can include an increased T cell response associated with the subject administered the vaccine as compared to the subject not administered the vaccine.
  • the T cell response associated with the subject administered the vaccine can be increased by about 2-fold to about 30-fold, about 3-fold to about 25-fold, or about 4-fold to about 20-fold as compared to the subject not administered the vaccine.
  • the T cell response associated with the subject administered the vaccine can be increased by at least about 1.5- fold, at least about 2.0-fold, at least about 3.0-fold, at least about 4.0-fold, at least about 5.0- fold, at least about 6.0-fold, at least about 6.5-fold, at least about 7.0-fold, at least about 7.5- fold, at least about 8.0-fold, at least about 8.5-fold, at least about 9.0-fold, at least about 9.5- fold, at least about 10.0-fold, at least about 10.5-fold, at least about 11.0-fold, at least about 11.5-fold, at least about 12.0-fold, at least about 12.5-fold, at least about 13.0-fold, at least about 13.5-fold, at least about 14.0-fold, at least about 14.5-fold, at least about 15.0-fold, at least about 16.0-fold, at least about 17.0-fold, at least about 18.0-fold, at least about 19.0- fold, at least about 20.0-fold, at least about 21.0-fold, at least about 22.0-fold, at least about 23.
  • the vaccine of the present invention can have features required of effective vaccines such as being safe so the vaccine itself does not cause illness or death; is protective against illness resulting from exposure to live pathogens such as viruses or bacteria; induces antibody to prevent invention of cells; induces protective T cells against intracellular pathogens; and provides ease of administration, few side effects, biological stability, and low cost per dose.
  • the vaccine can further induce an immune response when administered to different tissues such as the muscle or skin.
  • the vaccine can further induce an immune response when administered via electroporation, or injection, or subcutaneously, or intramuscularly.
  • the HPV antigen is capable of eliciting an immune response in a mammal against one or more HPV strains.
  • HPV antigens comprising a HPV6 antigenic domain and a HPV11 antigenic domain.
  • the HPV6 antigenic domain may be located N-terminal or C-terminal to the HPV11 antigenic domain.
  • the HPV6 antigenic domain comprises an HPV6 E6 antigenic domain, a fragment thereof, or a variant thereof and an HPV6 E7 antigenic domain, a fragment thereof, a variant thereof, or a combination thereof.
  • the HPV6 E6 antigenic domain may be located N-terminal or C-terminal to the HPV6 E7 antigenic domain.
  • the HPV6 E6 antigenic domain can comprise an epitope(s) that makes it particularly effective as an immunogen against which an immune response can be induced.
  • the HPV6 E6 antigenic domain can be a consensus sequence derived from two or more strains of HPV6.
  • the HPV6 E6 antigenic domain can comprise a consensus sequence and/or modification(s) for improved expression. Modification can include codon optimization, RNA optimization, addition of a kozak sequence for increased translation initiation, and/or the addition of an immunoglobulin leader sequence to increase the immunogenicity of the HPV6 E6 antigenic domain.
  • the HPV6 E6 consensus antigenic domain can comprise a signal peptide such as an immunoglobulin signal peptide, for example, but not limited to, an immunoglobulin E (IgE) or immunoglobulin (IgG) signal peptide.
  • the HPV6 E6 consensus antigenic domain can comprise a hemagglutinin (HA) tag.
  • the HPV6 E6 consensus antigenic domain can be designed to elicit stronger and broader cellular and/or humoral immune responses than a corresponding codon optimized HPV6 E6 antigenic domain.
  • the HPV6 E7 antigenic domain can comprise an epitope(s) that makes it particularly effective as an immunogen against which an immune response can be induced.
  • the HPV6 E7 antigenic domain can be a consensus sequence derived from two or more strains of HPV6.
  • the HPV6 E7 antigenic domain can comprise a consensus sequence and/or modification(s) for improved expression. Modification can include codon optimization, RNA optimization, addition of a kozak sequence for increased translation initiation, and/or the addition of an immunoglobulin leader sequence to increase the immunogenicity of the HPV6 E7 antigenic domain.
  • the HPV6 E7 consensus antigenic domain can comprise a signal peptide such as an immunoglobulin signal peptide, for example, but not limited to, an immunoglobulin E (IgE) or immunoglobulin (IgG) signal peptide.
  • the HPV6 E7 consensus antigenic domain can comprise a hemagglutinin (HA) tag.
  • the HPV6 E7 consensus antigenic domain can be designed to elicit stronger and broader cellular and/or humoral immune responses than a corresponding codon optimized HPV6 E7 antigenic domain.
  • the HPV11 antigenic domain comprises an HPV11 E6 antigenic domain, a fragment thereof, or a variant thereof and an HPV11 E7 antigenic domain, a fragment thereof, a variant thereof, or a combination thereof.
  • the HPV11 E6 antigenic domain may be positioned N-terminal or C-terminal to the HPV11 E7 antigenic domain.
  • the HPV11 E6 antigenic domain can comprise an epitope(s) that makes it particularly effective as an immunogen against which an immune response can be induced.
  • the HPV11 E6 antigenic domain can be a consensus sequence derived from two or more strains of HPV11.
  • the HPV11 E6 antigenic domain can comprise a consensus sequence and/or modification(s) for improved expression. Modification can include codon optimization, RNA optimization, addition of a kozak sequence for increased translation initiation, and/or the addition of an immunoglobulin leader sequence to increase the immunogenicity of the HPV11 E6 antigenic domain.
  • the HPV11 E6 consensus antigenic domain can comprise a signal peptide such as an immunoglobulin signal peptide, for example, but not limited to, an immunoglobulin E (IgE) or immunoglobulin (IgG) signal peptide.
  • the HPV11 E6 consensus antigenic domain can comprise a hemagglutinin (HA) tag.
  • the HPV11 E6 consensus antigenic domain can be designed to elicit stronger and broader cellular and/or humoral immune responses than a corresponding codon optimized HPV11 E6 antigenic domain.
  • the HPV11 E7 antigenic domain can comprise an epitope(s) that makes it particularly effective as an immunogen against which an immune response can be induced.
  • the HPV11 E7 antigenic domain can be a consensus sequence derived from two or more strains of HPV11.
  • the HPV11 E7 antigenic domain can comprise a consensus sequence and/or modification(s) for improved expression. Modification can include codon optimization, RNA optimization, addition of a kozak sequence for increased translation initiation, and/or the addition of an immunoglobulin leader sequence to increase the immunogenicity of the HPV11 E7 antigenic domain.
  • the HPV11 E7 consensus antigenic domain can comprise a signal peptide such as an immunoglobulin signal peptide, for example, but not limited to, an immunoglobulin E (IgE) or immunoglobulin (IgG) signal peptide.
  • the HPV11 E7 consensus antigenic domain can comprise a hemagglutinin (HA) tag.
  • HA hemagglutinin
  • the HPV11 E7 consensus antigenic domain can be designed to elicit stronger and broader cellular and/or humoral immune responses than a corresponding codon optimized HPV11 E7 antigenic domain.
  • the HPV antigen comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; an amino acid sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; an immunogenic fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; or an amino acid sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to an immunogenic fragment of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • Fragments of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11 can comprise 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more percent of the length of the full length of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • Fragments of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11 can comprise 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more percent of the length of the full length of the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • Fragments of SEQ ID NO:1 or SEQ ID NO: 11 may be 100% identical to the full-length reference sequence except missing at least one amino acid from the N and/or C terminal, in each case with or without signal peptides and/or a methionine at position 1.
  • Fragments of SEQ ID NO:1 or SEQ ID NO: 11 can comprise 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more percent of the length of the full length SEQ ID NO:1 or SEQ ID NO: 11, excluding any heterologous signal peptide added.
  • the fragment can, preferably, comprise a fragment of SEQ ID NO:1 or SEQ ID NO: 11 that is 95% or more, 96% or more, 97% or more, 98% or more or 99% or more homologous to SEQ ID NO:1 or SEQ ID NO: 11 and additionally comprise an N terminal methionine or heterologous signal peptide which is not included when calculating percent homology Fragments can further comprise an N- terminal methionine and/or a signal peptide such as an immunoglobulin signal peptide, for example an IgE or IgG signal peptide. The N-terminal methionine and/or signal peptide may be linked to the fragment.
  • fragments of SEQ ID NO:1 or SEQ ID NO: 11 may comprise 100 or more residues; in some embodiments, 200 or more residues; in some embodiments 300 or more residues; in some embodiments, 400 or more residues; and in some embodiments 500 or more residues.
  • the HPV antigen may comprise HPV6 and HPV11 antigenic domains separated by one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • a post-translational cleavage site is located between the HPV6 and HPV11 antigen domains, between the HPV6 E6 and E7 antigenic domains, and/or between the HPV11 E6 and E7 antigenic domains.
  • a translational skipping site is located between the HPV6 and HPV11 antigen domains, between the HPV6 E6 and E7 antigenic domains, and/or between the HPV11 E6 and E7 antigenic domains.
  • a post-translational cleavage site and a translational skipping site are located between the HPV6 and HPV11 antigen domains, between the HPV6 E6 and E7 antigen domains, and/or between the HPV11 E6 and E7 antigenic domains.
  • the post-translational cleavage site is a furin cleavage site.
  • the translational skipping site is a P2A site.
  • the HPV immunogenic protein comprises the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 11.
  • the HPV antigen comprises the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; an amino acid sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to SEQ ID NO:1 or SEQ ID NO: 11; an immunogenic fragment of SEQ ID NO:1 or SEQ ID NO: 11; or an amino acid sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to an immunogenic fragment of SEQ ID NO:1 or SEQ ID NO: 11.
  • Proteins of the invention may be generated using well known techniques.
  • DNA molecules that encode a protein of the invention can be inserted into a commercially available expression vector for use in an expression system.
  • the protein produced is recovered from the culture, either by lysing the cells or from the culture medium as appropriate and known to those in the art.
  • One having ordinary skill in the art can, using well known techniques, isolate protein that is produced using such expression systems.
  • the methods of purifying protein from natural sources using antibodies which specifically bind to a specific protein as described above may be equally applied to purifying protein produced by recombinant DNA methodology.
  • automated peptide synthesizers may also be employed to produce isolated, essentially pure protein.
  • the HPV antigen can be a nucleic acid molecule that encodes the HPV6- HPV11 fusion antigen disclosed herein.
  • the nucleotide sequence encoding the HPV11 antigenic domain may be located 5’ or 3’ to the nucleotide sequence encoding the HPV6 antigenic domain.
  • the nucleic acid sequence encoding the HPV6 antigenic domain comprises a nucleic acid sequence encoding a HPV6 E6 antigenic domain and a HPV6 E7 antigenic domain.
  • the nucleic acid sequence encoding the HPV6 E6 antigenic domain may be located 5’ or 3’ to the nucleic acid sequence encoding the HPV6 E7 antigenic domain.
  • the nucleic acid sequence encoding the HPV11 antigenic domain comprises a nucleic acid sequence encoding a HPV11 E6 antigenic domain and a HPV11 E7 antigenic domain.
  • the nucleic acid sequence encoding the HPV11 E6 antigenic domain may be located 5’ or 3’ to the nucleic acid sequence encoding the HPV11 E7 antigenic domain.
  • nucleotide sequences encoding antigenic domains of the HPV antigen may be separated by nucleotide sequences encoding one or more post- translational cleavage sites, one or more translational skipping sites, or both.
  • a nucleotide sequence encoding a post-translational cleavage site is located between the nucleotide sequences encoding the HPV6 and HPV11 antigenic domains, between the nucleotide sequences encoding the HPV6 E6 and E7 antigenic domains, between the nucleotide sequences encoding the HPV11 E6 and E7 antigenic domains, or any combination thereof.
  • nucleotide sequences encoding a translational skipping site is located between the nucleotide sequences encoding the HPV6 and HPV11 antigen domains, between the nucleotide sequences encoding the HPV6 E6 and E7 antigen domains, between the nucleotide sequences encoding the HPV11 E6 and E7 antigenic domains, or any combination thereof.
  • nucleotide sequences encoding a post-translational cleavage site and a translational skipping site are located between the nucleotide sequences encoding the HPV6 and HPV11 antigenic domains, between the nucleotide sequences encoding the HPV6 E6 and E7 antigenic domains, between the nucleotide sequences encoding the HPV11 E6 and E7 antigenic domains, or any combination thereof.
  • the post-translational cleavage site is a furin cleavage site.
  • the translational skipping site is a P2A site.
  • the nucleic acid sequence encoding the HPV antigen comprises: the nucleotide sequence of SEQ ID NO:2 or SEQ ID NO: 12; a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to the nucleotide sequence of SEQ ID NO:2 or SEQ ID NO: 12; a fragment of the nucleotide sequence of SEQ ID NO:2 or SEQ ID NO: 12; or a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to a fragment of the nucleotide sequence of SEQ ID NO:2 or SEQ ID NO: 12.
  • Fragments can further comprise coding sequences for an N terminal methionine and/or a signal peptide such as an immunoglobulin signal peptide, for example an IgE or IgG signal peptide.
  • the coding sequence encoding the N-terminal methionine and/or signal peptide may be linked to the fragment.
  • Nucleic acid molecules that comprise a nucleotide sequence that encodes the immunogen(s) may be operably linked to regulatory elements.
  • the nucleic acid molecule can be DNA, RNA, cDNA, a variant thereof, a fragment thereof, or a combination thereof.
  • the nucleic acid sequence can also include additional sequences that encode linker or tag sequences that are linked to the antigen by a peptide bond.
  • the nucleic acid molecule encoding the HPV antigen is an expression vector.
  • An expression vector can be a circular plasmid or a linear nucleic acid.
  • An expression vector is capable of directing expression of a particular nucleotide sequence in an appropriate subject cell.
  • An expression vector can have a promoter operably linked to the antigen-encoding nucleotide sequence, which may be operably linked to termination signals.
  • An expression vector can also contain sequences required for proper translation of the nucleotide sequence.
  • the expression vector comprising the nucleotide sequence of interest may be chimeric, meaning that at least one of its components is heterologous with respect to at least one of its other components.
  • the expression of the nucleotide sequence in the expression cassette may be under the control of a constitutive promoter or of an inducible promoter, which initiates transcription only when the host cell is exposed to some particular external stimulus.
  • the promoter can also be specific to a particular tissue or organ or stage of development.
  • the nucleic acid is an RNA molecule.
  • the invention provides an RNA molecule encoding one or more polypeptides of interest.
  • the RNA may be plus-stranded.
  • the RNA molecule can be translated by cells without needing any intervening replication steps such as reverse transcription.
  • An RNA molecule useful with the invention may have a 5′ cap (e.g.
  • RNA molecule useful with the invention may have a 5′ triphosphate group. In a capped RNA this may be linked to a 7- methylguanosine via a 5′-to-5′ bridge.
  • An RNA molecule may have a 3′ poly-A tail. It may also include a poly-A polymerase recognition sequence (e.g. AAUAAA) near its 3′ end.
  • An RNA molecule useful with the invention may be single- stranded.
  • the RNA molecule is a naked RNA molecule.
  • the RNA molecule is comprised within a vector.
  • the RNA has 5' and 3' UTRs.
  • the 5' UTR is between zero and 3000 nucleotides in length.
  • the length of 5' and 3' UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5' and 3' UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.
  • the 5' and 3' UTRs can be the naturally occurring, endogenous 5' and 3' UTRs for the gene of interest.
  • UTR sequences that are not endogenous to the gene of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template.
  • the use of UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA.
  • UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA.
  • AU-rich elements in 3' UTR sequences can decrease the stability of RNA. Therefore, 3' UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.
  • the 5' UTR can contain the Kozak sequence of the endogenous gene.
  • a consensus Kozak sequence can be redesigned by adding the 5' UTR sequence.
  • Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many RNAs is known in the art.
  • the 5' UTR can be derived from an RNA virus whose RNA genome is stable in cells.
  • various nucleotide analogues can be used in the 3' or 5' UTR to impede exonuclease degradation of the RNA.
  • the RNA has both a cap on the 5' end and a 3' poly(A) tail which determine ribosome binding, initiation of translation and stability of RNA in the cell.
  • the RNA is a nucleoside-modified RNA. Nucleoside- modified RNA have particular advantages over non-modified RNA, including for example, increased stability, low or absent innate immunogenicity, and enhanced translation.
  • the expression vector may be a circular plasmid, which may transform a target cell by integration into the cellular genome or exist extrachromosomally (e.g., autonomous replicating plasmid with an origin of replication).
  • the vector can be pVAX, pcDNA3.0, or provax, or any other expression vector capable of expressing DNA encoding the antigen and enabling a cell to translate the sequence to an antigen that is recognized by the immune system.
  • a linear nucleic acid immunogenic composition or linear expression cassette (“LEC”), that is capable of being efficiently delivered to a subject via electroporation and expressing one or more desired antigens.
  • the LEC may be any linear DNA devoid of any phosphate backbone.
  • the DNA may encode one or more antigens.
  • the LEC may contain a promoter, an intron, a stop codon, and/or a polyadenylation signal. The expression of the antigen may be controlled by the promoter.
  • the LEC may not contain any antibiotic resistance genes and/or a phosphate backbone.
  • the LEC may not contain other nucleotide sequences unrelated to the desired antigen gene expression.
  • the LEC may be derived from any plasmid capable of being linearized.
  • the plasmid may be capable of expressing the antigen.
  • the plasmid can be pNP (Puerto Rico/34) or pM2 (New Caledonia/99).
  • the plasmid may be WLV009, pVAX, pcDNA3.0, or provax, or any other expression vector capable of expressing DNA encoding the antigen and enabling a cell to translate the sequence to an antigen that is recognized by the immune system.
  • the LEC can be pcrM2.
  • the LEC can be pcrNP.
  • pcrNP and pcrMR can be derived from pNP (Puerto Rico/34) and pM2 (New Caledonia/99), respectively.
  • the vector can comprise heterologous nucleic acid encoding the above described antigens and can further comprise an initiation codon, which can be upstream of the one or more cancer antigen coding sequence(s), and a stop codon, which can be downstream of the coding sequence(s) of the above described antigens.
  • the vector may have a promoter.
  • a promoter may be any promoter that is capable of driving gene expression and regulating expression of the isolated nucleic acid.
  • Such a promoter is a cis-acting sequence element required for transcription via a DNA dependent RNA polymerase, which transcribes the antigen sequence described herein. Selection of the promoter used to direct expression of a heterologous nucleic acid depends on the particular application.
  • the promoter may be positioned about the same distance from the transcription start in the vector as it is from the transcription start site in its natural setting. However, variation in this distance may be accommodated without loss of promoter function.
  • the initiation and termination codon can be in frame with the coding sequence(s) of the above described antigens.
  • the vector can also comprise a promoter that is operably linked to the coding sequence(s) of the above described antigens.
  • the promoter operably linked to the coding sequence(s) of the above described antigens can be a promoter from simian virus 40 (SV40), a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) promoter such as the bovine immunodeficiency virus (BIV) long terminal repeat (LTR) promoter, a Moloney virus promoter, an avian leukosis virus (ALV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter, Epstein Barr virus (EBV) promoter, or a Rous sarcoma virus (RSV) promoter.
  • SV40 simian virus 40
  • MMTV mouse mammary tumor virus
  • HSV human immunodeficiency virus
  • HSV human immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • LTR long terminal repeat
  • Moloney virus promoter an avian leukosis virus (ALV
  • the promoter can also be a promoter from a human gene such as human actin, human myosin, human hemoglobin, human muscle creatine, or human metallothionein.
  • the promoter can also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic. Examples of such promoters are described in US patent application publication no. US20040175727, the contents of which are incorporated herein in its entirety.
  • the vector can also comprise a polyadenylation signal, which can be downstream of the coding sequence(s) of the above described antigens and/or antibodies.
  • the polyadenylation signal can be a SV40 polyadenylation signal, LTR polyadenylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human ⁇ -globin polyadenylation signal.
  • the SV40 polyadenylation signal can be a polyadenylation signal from a pCEP4 vector (Invitrogen, San Diego, CA).
  • the vector can also comprise an enhancer upstream of the above described antigens.
  • the enhancer can be necessary for expression.
  • the enhancer can be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, HA, RSV or EBV.
  • the vector may include an enhancer and an intron with functional splice donor and acceptor sites.
  • the vector may contain a transcription termination region downstream of the structural gene to provide for efficient termination.
  • the termination region may be obtained from the same gene as the promoter sequence or may be obtained from different genes.
  • the vector can further comprise elements or reagents that inhibit it from integrating into the chromosome.
  • the vector can comprise a mammalian origin of replication in order to maintain the vector extrachromosomally and produce multiple copies of the vector in a cell.
  • the vector can be pVAX1, pCEP4 or pREP4 from Invitrogen (San Diego, CA), which can comprise the Epstein Barr virus origin of replication and nuclear antigen EBNA-1 coding region, which can produce high copy episomal replication without integration.
  • the vector can be pVAX1 or a pVAX1 variant with changes such as the variant plasmid described herein.
  • the variant pVax1 plasmid is a 2998 base pair variant of the backbone vector plasmid pVAX1 (Invitrogen, Carlsbad CA).
  • the CMV promoter is located at bases 137-724.
  • the T7 promoter/priming site is at bases 664-683. Multiple cloning sites are at bases 696-811.
  • Bovine GH polyadenylation signal is at bases 829-1053.
  • the Kanamycin resistance gene is at bases 1226-2020.
  • the pUC origin is at bases 2320-2993.
  • the following mutations were found in the sequence of pVAX1: C>G241 in CMV promoter C>T 1942 backbone, downstream of the bovine growth hormone polyadenylation signal (bGHpolyA) A> - 2876 backbone, downstream of the Kanamycin gene C>T 3277 in pUC origin of replication (Ori) high copy number mutation (see Nucleic Acid Research 1985) G>C 3753 in very end of pUC Ori upstream of RNASeH site Base pairs 2, 3 and 4 are changed from ACT to CTG in backbone, upstream of CMV promoter.
  • the backbone of the vector can be pAV0242.
  • the vector can be a replication defective adenovirus type 5 (Ad5) vector.
  • Ad5 replication defective adenovirus type 5
  • the vector can also comprise a regulatory sequence, which can be well suited for gene expression in a mammalian or human cell into which the vector is administered.
  • the antigen sequences disclosed herein can comprise a codon, which can allow more efficient transcription of the coding sequence in the host cell.
  • the vector can be pSE420 (Invitrogen, San Diego, Calif.), which can be used for protein production in Escherichia coli (E. coli).
  • the vector can also be pYES2 (Invitrogen, San Diego, Calif.), which can be used for protein production in Saccharomyces cerevisiae strains of yeast.
  • the vector can also be of the MAXBACTM complete baculovirus expression system (Invitrogen, San Diego, Calif.), which can be used for protein production in insect cells.
  • the vector can also be pcDNA I or pcDNA3 (Invitrogen, San Diego, Calif.), which may be used for protein production in mammalian cells such as Chinese hamster ovary (CHO) cells.
  • the vector can be expression vectors or systems to produce protein by routine techniques and readily available starting materials including Sambrook et al., Molecular Cloning and Laboratory Manual, Second Ed., Cold Spring Harbor (1989), incorporated fully herein by reference.
  • An exemplary DNA plasmid comprises SEQ ID NO: 3.
  • Immunogenic compositions of the invention may include a HPV antigen of the invention, a recombinant vaccine comprising a nucleotide sequence that encodes a HPV antigen of the invention, a live attenuated pathogen that encodes a HPV antigen of the invention and/or includes a HPV antigen of the invention; a killed pathogen including a HPV antigen of the invention; or a composition such as a liposome or subunit vaccine that comprises a HPV antigen of the invention.
  • the present invention further relates to pharmaceutical compositions, for example but not limited to injectable pharmaceutical compositions, that comprise the disclosed immunogenic compositions.
  • the immunogenic compositions of the invention may be formulated with suitable pharmaceutically acceptable carriers, excipients, and other agents that provide suitable transfer, delivery, tolerance, and the like.
  • the pharmaceutically acceptable excipient can be functional molecules such as vehicles, carriers, or diluents.
  • the pharmaceutically acceptable excipient can be a transfection facilitating agent, which can include surface active agents, such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.
  • the pharmaceutically acceptable excipient may be an adjuvant.
  • compositions and vaccines comprising the HPV antigen of the invention in combination with an adjuvant.
  • the adjuvant can be other genes that are expressed in an alternative plasmid or are delivered as proteins in combination with the HPV antigen of the invention.
  • the adjuvant may be selected from the group consisting of: ⁇ -interferon (IFN- ⁇ ), ⁇ -interferon (IFN- ⁇ ), ⁇ -interferon, platelet derived growth factor (PDGF), TNF ⁇ , TNF ⁇ , GM- CSF, epidermal growth factor (EGF), cutaneous T cell-attracting chemokine (CTACK), epithelial thymus-expressed chemokine (TECK), mucosae-associated epithelial chemokine (MEC), IL-12, IL-15, MHC, CD80, CD86 including IL-15 having the signal sequence deleted and optionally including the signal peptide from IgE.
  • IFN- ⁇ ⁇ -interferon
  • IFN- ⁇ ⁇ -interferon
  • PDGF platelet derived growth factor
  • TNF ⁇ TNF ⁇
  • TNF ⁇
  • the adjuvant can be IL-12, IL- 15, IL-28, CTACK, TECK, platelet derived growth factor (PDGF), TNF ⁇ , TNF ⁇ , GM-CSF, epidermal growth factor (EGF), IL-1, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, or a combination thereof.
  • PDGF platelet derived growth factor
  • TNF ⁇ TNF ⁇
  • GM-CSF epidermal growth factor
  • EGF epidermal growth factor
  • IL-1, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-18, or a combination thereof IL-12, IL- 15, IL-28, CTACK, TECK, platelet derived growth factor (PDGF), TNF ⁇ , TNF ⁇ , GM-CSF, epidermal growth factor (EGF), IL-1, IL-2, IL-4, IL-5, IL-6, IL-10,
  • genes that can be useful as adjuvants include those encoding: MCP-1, MIP-1a, MIP-1p, IL-8, RANTES, L-selectin, P-selectin, E-selectin, CD34, GlyCAM-1, MadCAM-1, LFA-1, VLA-1, Mac-1, p150.95, PECAM, ICAM-1, ICAM-2, ICAM-3, CD2, LFA-3, M-CSF, G-CSF, IL-4, mutant forms of IL-18, CD40, CD40L, vascular growth factor, fibroblast growth factor, IL-7, IL-22, nerve growth factor, vascular endothelial growth factor, Fas, TNF receptor, Flt, Apo-1, p55, WSL-1, DR3, TRAMP, Apo-3, AIR, LARD, NGRF, DR4, DR5, KILLER, TRAIL-R2, TRICK2, DR6, Caspase ICE, Fos, c-jun, Sp
  • the adjuvant is interleukin-12 (IL12).
  • IL12 may be included in a vaccine in the form of its p35 and p40 subunits.
  • the adjuvant IL-12 may be administered to the subject as its p35 and p40 subunits.
  • the IL12 p35 and p40 subunits may be encoded by the same expression vector or by separate expression vectors.
  • the nucleic acid molecule encoding the IL12 may the same as or different than the nucleic acid molecule encoding the HPV6 antigen fused to the HPV11 antigen.
  • the nucleic acid molecule encoding IL12 comprises a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • the nucleic acid molecule encoding the p35 subunit of IL12 may comprise a nucleotide sequence that encodes SEQ ID NO:6; a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to a nucleotide sequence that encodes SEQ ID NO:6; a fragment of a nucleotide sequence that encodes SEQ ID NO:6; or a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO:6.
  • the nucleic acid molecule encoding the p40 subunit of IL12 may comprise a nucleotide sequence that encodes SEQ ID NO:8; a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% homologous to a nucleotide sequence that encodes SEQ ID NO:8; a fragment of a nucleotide sequence that encodes SEQ ID NO:8; or a nucleotide sequence that is at least 95% homologous to a fragment of a nucleotide sequence that encodes SEQ ID NO:8.
  • the nucleic acid molecule encoding the p35 subunit of IL12 may comprise a nucleotide sequence of SEQ ID NO:5; a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence of SEQ ID NO:5; a fragment of the nucleotide sequence of SEQ ID NO:5; or a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% identical to a fragment of the nucleotide sequence of SEQ ID NO:5.
  • the nucleic acid molecule encoding the p40 subunit of IL12 may comprise a nucleotide sequence of SEQ ID NO:7; a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% identical to the nucleotide sequence of SEQ ID NO:7; a fragment of the nucleotide sequence of SEQ ID NO:7; or a nucleotide sequence that is at least about 95%, about 96%, about 97%, about 98%, or about 99% identical to a fragment of the nucleotide sequence of SEQ ID NO:7.
  • the composition comprises pGX3024 and pGX6010.
  • the composition is INO-3107.
  • buffer refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components.
  • the buffer generally has a pH from about 4.0 to about 8.0, for example from about 5.0 to about 7.0.
  • the buffer is saline-sodium citrate (SSC) buffer.
  • the immunogenic composition comprises a vector comprising a nucleic acid molecule encoding a HPV antigen as described above, the immunogenic composition comprises 6 mg/ml of vector in buffer, for example but not limited to SSC buffer.
  • the immunogenic composition comprises 6 mg/mL of the DNA plasmid pGX3024 in buffer. In some embodiments in which the immunogenic composition further comprises a separate vector comprising a nucleic acid molecule encoding the p35 subunit of IL-12, the p40 subunit of IL- 12, or both, the immunogenic composition comprises 0.25 mg/ml of the separate vector in the buffer. In some embodiments, the immunogenic composition comprises 0.25 mg/mL of the DNA plasmid pGX6010 in the buffer in addition to the vector comprising a nucleic acid molecule encoding the HPV antigen (e.g., pGX3024).
  • compositions according to the present invention are formulated according to the mode of administration to be used.
  • pharmaceutical compositions are injectable pharmaceutical compositions, they are sterile, pyrogen free and particulate free.
  • An isotonic formulation is preferably used.
  • additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol and lactose.
  • isotonic solutions such as phosphate buffered saline are preferred.
  • Stabilizers include gelatin and albumin.
  • a vasoconstriction agent is added to the formulation.
  • Administration of the vaccine to the subject can induce or elicit an immune response in the subject.
  • Methods of inducing an immune response in a subject comprising administering to the subject an effective amount of the HPV antigen of the invention to thereby induce the immune response are thus provided.
  • methods of prophylactically or therapeutically immunizing a subject against HPV6, HPV11, or both comprising administering to the subject an effective amount of the HPV antigen of the invention to thereby induce an immune response against HPV6, HPV11, or both.
  • the induced immune response can be used to treat, prevent, and/or protect against disease, for example, pathologies relating to HPV infection.
  • the induced immune response provides the subject administered the vaccine resistance to one or more HPV strains.
  • the induced immune response can include an induced humoral immune response and/or an induced cellular immune response.
  • the subject can be a mammal, such as a human, a horse, a cow, a pig, a sheep, a cat, a dog, a rabbit, a guinea pig, a rat, or a mouse.
  • the vaccine dose can be between 1 ⁇ g to 10 mg total plasmid per injection, preferably 6.25 mg total plasmid per injection.
  • the vaccine can be administered every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 days.
  • the number of vaccine doses for effective treatment can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.
  • the vaccine can be administered prophylactically or therapeutically.
  • the vaccines can be administered in an amount sufficient to induce an immune response.
  • the vaccines are administered to a subject in need thereof in an amount sufficient to elicit a therapeutic effect.
  • An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the particular composition of the vaccine regimen administered, the manner of administration, the stage and severity of the disease, the general state of health of the patient, and the judgment of the prescribing physician.
  • the vaccine can be administered by methods well known in the art as described in Donnelly et al. (Ann. Rev. Immunol.15:617-648 (1997)); Felgner et al. (U.S. Pat.
  • the DNA of the vaccine can be complexed to particles or beads that can be administered to an individual, for example, using a vaccine gun.
  • a pharmaceutically acceptable carrier including a physiologically acceptable compound, depends, for example, on the route of administration of the expression vector.
  • the pGX3024 and pGX6010 are administered to the subject as INO-3107.
  • the pGX3024 and pGX6010 are administered to the subject as INO-3107 drug product containing 6.25 mg total plasmid/mL (6 mg/mL pGX3024, 0.25 mg/mL pGX6010) in 150 mM sodium chloride and 15 mM sodium citrate, pH 7.
  • the vaccine can be delivered via a variety of routes. Typical delivery routes include parenteral administration, e.g., intradermal, intramuscular or subcutaneous delivery. Other routes include oral administration, intranasal, and intravaginal routes.
  • the vaccine can be delivered to the interstitial spaces of tissues of an individual (Felgner et al., U.S. Pat. Nos.5,580,859 and 5,703,055, the contents of all of which are incorporated herein by reference in their entirety).
  • the vaccine can also be administered to muscle, or can be administered via intradermal or subcutaneous injections, or transdermally, such as by iontophoresis.
  • Epidermal administration of the vaccine can also be employed. Epidermal administration can involve mechanically or chemically irritating the outermost layer of epidermis to stimulate an immune response to the irritant (Carson et al., U.S. Pat.
  • a vaccine is delivered to an individual to modulate the activity of the individual's immune system and thereby enhance the immune response against HPV to treat RRP.
  • a nucleic acid molecule that encodes the HPV antigen of the invention is taken up by cells of the individual, the nucleotide sequence is expressed in the cells and the protein are thereby delivered to the individual.
  • Methods of delivering the coding sequences of the protein on nucleic acid molecule such as plasmid, as part of recombinant vaccines and as part of attenuated vaccines, as isolated proteins or proteins part of a vector are provided.
  • the methods comprise administering to a subject the HPV antigen of the invention.
  • the methods include a step of introducing the provided nucleic acid molecules followed by electroporation.
  • the disclosed methods may comprise administration of a plurality of copies of a single nucleic acid molecule such as a single plasmid, or a plurality of copies of two or more different nucleic acid molecules such as two or more different plasmids.
  • the methods may comprise administration of two, three, four, five, six, seven, eight, nine or ten or more different nucleic acid molecules.
  • the disclosed methods of inducing an immune response or methods of preventing or treating RRP further comprise administering to the subject an adjuvant.
  • the adjuvant is IL12.
  • IL12 may be included in a vaccine in the form of its p35 and p40 subunits.
  • the adjuvant IL-12 may be administered to the subject as its p35 and p40 subunits.
  • the IL12 p35 and p40 subunits may be encoded by the same expression vector or by separate expression vectors.
  • the IL12 p35 encoding sequence is as set forth in SEQ ID NO:5.
  • the IL12 p35 subunit has an amino acid sequence as set forth in SEQ ID NO:6.
  • the IL12 p40 encoding sequence is as set forth in SEQ ID NO:7.
  • the IL12 p40 subunit has an amino acid sequence as set forth in SEQ ID NO:8.
  • the expression vector is pGX6012 or pGX6010.
  • the methods are clinically proven safe, clinically proven effective, or both.
  • the method comprises concurrent administration of: (a) an immunogenic composition comprising a HPV antigen as disclosed herein and (b) a composition comprising a nucleic acid molecule encoding one or more IL-12 subunits (e.g. p35 and/or p40) disclosed herein.
  • the method comprises administering a composition comprising a nucleic acid molecule encoding one or more IL-12 subunits (e.g. p35 and/or p40) disclosed herein after the prior administration of a composition comprising a nucleic acid molecule encoding a HPV antigen disclosed herein. In some embodiments, the method comprises administering a composition comprising a nucleic acid molecule encoding a HPV antigen disclosed herein after the prior administration of a composition comprising a nucleic acid molecule encoding one or more IL-12 subunit (e.g. p35 and/or p40) disclosed herein.
  • IL-12 subunits e.g. p35 and/or p40
  • Routes of administration include, but are not limited to, intramuscular, intranasally, intraperitoneal, intradermal, subcutaneous, intravenous, intraarterially, intraoccularly and oral as well as topically, transdermally, by inhalation or suppository or to mucosal tissue such as by lavage to vaginal, rectal, urethral, buccal and sublingual tissue.
  • Preferred routes of administration include intramuscular, intraperitoneal, intradermal and subcutaneous injection.
  • Genetic constructs may be administered by means including, but not limited to, electroporation methods and devices, traditional syringes, needleless injection devices, or "microprojectile bombardment gone guns".
  • the vaccine can be administered via electroporation, such as by a method described in U.S. Pat. No.7,664,545, the contents of which are incorporated herein by reference.
  • the electroporation can be by a method and/or apparatus described in U.S. Pat. Nos.6,302,874; 5,676,646; 6,241,701; 6,233,482; 6,216,034; 6,208,893; 6,192,270; 6,181,964; 6,150,148; 6,120,493; 6,096,020; 6,068,650; and 5,702,359, the contents of which are incorporated herein by reference in their entirety.
  • the electroporation may be carried out via a minimally invasive device.
  • the minimally invasive electroporation device may be an apparatus for injecting the vaccine described above and associated fluid into body tissue.
  • the device may comprise a hollow needle, DNA cassette, and fluid delivery means, wherein the device is adapted to actuate the fluid delivery means in use so as to concurrently (for example, automatically) inject DNA into body tissue during insertion of the needle into the said body tissue.
  • This has the advantage that the ability to inject the DNA and associated fluid gradually while the needle is being inserted leads to a more even distribution of the fluid through the body tissue. The pain experienced during injection may be reduced due to the distribution of the DNA being injected over a larger area.
  • the MID may inject the vaccine into tissue without the use of a needle.
  • the MID may inject the vaccine as a small stream or jet with such force that the vaccine pierces the surface of the tissue and enters the underlying tissue and/or muscle.
  • the force behind the small stream or jet may be provided by expansion of a compressed gas, such as carbon dioxide through a micro-orifice within a fraction of a second. Examples of minimally invasive electroporation devices, and methods of using them, are described in published U.S. Patent Application No.20080234655; U.S. Pat. Nos.6,520,950; 7,171,264; 6,208,893; 6,009,347; 6,120,493; 7,245,963; 7,328,064; and 6,763,264, the contents of each of which are herein incorporated by reference.
  • the MID may comprise an injector that creates a high-speed jet of liquid that painlessly pierces the tissue.
  • Such needle-free injectors are commercially available. Examples of needle-free injectors that can be utilized herein include those described in U.S. Pat. Nos. 3,805,783; 4,447,223; 5,505,697; and 4,342,310, the contents of each of which are herein incorporated by reference.
  • a desired vaccine in a form suitable for direct or indirect electrotransport may be introduced (e.g., injected) using a needle-free injector into the tissue to be treated, usually by contacting the tissue surface with the injector so as to actuate delivery of a jet of the agent, with sufficient force to cause penetration of the vaccine into the tissue.
  • the tissue to be treated is mucosa, skin or muscle
  • the agent is projected towards the mucosal or skin surface with sufficient force to cause the agent to penetrate through the stratum corneum and into dermal layers, or into underlying tissue and muscle, respectively.
  • Needle-free injectors are well suited to deliver vaccines to all types of tissues, particularly to skin and mucosa.
  • a needle-free injector may be used to propel a liquid that contains the vaccine to the surface and into the subject's skin or mucosa.
  • Representative examples of the various types of tissues that can be treated using the invention methods include pancreas, larynx, nasopharynx, hypopharynx, oropharynx, lip, throat, lung, heart, kidney, muscle, breast, colon, prostate, thymus, testis, skin, mucosal tissue, ovary, blood vessels, or any combination thereof.
  • the MID may have needle electrodes that electroporate the tissue.
  • pulsing between multiple pairs of electrodes in a multiple electrode array provides improved results over that of pulsing between a pair of electrodes.
  • Disclosed, for example, in U.S. Pat. No.5,702,359 entitled “Needle Electrodes for Mediated Delivery of Drugs and Genes” is an array of needles wherein a plurality of pairs of needles may be pulsed during the therapeutic treatment.
  • needles were disposed in a circular array, but have connectors and switching apparatus enabling a pulsing between opposing pairs of needle electrodes.
  • a pair of needle electrodes for delivering recombinant expression vectors to cells may be used.
  • the MID may comprise one or more electrode arrays.
  • the arrays may comprise two or more needles of the same diameter or different diameters.
  • the needles may be evenly or unevenly spaced apart.
  • the needles may be between 0.005 inches and 0.03 inches, between 0.01 inches and 0.025 inches; or between 0.015 inches and 0.020 inches.
  • the needle may be 0.0175 inches in diameter.
  • the needles may be 0.5 mm, 1.0 mm, 1.5 mm, 2.0 mm, 2.5 mm, 3.0 mm, 3.5 mm, 4.0 mm, or more spaced apart.
  • the MID may consist of a pulse generator and a two or more-needle vaccine injectors that deliver the vaccine and electroporation pulses in a single step.
  • the pulse generator may allow for flexible programming of pulse and injection parameters via a flash card operated personal computer, as well as comprehensive recording and storage of electroporation and patient data.
  • the pulse generator may deliver a variety of volt pulses during short periods of time. For example, the pulse generator may deliver three 15 volt pulses of 100 ms in duration.
  • the MID may be a CELLECTRA® (Inovio Pharmaceuticals, Blue Bell Pa.) device and system, which is a modular electrode system, that facilitates the introduction of a macromolecule, such as a DNA, into cells of a selected tissue in a body or plant.
  • the modular electrode system may comprise a plurality of needle electrodes; a hypodermic needle; an electrical connector that provides a conductive link from a programmable constant-current pulse controller to the plurality of needle electrodes; and a power source.
  • An operator can grasp the plurality of needle electrodes that are mounted on a support structure and firmly insert them into the selected tissue in a body or plant.
  • the macromolecules are then delivered via the hypodermic needle into the selected tissue.
  • the programmable constant-current pulse controller is activated and constant-current electrical pulse is applied to the plurality of needle electrodes.
  • the applied constant-current electrical pulse facilitates the introduction of the macromolecule into the cell between the plurality of electrodes. Cell death due to overheating of cells is minimized by limiting the power dissipation in the tissue by virtue of constant- current pulses.
  • the CELLECTRA device and system is described in U.S. Pat. No.7,245,963, the contents of which are herein incorporated by reference.
  • the CELLECTRA® device may be the CELLECTRA 2000® device or CELLECTRA® 3PSP device.
  • the CELLECTRA® 2000 device is configured by the manufacturer to support either ID (intradermal) or IM (intramuscular) administration.
  • the CELLECTRATM 2000 includes the CELLECTRATM Pulse Generator, the appropriate applicator, disposable sterile array and disposable sheath (ID only).
  • the DNA plasmid is delivered separately via needle and syringe injection in the area delineated by the electrodes immediately prior to the electroporation treatment.
  • the MID may be an Elgen 1000 system (Inovio Pharmaceuticals).
  • the Elgen 1000 system may comprise device that provides a hollow needle; and fluid delivery means, wherein the apparatus is adapted to actuate the fluid delivery means in use so as to concurrently (for example automatically) inject fluid, the described vaccine herein, into body tissue during insertion of the needle into the said body tissue.
  • the advantage is the ability to inject the fluid gradually while the needle is being inserted leads to a more even distribution of the fluid through the body tissue. It is also believed that the pain experienced during injection is reduced due to the distribution of the volume of fluid being injected over a larger area.
  • the automatic injection of fluid facilitates automatic monitoring and registration of an actual dose of fluid injected. This data can be stored by a control unit for documentation purposes if desired.
  • the rate of injection could be either linear or non- linear and that the injection may be carried out after the needles have been inserted through the skin of the subject to be treated and while they are inserted further into the body tissue.
  • Suitable tissues into which fluid may be injected by the apparatus of the present invention include tumor tissue, skin, or muscle tissue.
  • the apparatus further comprises needle insertion means for guiding insertion of the needle into the body tissue.
  • the rate of fluid injection is controlled by the rate of needle insertion. This has the advantage that both the needle insertion and injection of fluid can be controlled such that the rate of insertion can be matched to the rate of injection as desired. It also makes the apparatus easier for a user to operate. If desired means for automatically inserting the needle into body tissue could be provided.
  • a user could choose when to commence injection of fluid. Ideally however, injection is commenced when the tip of the needle has reached muscle tissue and the apparatus may include means for sensing when the needle has been inserted to a sufficient depth for injection of the fluid to commence. This means that injection of fluid can be prompted to commence automatically when the needle has reached a desired depth (which will normally be the depth at which muscle tissue begins). The depth at which muscle tissue begins could for example be taken to be a preset needle insertion depth such as a value of 4 mm which would be deemed sufficient for the needle to get through the skin layer.
  • the sensing means may comprise an ultrasound probe.
  • the sensing means may comprise a means for sensing a change in impedance or resistance.
  • the means may not as such record the depth of the needle in the body tissue but will rather be adapted to sense a change in impedance or resistance as the needle moves from a different type of body tissue into muscle. Either of these alternatives provides a relatively accurate and simple to operate means of sensing that injection may commence.
  • the depth of insertion of the needle can further be recorded if desired and could be used to control injection of fluid such that the volume of fluid to be injected is determined as the depth of needle insertion is being recorded.
  • the apparatus may further comprise: a base for supporting the needle; and a housing for receiving the base therein, wherein the base is moveable relative to the housing such that the needle is retracted within the housing when the base is in a first rearward position relative to the housing and the needle extends out of the housing when the base is in a second forward position within the housing.
  • a base for supporting the needle
  • a housing for receiving the base therein, wherein the base is moveable relative to the housing such that the needle is retracted within the housing when the base is in a first rearward position relative to the housing and the needle extends out of the housing when the base is in a second forward position within the housing.
  • the fluid delivery means may comprise piston driving means adapted to inject fluid at a controlled rate.
  • the piston driving means could for example be activated by a servo motor. However, the piston driving means may be actuated by the base being moved in the axial direction relative to the housing.
  • alternative means for fluid delivery could be provided.
  • a closed container which can be squeezed for fluid delivery at a controlled or non-controlled rate could be provided in the place of a syringe and piston system.
  • the apparatus described above could be used for any type of injection. It is however envisaged to be particularly useful in the field of electroporation and so it may further comprises means for applying a voltage to the needle.
  • kits which can be used for treating a subject using the methods of vaccination described above.
  • kits can comprise the vaccine.
  • the kits can also comprise instructions for carrying out the vaccination method described above and/or how to use the kit.
  • Instructions included in the kit can be affixed to packaging material or can be included as a package insert. While instructions are typically written or printed materials, they are not limited to such. Any medium capable of storing instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges), optical media (e.g., CD ROM), and the like.
  • the term “instructions” can include the address of an internet site which provides instructions.
  • HPV human papillomavirus
  • Embodiment 2 The nucleic acid molecule according to Embodiment 1, wherein the HPV6 antigenic domain is an HPV6 E6-E7 fusion antigen.
  • Embodiment 3 The nucleic acid molecule according Embodiment 1 or 2, wherein the HPV11 antigenic domain is an HPV11 E6-E7 fusion antigen.
  • Embodiment 5 The nucleic acid molecule according to any preceding Embodiment, comprising: a nucleotide sequence at least 95% homologous to SEQ ID NO:2 or SEQ ID NO: 12; the nucleotide sequence of SEQ ID NO: 2; or the nucleotide sequence of SEQ ID NO 12.
  • Embodiment 7 The nucleic acid molecule according to any preceding Embodiment wherein the HPV6 antigenic domain and the HPV11 antigenic domain are separated by a one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • Embodiment 9 The nucleic acid molecule according to Embodiment 4 wherein the HPV11 E6 antigenic domain and the HPV11 E7 antigenic domain are separated by one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • Embodiment 10 An expression vector comprising the nucleic acid molecule according to any preceding Embodiment.
  • Embodiment 11 An expression vector comprising the nucleic acid molecule according to any preceding Embodiment.
  • Embodiment 10 comprising a DNA plasmid.
  • Embodiment 12. The expression vector of Embodiment 10, comprising the nucleotide sequence of SEQ ID NO: 3.
  • Embodiment 13. An immunogenic protein comprising a human papillomavirus (HPV) 6 antigenic domain and a HPV11 antigenic domain.
  • Embodiment 14. The immunogenic protein according to Embodiment 14, wherein the HPV6 antigenic domain comprises a HPV6 E6 antigenic domain and a HPV6 E7 antigenic domain.
  • Embodiment 13 or 14 wherein the HPV11 antigenic domain comprises a HPV11 E6 antigenic domain and a HPV11 E7 antigenic domain.
  • Embodiment 16 The immunogenic protein according to any one of Embodiments 13 to 15, comprising: the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11; or an amino acid sequence that is at least 95% homologous to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO: 11.
  • Embodiment 17 The immunogenic protein according to any one of Embodiments 13 to 16, wherein the HPV11 antigenic domain is located N-terminal to the HPV6 antigen.
  • Embodiment 19 The immunogenic protein according to Embodiment 14 wherein the HPV6 E6 antigenic domain and the HPV6 E7 antigenic domain are separated by one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • Embodiment 20 The immunogenic protein according to Embodiment 14 wherein the HPV6 E6 antigenic domain and the HPV6 E7 antigenic domain are separated by one or more post-translational cleavage sites, one or more translational skipping sites, or both.
  • Embodiment 21 A vaccine comprising the nucleic acid molecule of any one of Embodiments 1 to 9 or the expression vector of any one of Embodiments 10 to 12 and a pharmaceutically acceptable excipient.
  • Embodiment 22 A pharmaceutical composition comprising the nucleic acid molecule of any one of Embodiments 1 to 9 or the expression vector of any one of Embodiments 10 to 12 and a pharmaceutically acceptable excipient.
  • Embodiment 23 Embodiment 23.
  • Embodiment 22 comprising an adjuvant.
  • Embodiment 24 The pharmaceutical composition according to Embodiment 23 wherein the adjuvant comprises interleukin-12 (IL12).
  • Embodiment 25 The pharmaceutical composition according to Embodiment 24 wherein the IL12 is encoded by a nucleic acid molecule.
  • Embodiment 26 The pharmaceutical composition according to Embodiment 25, wherein the nucleic acid molecule encoding IL12 is an expression vector.
  • Embodiment 27 A vaccine comprising the immunogenic protein of any one of Embodiments 13 to 20.
  • Embodiment 28 A vaccine comprising the immunogenic protein of any one of Embodiments 13 to 20.
  • a pharmaceutical composition comprising the immunogenic protein of any one of Embodiments 13 to 20 and a pharmaceutically acceptable excipient.
  • Embodiment 29 The pharmaceutical composition according to Embodiment 28, comprising an adjuvant.
  • Embodiment 30 The pharmaceutical composition according to Embodiment 29 wherein the adjuvant comprises interleukin-12 (IL12).
  • Embodiment 31 The pharmaceutical composition according to Embodiment 23 or 29, wherein the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • Embodiment 32 The pharmaceutical composition according to Embodiment 23 or 29, wherein the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • nucleotide sequence encoding the p35 subunit of IL12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6.
  • Embodiment 33 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6.
  • nucleotide sequence encoding the p40 subunit of IL12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8.
  • nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8.
  • Embodiment 31 comprises a nucleotide sequence selected from the group consisting of: the nucleotide sequence of SEQ ID NO: 4; or a nucleotide sequence that is at least 95% homologous to the nucleotide sequence of SEQ ID NO: 4.
  • Embodiment 35 The pharmaceutical composition according to any one of Embodiments 31 to 34 wherein the nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both is an expression vector.
  • Embodiment 36 is an expression vector.
  • Embodiment 35 wherein the expression vector comprising the nucleic acid molecule encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both is the same expression vector or a different expression vector than the expression vector comprising the nucleic acid molecule encoding the HPV antigen.
  • Embodiment 37 The pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 36 wherein the pharmaceutically acceptable excipient comprises a buffer, optionally saline-sodium citrate buffer, optionally a buffer comprising 150 mM sodium chloride and 15 mM sodium citrate, pH 7.
  • Embodiment 38 comprises a buffer, optionally saline-sodium citrate buffer, optionally a buffer comprising 150 mM sodium chloride and 15 mM sodium citrate, pH 7.
  • Embodiment 37 wherein the composition comprises 6 mg of the vector encoding the HPV antigen per milliliter of saline-sodium citrate buffer and 0.25 mg of the vector encoding the p35 subunit of IL-12, the p40 subunit of IL-1, or both, per milliliter of buffer.
  • Embodiment 39 The pharmaceutical composition of Embodiment 38, wherein the composition comprises 6 mg of pGX3024 per milliliter of saline-sodium citrate buffer and 0.25 mg of pGX6010 per milliliter of buffer.
  • Embodiment 40 Embodiment 40.
  • a method of inducing an immune response in a subject comprising administering to the subject an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, the immunogenic protein according to any one of Embodiments 13 to 20, the vaccine according to Embodiment 21 or Embodiment 27, or the pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 39, to thereby induce the immune response.
  • Embodiment 41 Embodiment 41.
  • a method of prophylactically or therapeutically immunizing a subject against HPV6 and/or HPV11 comprising administering to the subject an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, the immunogenic protein according to any one of Embodiments 13 to 20, the vaccine according to Embodiment 21 or Embodiment 27, or the pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 39, to thereby induce an immune response against HPV6, HPV11, or both.
  • Embodiment 42 Embodiment 42.
  • a method for treating or preventing recurrent respiratory papillomatosis (RRP) in a subject comprising administering to the subject an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, the immunogenic protein according to any one of Embodiments 13 to 20, the vaccine according to Embodiment 21 or Embodiment 27, or the pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 39, to thereby treat or prevent RRP.
  • Embodiment 43 The method according to Embodiment 42 wherein the RRP is juvenile-onset RRP or adult-onset RRP.
  • Embodiment 44 Embodiment 44.
  • Embodiment 45 The method according to any one of Embodiments 40 to 44, further comprising administering an adjuvant to the subject.
  • Embodiment 46 The method according to Embodiment 45 wherein the adjuvant is interleukin-12 (IL12).
  • Embodiment 47 The method according to Embodiment 46 wherein the IL12 is encoded by a nucleic acid molecule.
  • Embodiment 48 The method according to any one of Embodiments 40 to 43, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 12.
  • Embodiment 45 wherein the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • Embodiment 49 The method according to Embodiment 48, wherein the nucleotide sequence encoding the p35 subunit of IL-12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6.
  • Embodiment 50 Embodiment 50.
  • nucleotide sequence encoding the p40 subunit of IL-12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8.
  • nucleic acid molecule encoding IL12 comprises a nucleotide sequence selected from the group consisting of: the nucleotide sequence of SEQ ID NO: 4; or a nucleotide sequence that is at least 95% homologous to the nucleotide sequence of SEQ ID NO: 4.
  • nucleic acid molecule encoding the IL 12 is an expression vector, optionally a plasmid.
  • Embodiment 53 The method according to Embodiment 52, wherein the plasmid is pGX6010.
  • Embodiment 54 The method according to any one of Embodiments 40 to
  • Embodiment 55 The method according to any one of Embodiments 40 to
  • administering comprises intradermal or intramuscular injection.
  • Embodiment 56 The method according to Embodiment 55, wherein the administering further comprises electroporation.
  • Embodiment 57 Use of an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, or the immunogenic protein according to any one of Embodiments 13 to 20 in the manufacture of a prophylactic or medicament.
  • Embodiment 58 Use of an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, or the immunogenic protein according to any one of Embodiments 13 to 20 in the manufacture of a prophylactic or medicament to prevent or treat human papilloma virus (HPV) 6 or HPV11 infection.
  • HPV human papilloma virus
  • Embodiment 59 Use of an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, the immunogenic protein according to any one of Embodiments 13 to 20, the vaccine according to Embodiment 21 or Embodiment 27, or the pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 39 to prevent or treat human papilloma virus (HPV) 6 or HPV11 infection.
  • HPV human papilloma virus
  • Embodiment 60 Use of an effective amount of the nucleic acid molecule according to any one of Embodiments 1 to 9, the expression vector according to any one of Embodiments 10 to 12, the immunogenic protein according to any one of Embodiments 13 to 20, the vaccine according to Embodiment 21 or Embodiment 27, or the pharmaceutical composition according to any one of Embodiments 22 to 26 or 28 to 39 to prevent or treat recurrent respiratory papillomatosis (RRP).
  • RRP recurrent respiratory papillomatosis
  • Embodiment 61 The use according to Embodiment 60 wherein the RRP is juvenile-onset RRP or adult-onset RRP.
  • Embodiment 62 The use according to any one of Embodiments 57 to 61, wherein the nucleic acid molecule comprises the nucleotide sequence of SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 12.
  • Embodiment 63 The use according to any one of Embodiments 57 to 62 in combination with an adjuvant.
  • Embodiment 64 The use according to Embodiment 63 wherein the adjuvant is interleukin- 12 (IL12).
  • IL12 interleukin- 12
  • Embodiment 65 The use according to Embodiment 64 wherein the IL12 is encoded by a nucleic acid molecule.
  • Embodiment 66 The use according to Embodiment 65, wherein the adjuvant comprises a nucleic acid molecule comprising a nucleotide sequence encoding the p35 subunit of IL-12, the p40 subunit of IL-12, or both.
  • Embodiment 67 The use according to Embodiment 66, wherein the nucleotide sequence encoding the p35 subunit of IL-12 comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 6; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 6.
  • Embodiment 68 The use according to Embodiment 66 or 67, wherein the nucleotide sequence encoding the p40 subunit of IL-12comprises a nucleotide sequence selected from the group consisting of: a nucleotide sequence that encodes SEQ ID NO: 8; or a nucleotide sequence that is at least 95% homologous to a nucleotide sequence that encodes SEQ ID NO: 8.
  • Embodiment 69 The use according to Embodiment 65, wherein the nucleic acid molecule encoding IL12 comprises a nucleotide sequence selected from the group consisting of: the nucleotide sequence of SEQ ID NO: 4; or a nucleotide sequence that is at least 95% homologous to the nucleotide sequence of SEQ ID NO: 4.
  • Embodiment 70 The use according to Embodiment 65, wherein the nucleic acid molecule encoding the IL12 is an expression vector, optionally a plasmid.
  • Embodiment 71 The use according to Embodiment 70, wherein the plasmid is pGX6010.
  • HPV6 E6/E7 and HP V11 E6/E7 consensus sequences were generated using sequences obtained from GenBank. Two point mutations were introduced into the HPV6 E6 and HPV11 E6 proteins to inhibit the ability to bind and degrade p53. One point mutation was introduced into the HPV6 E7 and HP VI 1 E7 proteins to abolish binding of pi 30. Sequences were optimized using Inovio’s proprietary gene optimization algorithm.
  • Figure 1A shows a schematic of antigens encoded in different HPV6 and/or HPV11 plasmids. Individual antigens are separated by a P2A cleavage site for translational skipping and a furin cleavage site for post-translational cleavage of the P2A sequence.
  • DNA plasmid pGX3024 encodes consensus SynCon® E6 and E7 antigens of both HPV6 and HPV11.
  • Figure 1B provides a plasmid map of pGX3024.
  • In vitro transfection and Western blot analyses [0240] Expression of pGX3024 in vitro. pGX3024 mediated HPV6 and HPV11 E6 and E7 antigen expression was confirmed by Western blot analysis following in vitro transfection of HEK-293T cells with pGX3024 plasmid.
  • HEK-293T cells were plated at 80% confluence the day before transfections in 6-well tissue culture dishes. The following day, cells were transfected according to manufacturer recommendations with 3 ⁇ g of plasmid DNA using Lipofectamine 3000 transfection reagent (Thermo Scientific).
  • cell lysates were harvested and protein concentration was determined by BCA assay (Quick StartTM Bradford Protein Assay, BioRad). Thirty microgams (30 ⁇ g) of cell lysates were loaded onto a 12% Bis-Tris acrylamide gel (Thermo Scientific) and transferred to a PVDF membrane. Precision Plus ProteinTM Dual Xtra Prestained Protein Standards (BioRad, cat# 1610377) was loaded as a molecular weight reference.
  • blots were washed in 1x PBS/0.05% Tween-20 and blocked for 1h at room temperature in 1x PBS/0.05% Tween- 20/5% Milk then probed overnight with diluted anti-HPV11 E7 (Genetex), at room temperature overnight. The next day, the blots were washed then incubated with anti-mouse IgG HRP (Bethyl Laboratories) 1:10,000 for 1hour at room temperature then washed again. For detection, blots were incubated for 5 mins with ECL Prime Western blotting substrate (GE Lifesciences/ Amersham cat# RPN2232/89168-782). Blots were imaged on the Protein Simple FluorChem® by chemiluminescence.
  • ECL Prime Western blotting substrate GE Lifesciences/ Amersham cat# RPN2232/89168-782
  • E6 and E7 proteins were detected in cells transfected with pGX3024 and control pGX3021 and pGX3022 plasmids, but not negative control pGX0001 plasmid. E7 protein expression was detected using a commercially available anti- HPV11 E7 antibody ( Figure 2, left panel).
  • E7 proteins were detected in cells transfected with pGX3024, but not negative control pGX0001 plasmid. E7 antigen was detected in cells transfected with HPV6 antigen-only plasmid (pGX3021) as well HPV11 antigen-only plasmid (pGX3022), indicating the anti-HPV11 E7 antibody was cross-reactive against both HPV6 and HPV11 E7 antigens and suggesting the bands detected in pGX3024-transfected cells represent both HPV6 and HPV11 E7 protein expression. [0243] After evaluating multiple commercially available reagents, an antibody that specifically recognized HPV6 or HPV11 E6 proteins was unable to be identified.
  • pGX3024 was evaluated for immunogenicity in two mouse models ( Figures 3 through 6). DNA vaccine pGX3024-induced cellular and humoral immune responses were characterized in the C57BL/6 mouse model in two independent studies.
  • mice Female C57BL/6 mice (n of 5 or 10 per group in Study 1 or Study 2, respectively) received two immunizations spaced two weeks apart by intramuscular electroporation (IM-EP) delivery of 20 ⁇ g pGX3024 or control DNA vaccines. T cell responses were measured one week post second immunization by IFN ⁇ ELISpot after splenocyte stimulation with HPV6/HPV11 E6 or E7 peptides. Following euthanization, mouse spleens were isolated and placed in a tube containing 5ml of R10 media (RPMI 1640 supplemented with 10% fetal bovine serum, 1% penicillin-streptomycin and 0.001% 2-mercaptoethanol).
  • R10 media RPMI 1640 supplemented with 10% fetal bovine serum, 1% penicillin-streptomycin and 0.001% 2-mercaptoethanol.
  • Splenocytes were isolated by mechanical disruption of the spleen using the GentleMACS Dissociator (Miltenyi Biotech) then filtered using a 40 ⁇ m cell strainer (BD Falcon). After centrifugation, resuspended cell pellets were treated with ACK lysis buffer (Lonza) for 5 mins to lyse red blood cells. The splenocytes were washed in PBS, centrifuged, resuspended in R10 media and counted using the Vi-cell (Beckman Coulter). Mouse IFN- ⁇ ELISpot kits were purchased from MabTech (MabTech #3321-4APW-10) to evaluate antigen-specific responses.
  • the precoated 96-well plates were washed in PBS according to the manufacturer’s protocol and blocked for 2hrs at room temperature with R10 media. Isolated splenocytes were resuspended in R10 media and plated in triplicate at 2x10 5 cells per well. Overlapping 15-mer peptides for HPV6 E6 and E7 proteins as well as HPV11 E6 and E7 proteins were synthesized. These peptides were resuspended in DMSO (Sigma) and pooled at a concentration of ⁇ 2 ⁇ g/ml per peptide into two peptide pools per each antigen (HPV6 E6, HPV6 E7, HPV11 E6 and HPV11 E7) for cell stimulation.
  • Concavalin A (Sigma) was used at 5 ⁇ g/ml and complete media with DMSO was used as a negative control. The plates were incubated for a minimum of 18 hours at 37°C 5% CO2. For development, plates were first washed in PBS then incubated with a biotinylated anti-mouse IFN- ⁇ detection antibody (R4-6A2-biotin) for 2 hours at room temperature. After washing, plates were then incubated with streptavidin-ALP (MabTech #3321-4APW-10) for 1 hour at room temperature. Spots were detected using a filtered substrate solution (BCIP/NBT-plus) according to manufacturer’s instruction (MabTech).
  • Antibodies against HPV6 and HPV11 E7 antigens were measured by binding IgG ELISA in sera samples collected before immunization (Week 0) and after first (Week 2) and second (Week 3) immunization with either pGX3024 or negative control plasmid (pGX0001).
  • IgG Antigen Binding ELISA [0249] 96-well high binding NuncTM plates (Thermo Scientific) were coated with 0.5 ⁇ g/ml of each protein (HPV6 E7 and HPV11 E7 – Tulip BioLabs) in 1x DPBS (Thermo Scientific) overnight at 4°C.
  • HPV6 E7 binding antibodies were detected in pGX3024, but not pGX0001, immunized mice after first and second immunization (Figure 4, left panel). In general, HPV11 E7 binding antibodies were reduced compared to HPV6 E7 binding antibodies in immunized mice; however, HPV11 E7 binding antibodies were greater after two immunizations (week 3) in mice immunized with pGX3024 as compared to pGX0001 ( Figure 4, right panel).
  • pGX3024 immunogenicity in BALB/c mice As previously mentioned, C57BL/6 mice have a single MHC haplotype (H2b) which may explain the lack of HPV6 E6 cellular responses in this model. pGX3024 vaccine-induced cellular responses were thus investigated in the BALB/c mouse model with a different MHC haplotype (H2d). The impact of pGX3024 dose and combination with a plasmid encoding murine IL-12 adjuvant (pGX6012) was also investigated.
  • mice Female BALB/c mice (n of 6 per group) received two immunizations spaced two weeks apart by intramuscular electroporation (IM-EP) delivery of 1 ⁇ g, 5 ⁇ g, 10 ⁇ g, or 20 ⁇ g pGX3024 DNA vaccine alone, or 5 ⁇ g pGX3024 adjuvanted with either 2 ⁇ g or 11 ⁇ g pGX6012 murine IL-12 plasmid.
  • T cell responses were measured one week post second immunization by IFN ⁇ ELISpot after splenocyte stimulation with HPV6/HPV11 E6 or E7 peptides as shown in Figure 5.
  • HPV6 and HPV11 specific T cell responses were detected in mice following immunization with all dose levels of pGX3024, but not pGX0001, plasmid in a dose-related manner. Total HPV6 and HPV11 cellular responses increased with increasing pGX3024 dose. Unlike the C57BL/6 model, pGX3024 immunized BALB/c mice had T cell responses against HPV6 E6 antigen as well as HPV6 E7, HPV11 E6 and HPV11 E7 antigens. There were no significant differences in T cell responses among mice immunized with 5 ⁇ g pGX3024 with or without either dose level of pGX6012 as determined by one-way ANOVA, Tukey’s post-test.
  • Antibodies against HPV6 and HPV11 E7 antigens were measured by binding IgG ELISA in sera samples collected before immunization (Week 0) and after first (Week 2) and second (Week 3) immunization with either 5 ⁇ g, 10 ⁇ g, or 20 ⁇ g pGX3024 DNA vaccine alone, or 5 ⁇ g pGX3024 adjuvanted with 2 ⁇ g murine IL-12 plasmid (pGX6012). Sera from mice immunized with 40 ⁇ g empty pGX0001 plasmid served as negative controls.
  • HPV6 E7 and HPV11 E7 binding antibodies were significantly increased at Week 3 compared to Week 0 in pGX3024 immunized BALB/c mice regardless of dose or presence of IL-12 plasmid, but not in pGX0001 mice ( Figure 6).
  • Antibody levels were also significantly increased after single immunization (Week 2) with 20 ⁇ g pGX3024, or 5 ⁇ g pGX3024 adjuvanted with 2 ⁇ g murine IL-12 plasmid.
  • INO-3107 (pGX3024 with pGX6010) was evaluated for immunogenicity and safety in a rabbit model.
  • New Zealand White (NZW) rabbits (n of 5 per group) received four immunizations spaced three weeks apart of INO-3107 (6 mg pGX3024 and 0.25 mg pGX6010 co-formulated in 1 mL 1X SSC), or 1 mL 1X SSC (negative control) by intramuscular (IM) injection into the quadriceps followed by electroporation (EP) using the CELLECTRA® 2000 Electroporation Device.
  • NZW New Zealand White
  • HBSS Hank’s Balanced Salts Solution
  • R10 media RPMI 1640 supplemented with 10% fetal bovine serum, 1% penicillin- streptomycin and 0.001% 2-mercaptoethanol.
  • the cell pellet was resuspended in ACK lysis buffer (Lonza) to lyse red blood cells and incubated at room temperature for 4 mins.
  • the PBMCs were washed, spun and resuspended in R10 media and counted using the Vi-cell (Beckman Coulter). Rabbit IFN- ⁇ ELISpot kits (MabTech (MabTech #3110-4HPW-10) were used to evaluate antigen specific responses. Plates were prepared following the manufacturer’s protocol and rabbit PBMCs were plated in triplicate at 2x10 5 cells per well. Overlapping 15-mer peptides for the E6 and E7 proteins of HPV6 and HPV11 were used for cell stimulation. Phorbol 12-myristate 13-acetate and ionomycin (PMA/I) (Sigma) and media containing DMSO served as a positive and negative control, respectively.
  • PMA/I Phorbol 12-myristate 13-acetate and ionomycin
  • HPV6 and HPV11 T cell responses were boostable as they increased following each successive immunization with INO-3107 (Figure 7). Immunization with INO-3107 induced T cell responses against HPV6 and HPV11 E6 antigens, but not HPV6 or HPV11 E7 antigens in this model ( Figure 8). [0258] Humoral responses against HPV6 and HPV11 E7 antigens were measured by binding IgG ELISA in sera samples collected before and two weeks after each immunization. Timecourse of antibody levels are shown in Figure 9. HPV6 or HPV11 E7 binding antibodies were detected in 4 of 5 rabbits immunized with INO-3107, but not in rabbits dosed with 1X SSC.
  • HPV6 E7 binding antibodies were reduced compared to HPV11 E7 binding antibodies in immunized rabbits.
  • ELISpot and ELISA data taken together confirm immunogenicity of all antigens encoded by INO-3107 in the rabbit model.
  • physiological parameters including body weights, hematology, serum chemistries, and general appearance were monitored throughout the study as indicators of vaccine safety and animal health. No significant differences in body weights or body weight changes over time were observed in rabbits administered INO-3107 ( Figure 10). Also, no findings were observed during monitoring of general appearance (nose, eyes, fur, movement) for either treatment groups during the study.
  • NZW rabbits (n of 5) were immunized three times at three-week intervals with INO-3107 formulated at 1 mg pGX3024 in 0.1 mL 1X SSC, by ID delivery. Rabbit IFN ⁇ ELISpots, previously described, were performed prior to the first vaccination and at Weeks 2, 5 and 8. The combined immune response to both antigens, HPV6 and HPV11, increased following each immunization, with the T cell responses being more HPV6 E6 and HPV11 E6 specific ( Figure 13).
  • Each treatment was delivered by Mantoux intradermal (ID) injection of a 100 ⁇ L dosing solution into the skin followed by electroporation using the CELLECTRA 2000® Adaptive Constant Current Electroporation Device with a 3P array (Inovio Pharmaceuticals) according to the manufacturer’s protocol.
  • Table 1 Study Design [0266] Group 1 animals received a total of three immunizations spaced two weeks apart. Sera samples were collected from all animals for humoral immunogenicity assessments at Week 0, Week 2, Week 4 and Week 6. Whole blood samples were collected from all animals for cellular immunogenicity assessments at Week 2, Week 4, and Week 6. [0267] Guinea pig IFN- ⁇ ELISpot.
  • Guinea pig IFN- ⁇ ELISpot was performed according to methods described in Schultheis, et al., J Vis Exp.2019;(143):10.3791/58595. Published 2019 Jan 20. doi:10.3791/58595.
  • Peripheral blood was drawn from the jugular vein of each anaesthetized animal and transferred immediately into EDTA blood collection tubes. Blood was diluted 1:1 with phosphate-buffered saline. Diluted blood was layered over Ficoll- Paque Plus (GE Healthcare Life Sciences) in SepMateTM tubes (Stemcell) and centrifuged (1200g, 10 min, 24 °C).
  • PBMCs were resuspended at 1x10 6 cells/ml in R10 medium and plated at 100 ⁇ l/well on 96-well Millipore IP plates (Millipore) previously coated with 5 ⁇ g/ml primary anti-IFN- ⁇ antibody V-E4 (provided by Dr. Schafer, Robert Koch Institute, Berlin, Germany) blocked with R10 media.100 ⁇ l of HPV6 E6, HPV6 E7, HPV11 E6, or HPV11 E7 peptide pools, or phorbol 12-myristate 13-acetate (PMA)/Ionomycin stimulants were added to the cells. Samples were assayed in triplicates.
  • PMA phorbol 12-myristate 13-acetate
  • Plates were then washed as before and serially diluted sera samples were added and the plates were incubated for 2 hours at room temperature. Plates were washed and incubated with a 1:10,000 dilution of anti-guinea pig IgG horseradish peroxidase (HRP) secondary antibody (Sigma) for 1 hour at room temperature. The plates were washed and 100 ⁇ l/well of SureBlueTM TMB Substrate (KPL 5120-0077) was added to the plates. The reaction was stopped upon the addition of 100ul/well of TMB Stop Solution (KPL 5150-0021) after a 6 minute incubation and the plates were read on a Biotek Synergy plate reader at the 450 nm wavelength.
  • HRP horseradish peroxidase
  • Humoral responses against HPV6 E7 and HPV11 E7 antigens were measured by binding IgG ELISA in sera samples collected before and two weeks after each immunization. Timecourse of antibody levels are shown in Figure 12.
  • HPV6 E7 and HPV11 E7 binding antibodies were detected in guinea pigs following immunization with pGX3024.
  • Phase 1/2 Clinical Trial INO-3107 With Electroporation (EP) in Subjects With HPV-6- and/or HPV-11-associated Recurrent Respiratory Papillomatosis (RRP) [ClinicalTrials.gov Identifier: NCT04398433]
  • This is a Phase 1/2 open-label, multi-center trial to evaluate the safety, tolerability, immunogenicity, and efficacy of INO-3107 drug product in subjects with HPV- 6- and/or HPV-11-associated recurrent respiratory papillomatosis (RRP).
  • INO-3107 drug product will be administered IM followed by EP in subjects at Day 0, Weeks 3, 6, and 9.
  • This study will enroll approximately 20 adults ( ⁇ 18 years old) who have been diagnosed with either Juvenile-Onset RRP (J-O RRP) as defined by age at first diagnosis ⁇ 12 years or with Adult-Onset RRP (A-O RRP) as defined by age at first diagnosis ⁇ 12 years.
  • the trial population is divided into two cohorts: Cohort A: Participants with diagnoses of Juvenile-Onset RRP as defined by age at first diagnosis of RRP ⁇ 12 years.
  • Cohort B Participants with Adult-onset RRP as defined by age at first diagnosis of RRP ⁇ 12 years.
  • This study will have a safety run-in with up to six participants with a one week waiting period between each enrolled participant.
  • DLT dose-limiting toxicity
  • Cohort B (participants with Adult-Onset RRP) will be administered one 6.25mg injection of INO-3107 drug product intramuscular (IM) injection followed by EP using CELLECTRA® 2000 at Day 0, Week 3, Week 6, and Week 9.
  • the primary objective of the study is to evaluate the safety and tolerability of INO-3107 drug product in subjects with HPV-6 and/or HPV-11-associated RRP.
  • the primary endpoint is safety and tolerability as assessed by reported adverse events (AE) and serious adverse events (SAE).
  • SAE serious adverse events
  • the primary outcome measure is percentage of participants with Adverse Events (AEs) and Serious Adverse Events (SAEs) [Time Frame: Screening up to Week 52 (up to approximately 1 year)].
  • An adverse event is any untoward medical occurrence in a participant or clinical investigation participant administered a pharmaceutical product and that does not necessarily have a causal relationship with this treatment.
  • An AE can include any unfavorable and unintended sign (including an abnormal laboratory finding), symptom, or disease temporally associated with the use of a medicinal (investigational) product, whether or not related to the medicinal (investigational) product.
  • a serious adverse event is any untoward medical occurrence that at any dose: 1. Results in death.2. A life-threatening event; however, this does not include an event that, had it occurred in a more severe form, might have caused death.3. Requires inpatient hospitalization or prolongation of existing hospitalization.4. Results in persistent or significant disability/incapacity.5.
  • microRNA microRNA
  • Secondary endpoints are: 1. The Number of RRP Surgical Interventions in the 52 Weeks Post Day 0 Compared to the Number of RRP Surgical Interventions in the Year Prior to Day 0 Dosing [Time Frame: Screening up to Week 52 (up to approximately 1 year)] 2. Change in RRP Staging Assessment Scores Over Time [Time Frame: Screening, Day 0, Weeks 6, 11, 26, 52 (up to approximately 1 year)].
  • An RRP Staging Assessment score will be determined using a modified Derkay staging tool. It includes both a subjective functional assessment of clinical parameters and an anatomic assessment of disease distribution.
  • the anatomic score can then be used in combination with the functional score to measure an individual patient's clinical course and response to the therapy over time.
  • IFN- ⁇ ELISpot Interferon-gamma Enzyme-Linked Immunosorbent Spot
  • Change from Baseline in Flow Cytometry Response Magnitude for T-cell Phenotype and Lytic Potential in PBMCs [Time Frame: Baseline, Weeks 6, 9, 11, 26, 52] 5.
  • circulating free HPV DNA cfHPV DNA 6/11 as a correlate of disease burden and clinical outcomes in RRP patients treated with INO-3107 drug product.
  • the exploratory endpoints are: 1. Clearance of HPV-6/11 in resected tissue compared to baseline; 2. Antigen-specific humoral immune responses assessed by ELISA; 3. Assessment of pro-inflammatory and immunosuppressive elements in peripheral blood; and 4. Quantity of cfHPV DNA 6/11 pre- and post-INO-3107 drug product as a correlate of disease burden and clinical outcomes in RRP patients treated with INO-3107 drug product.
  • Efficacy Assessment A detailed medical history will be obtained for each subject which will include documentation of HPV-6 and/or HPV-11 RRP, a list of RRP surgeries and therapies occurring within 3 years prior to screening, and any periods of remission. Subjects must have had at least two surgical RRP interventions (including laser) in the year prior to and including Day 0, to be eligible for the study. Subjects must require RRP intervention at the time of entry into this study and will undergo surgical removal of their papilloma(s) during screening, within 14 days prior to Day 0 dosing, to maximize standardization of baseline staging across subjects.
  • the efficacy assessment will be based upon the number of RRP surgical interventions in the 52 weeks post Day 0 compared to the number of RRP surgical interventions in the year prior to Day 0 dosing.
  • RRP surgical interventions include laser therapies.
  • the trial will also evaluate changes in RRP Staging Assessment over time as a secondary endpoint.
  • Safety Assessment Subjects will be followed for safety from the time of signing informed consent through Week 52, or the subject’s last visit. The safety of INO- 3107 drug product will be measured and graded in accordance with the CTCAE v5.0. Clinically significant changes in laboratory parameters and vital signs from baseline assessments will be assessed.
  • An adverse event is any untoward medical occurrence in a patient or clinical investigation subject administered a pharmaceutical product and which does not necessarily have to have a causal relationship with this treatment.
  • An AE can therefore be any unfavorable and unintended sign (including an abnormal laboratory finding, for example), symptom, or disease temporally associated with the use of a medicinal product, whether or not considered related to the medicinal product.
  • Adverse Events include the following: pre- or post-treatment complications that occur as a result of protocol mandated procedure during or after screening (before the administration of clinical trial drug); any pre-existing condition, with the exception of the condition under investigation in this study, that increases in severity, or changes in nature during or as a consequence of the clinical trial drug administration phase; complications of pregnancy.
  • Adverse Events do not include the following: medical or surgical procedures (e.g., surgery, endoscopy, tooth extraction, transfusion) performed, however, the condition that leads to the procedure is an AE; pre- existing diseases or conditions or laboratory abnormalities present or detected before the Screening Visit that do not worsen; recurrences of RRP; situations where an untoward medical occurrence has not occurred (e.g., hospitalization for elective surgery, social and/or convenience admissions); overdose without clinical sequelae; any medical condition or clinically significant laboratory abnormality with an onset date before informed consent is provided, is not an AE; uncomplicated pregnancy; an induced elective abortion to terminate a pregnancy without medical reason.
  • medical or surgical procedures e.g., surgery, endoscopy, tooth extraction, transfusion
  • recurrences of RRP situations where an untoward medical occurrence has not occurred (e.g., hospitalization for elective surgery
  • Adverse drug reactions include all noxious and unintended responses to a medicinal product related to any dose. This means that a causal relationship between the medicinal product and an adverse event is at least a reasonable possibility (i.e., the relationship cannot be ruled out).
  • a serious adverse event is any untoward medical occurrence that at any dose: results in death; is life-threatening; requires inpatient hospitalization or prolongation of existing hospitalization; results in persistent or significant disability/incapacity; results in congenital anomaly or birth defect; and/or an important medical event.
  • An unexpected adverse drug reaction is an adverse reaction, the nature or severity of which is not consistent with the applicable product information.
  • UADE unanticipated (serious) adverse device effect
  • a device if that effect, problem, or death was not previously identified in nature, severity, or degree of incidence in the investigational plan or application (including a supplementary plan or application), or any other unanticipated serious problem associated with a device that relates to the rights, safety, or welfare of subjects.
  • Immunogenicity Assessment The study will explore humoral and cell mediated immune responses in blood samples taken at baseline (i.e. Screening and Day 0 prior to dosing) and Weeks 6, 9, 11, 26, and 52. Tissue samples will be collected at baseline and if clinically indicated during the study.
  • Profiling of miRNA may occur using tissue obtained at Screening, Day 0, and upon relapse. Assessment of Day 0 and screening samples will explore predictive algorithms for response to treatment with INO-3107. Samples assessed from relapse will describe how changes in miRNA profiles may associate with likelihood of relapse.
  • Virologic Assessment The trial will evaluate the presence of HPV-6/11 DNA in tissue samples and peripheral blood, prior to and following study treatment, as described.
  • INO-3107 drug product is the investigational product to be used in this study.
  • INO-3107 drug product contains DNA plasmid for expression of the E6 and E7 proteins of HPV 11 and HPV 6 genes (pGX3024) and expression plasmid expressing human IL-12 subunits (pGX6010).
  • the INO-3107 drug product is a clear colorless solution that contains 6.25 mg total plasmid/mL (6 mg/mL pGX3024, 0.25 mg/mL pGX6010) in 150 mM sodium chloride and 15 mM sodium citrate, pH 7. A minimum volume of 1mL will be filled into 2-mL clear glass vials for intramuscular injection.
  • Subjects will be administered one 6.25 mg injection of INO-3107 drug product intramuscularly followed by EP using CELLECTRA® 2000 EP device at Day 0, Week 3, Week 6, and Week 9.
  • the analysis populations will be the following: -
  • the intention to treat (ITT) population includes all subjects who are eligible.
  • the modified intention to treat (mITT) population includes all subjects who receive at least one dose of INO-3107 drug product.
  • the per-protocol (PP) population comprises subjects who receive all doses of INO- 3107 drug product and have no protocol violations. Subjects excluded from the PP population will be identified and documented prior to locking of the trial database.
  • the safety analysis set includes all subjects who receive at least one dose of INO- 3107 drug product.
  • Peripheral Blood Immunogenicity Assessments Whole blood and serum samples will be obtained at baseline (screening and Day 0 prior to dosing) and at Weeks 6, 9, 11, 26 and 52. Peripheral blood mononuclear cells (PBMCs) will be isolated from whole blood samples. Assessment of cellular immune activity may occur via the application of gene expression, Interferon- ⁇ enzyme-linked immunosorbent spot (IFN- ⁇ ELISpot), as well as flow cytometry assays. Additional assessment of cellular immune activity may occur via the application Flow Cytometry for the purposes of performing a Lytic Granule Loading Assay.
  • IFN- ⁇ ELISpot Interferon- ⁇ enzyme-linked immunosorbent spot
  • the Lytic Granule Loading assay may examine the following external cellular markers: CD3, CD4, CD8 (T cell identification), Ki67, CD137, CD38 and CD69 (T cell activation markers) as well as PD-1 (exhaustion/activation marker), Tim-3, and Lag-3.
  • the Lytic Granule Loading assay may additionally analyze the following intracellular markers: Granzyme A, Granzyme B, Granulysin and Perforin (proteins involved in lytic degranulation and cytotoxic potential).
  • Profiling of miRNA will occur using plasma obtained at Screening, Day 0, and Week 6. Assessment of Day 0 and Screening samples will explore predictive algorithms for response to treatment with INO-3107.
  • TEAEs will be summarized among the Safety Population by frequency. These frequencies will be presented overall, by system organ class and by preferred term, the percentage of subjects affected. Additional frequencies will be presented with respect to maximum severity and to strongest relationship to study treatment. Multiple occurrences of the same AE will be counted only once following a worst-case approach with respect to severity and relationship to study treatment.
  • the main summary of safety data will be based on TEAEs. For this summary, the frequency of preferred term events will be calculated along with 95% confidence intervals, using the exact method of Clopper-Pearson. Separate summaries will be based on events occurring within 7 days of any dose and regardless of when they occurred. AEs and SAEs that are not TEAEs or serious TEAEs will be presented in listings.
  • AE duration will be calculated as (Stop Date – Start Date) + 1.
  • Laboratory response variables will be descriptively summarized per time point and as changes from baseline including 95% confidence intervals. Shifts from baseline according to the CTCAE will also be presented. Laboratory values considered clinically significant will be presented in listings.
  • Sequences and Sequence Identifiers >pGX3024 insert only amino acid sequence without IgE Leader Sequence ⁇ SEQ ID NO: 1> ESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQ YRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPQCEIEKLKHILGKARFIKLNNQRKGRCLHCWTTCMEDLLPR GRKRRSGSGATNFSLLKQAGDVEENPGPHGRLVTLKDIVLDLQPPDPVGLHAYEQLEDSSEDEVDKVDKQDSQPL TQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKPRGRKRRSGSGATNFSLLKQAGDVEE NPGPESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIYSYAYKQLKVLFR

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Engineering & Computer Science (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/032545 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same Ceased WO2021231925A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
PH1/2022/553102A PH12022553102A1 (en) 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same
BR112022022719A BR112022022719A2 (pt) 2020-05-14 2021-05-14 Vacinas para papilomatose respiratória recorrente e métodos de usar a mesma
MX2022014248A MX2022014248A (es) 2020-05-14 2021-05-14 Vacunas para la papilomatosis respiratoria recurrente y metodos para usar estas.
EP21804155.6A EP4149536A4 (en) 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same
PE2022002641A PE20230349A1 (es) 2020-05-14 2021-05-14 Vacunas para la papilomatosis respiratoria recurrente y metodos para usar estas
IL297903A IL297903A (en) 2020-05-14 2021-05-14 Vaccines for multiple recurrent respiratory papillomas and methods of their use
KR1020227043183A KR20230011335A (ko) 2020-05-14 2021-05-14 재발성 호흡기 유두종증에 대한 백신 및 이의 사용 방법
CN202180041036.2A CN115803051A (zh) 2020-05-14 2021-05-14 用于复发性呼吸道乳头状瘤病的疫苗及其使用方法
AU2021271860A AU2021271860B2 (en) 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same
JP2022568868A JP7765407B2 (ja) 2020-05-14 2021-05-14 再発性呼吸器乳頭腫症のためのワクチン及びそれを使用する方法
CA3177949A CA3177949A1 (en) 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same
SA522441314A SA522441314B1 (ar) 2020-05-14 2022-11-14 لقاحات لوُرام حليمي تنفسي متكرر وطرق استخدامها
CONC2022/0017989A CO2022017989A2 (es) 2020-05-14 2022-12-12 Vacunas para la papilomatosis respiratoria recurrente y métodos para usar estas
JP2025116664A JP2025158979A (ja) 2020-05-14 2025-07-10 再発性呼吸器乳頭腫症のためのワクチン及びそれを使用する方法
AU2025220899A AU2025220899A1 (en) 2020-05-14 2025-08-26 Vaccines for recurrent respiratory papillomatosis and methods of using the same

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063024912P 2020-05-14 2020-05-14
US63/024,912 2020-05-14

Publications (2)

Publication Number Publication Date
WO2021231925A1 true WO2021231925A1 (en) 2021-11-18
WO2021231925A8 WO2021231925A8 (en) 2022-03-24

Family

ID=78513438

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/032545 Ceased WO2021231925A1 (en) 2020-05-14 2021-05-14 Vaccines for recurrent respiratory papillomatosis and methods of using the same

Country Status (15)

Country Link
US (3) US11744885B2 (https=)
EP (1) EP4149536A4 (https=)
JP (2) JP7765407B2 (https=)
KR (1) KR20230011335A (https=)
CN (1) CN115803051A (https=)
AU (2) AU2021271860B2 (https=)
BR (1) BR112022022719A2 (https=)
CA (1) CA3177949A1 (https=)
CO (1) CO2022017989A2 (https=)
IL (1) IL297903A (https=)
MX (1) MX2022014248A (https=)
PE (1) PE20230349A1 (https=)
PH (1) PH12022553102A1 (https=)
SA (1) SA522441314B1 (https=)
WO (1) WO2021231925A1 (https=)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11409951B1 (en) * 2021-09-24 2022-08-09 International Business Machines Corporation Facilitating annotation of document elements
JP2024545087A (ja) * 2022-01-24 2024-12-05 ニュウィッシュ・テクノロジー(ベイジン)カンパニー・リミテッド Ccl11の用途

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112022022719A2 (pt) 2020-05-14 2023-02-14 Inovio Pharmaceuticals Inc Vacinas para papilomatose respiratória recorrente e métodos de usar a mesma
US20240123052A1 (en) * 2022-10-13 2024-04-18 Inovio Pharmaceuticals, Inc. Vaccines For Recurrent Respiratory Papillomatosis And Methods of Using the Same
CN121752584A (zh) * 2023-05-22 2026-03-27 普瑞赛格恩公司 用于治疗复发性呼吸道乳头状瘤病的新型腺病毒疫苗疗法

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180179257A1 (en) * 2015-06-10 2018-06-28 Hookipa Biotech Ag Hpv vaccines
US20190062379A1 (en) * 2015-12-04 2019-02-28 Xiamen University Mutant of L1 Protein of Human Papillomavirus Type 11
US20190192650A1 (en) * 2013-03-12 2019-06-27 The Trustees Of The University Of Pennsylvania Vaccines For Human Papilloma Virus And Methods For Using The Same
WO2019151760A1 (ko) * 2018-02-02 2019-08-08 주식회사 에스엘백시젠 신규 다가 hpv 백신 조성물

Family Cites Families (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3805783A (en) 1971-02-12 1974-04-23 A Ismach Hand powered hypodermic jet injector gun
US4342310A (en) 1980-07-08 1982-08-03 Istvan Lindmayer Hydro-pneumatic jet injector
US4447223A (en) 1982-04-16 1984-05-08 Cct Associates Medicament implant applicator
US5703055A (en) 1989-03-21 1997-12-30 Wisconsin Alumni Research Foundation Generation of antibodies through lipid mediated DNA delivery
US5545130A (en) 1992-04-08 1996-08-13 Genetronics, Inc. Flow through electroporation method
US5702359A (en) 1995-06-06 1997-12-30 Genetronics, Inc. Needle electrodes for mediated delivery of drugs and genes
US5993434A (en) 1993-04-01 1999-11-30 Genetronics, Inc. Method of treatment using electroporation mediated delivery of drugs and genes
US5679647A (en) 1993-08-26 1997-10-21 The Regents Of The University Of California Methods and devices for immunizing a host against tumor-associated antigens through administration of naked polynucleotides which encode tumor-associated antigenic peptides
US5505697A (en) 1994-01-14 1996-04-09 Mckinnon, Jr.; Charles N. Electrically powered jet injector
US5869326A (en) 1996-09-09 1999-02-09 Genetronics, Inc. Electroporation employing user-configured pulsing scheme
US6216034B1 (en) 1997-08-01 2001-04-10 Genetronics, Inc. Method of programming an array of needle electrodes for electroporation therapy of tissue
US6055453A (en) 1997-08-01 2000-04-25 Genetronics, Inc. Apparatus for addressing needle array electrodes for electroporation therapy
US6241701B1 (en) 1997-08-01 2001-06-05 Genetronics, Inc. Apparatus for electroporation mediated delivery of drugs and genes
US6208893B1 (en) 1998-01-27 2001-03-27 Genetronics, Inc. Electroporation apparatus with connective electrode template
US6009347A (en) 1998-01-27 1999-12-28 Genetronics, Inc. Electroporation apparatus with connective electrode template
US6120493A (en) 1998-01-27 2000-09-19 Genetronics, Inc. Method for the introduction of therapeutic agents utilizing an electroporation apparatus
JP2002520101A (ja) 1998-07-13 2002-07-09 ジェネトロニクス、インコーポレーテッド 電気的に補助される化粧用薬剤の局部送達法および装置
US6192270B1 (en) 1998-08-14 2001-02-20 Genetronics, Inc. Apparatus and method for the delivery of drugs and genes into tissue
US6150148A (en) 1998-10-21 2000-11-21 Genetronics, Inc. Electroporation apparatus for control of temperature during the process
US7171264B1 (en) 1999-05-10 2007-01-30 Genetronics, Inc. Intradermal delivery of active agents by needle-free injection and electroporation
US6520950B1 (en) 1999-05-10 2003-02-18 Genetronics, Inc. Method of electroporation-enhanced delivery of active agents
US7245963B2 (en) 2002-03-07 2007-07-17 Advisys, Inc. Electrode assembly for constant-current electroporation and use
US7328064B2 (en) 2002-07-04 2008-02-05 Inovio As Electroporation device and injection apparatus
MXPA05004860A (es) 2002-11-04 2005-08-18 Advisys Inc Promotores musculares sinteticos con actividades que exceden las secuencias reguladoras de origen natural en las celulas cardiacas.
CA2653478A1 (en) * 2009-01-23 2010-07-23 Gregg Martin Automated wash system for industrial vehicles
WO2014093894A2 (en) 2012-12-13 2014-06-19 The Trustees Of The University Of Pennsylvania Dna antibody constructs and method of using same
KR20150130284A (ko) 2013-03-15 2015-11-23 더 트러스티스 오브 더 유니버시티 오브 펜실바니아 암 백신 및 이를 이용한 치료 방법
MX2017007187A (es) 2014-12-01 2018-01-30 Univ Pennsylvania Construcciones de anticuerpos de adn y metodo para utilizarlas.
US20230000969A1 (en) 2019-10-24 2023-01-05 Inovio Pharmaceuticals, Inc. Improved vaccines for recurrent respiratory papillomatosis and methods for using the same
BR112022022719A2 (pt) 2020-05-14 2023-02-14 Inovio Pharmaceuticals Inc Vacinas para papilomatose respiratória recorrente e métodos de usar a mesma
CA3223587A1 (en) 2021-06-30 2023-01-05 Paul Fisher Side-port injection devices for use with electroporation, and related systems and methods

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20190192650A1 (en) * 2013-03-12 2019-06-27 The Trustees Of The University Of Pennsylvania Vaccines For Human Papilloma Virus And Methods For Using The Same
US20180179257A1 (en) * 2015-06-10 2018-06-28 Hookipa Biotech Ag Hpv vaccines
US20190062379A1 (en) * 2015-12-04 2019-02-28 Xiamen University Mutant of L1 Protein of Human Papillomavirus Type 11
WO2019151760A1 (ko) * 2018-02-02 2019-08-08 주식회사 에스엘백시젠 신규 다가 hpv 백신 조성물

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4149536A4 *

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11409951B1 (en) * 2021-09-24 2022-08-09 International Business Machines Corporation Facilitating annotation of document elements
JP2024545087A (ja) * 2022-01-24 2024-12-05 ニュウィッシュ・テクノロジー(ベイジン)カンパニー・リミテッド Ccl11の用途
JP7777890B2 (ja) 2022-01-24 2025-12-01 ニュウィッシュ・テクノロジー(ベイジン)カンパニー・リミテッド Ccl11の用途

Also Published As

Publication number Publication date
US20260053908A1 (en) 2026-02-26
US20210353736A1 (en) 2021-11-18
CO2022017989A2 (es) 2022-12-20
SA522441314B1 (ar) 2024-08-05
MX2022014248A (es) 2022-12-02
EP4149536A4 (en) 2024-08-07
BR112022022719A2 (pt) 2023-02-14
CN115803051A (zh) 2023-03-14
US11744885B2 (en) 2023-09-05
US20230414744A1 (en) 2023-12-28
AU2021271860A1 (en) 2022-12-15
JP2025158979A (ja) 2025-10-17
US12478667B2 (en) 2025-11-25
PE20230349A1 (es) 2023-03-02
EP4149536A1 (en) 2023-03-22
JP7765407B2 (ja) 2025-11-06
IL297903A (en) 2023-01-01
KR20230011335A (ko) 2023-01-20
AU2025220899A1 (en) 2025-09-18
WO2021231925A8 (en) 2022-03-24
AU2021271860B2 (en) 2025-06-05
CA3177949A1 (en) 2021-11-18
PH12022553102A1 (en) 2023-11-20
JP2023525558A (ja) 2023-06-16

Similar Documents

Publication Publication Date Title
US12478667B2 (en) Vaccines for recurrent respiratory papillomatosis and methods of using the same
JP2024150611A (ja) Wt1ワクチン
CN105939730A (zh) MERS-CoV疫苗
US20190328855A1 (en) Optimized Synthetic Consensus Immunogenic Compositions Targeting Fibroblast Activation Protein
KR20150128900A (ko) 항원 및 어쥬번트로서 인터류킨-23을 갖는 백신
US20240123052A1 (en) Vaccines For Recurrent Respiratory Papillomatosis And Methods of Using the Same
EP3106174A1 (en) Immunotherapeutic composition, therapeutic method and diagnostic method
EA049710B1 (ru) Вакцины против рецидивирующего респираторного папилломатоза и способы их применения
HK40089092A (zh) 用於复发性呼吸道乳头状瘤病的疫苗及其使用方法
US12350318B2 (en) Combination therapy to treat brain cancer
HK40126944A (zh) 用於复发性呼吸道乳头状瘤病的疫苗及其使用方法
US20260008821A1 (en) Modified hiv envelope antigens and method of use thereof
TW202400635A (zh) 針對sars-cov-2變異體之免疫原性組合物及其使用方法
US20230210981A1 (en) Coronavirus disease 2019 (covid-19) combination vaccine
WO2022174052A1 (en) Consensus prostate antigens, nucleic acid molecules encoding the same, and vaccines and uses comprising the same
HK40108628A (zh) 用以治疗脑癌的组合疗法
EA049799B1 (ru) Комбинированная терапия для лечения рака мозга

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21804155

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3177949

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022568868

Country of ref document: JP

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022022719

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 202217070040

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20227043183

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: DZP2022001003

Country of ref document: DZ

WWE Wipo information: entry into national phase

Ref document number: NC2022/0017989

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 2021271860

Country of ref document: AU

Date of ref document: 20210514

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021804155

Country of ref document: EP

Effective date: 20221214

WWP Wipo information: published in national office

Ref document number: NC2022/0017989

Country of ref document: CO

ENP Entry into the national phase

Ref document number: 112022022719

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20221108

WWE Wipo information: entry into national phase

Ref document number: 522441314

Country of ref document: SA

WWE Wipo information: entry into national phase

Ref document number: 522441314

Country of ref document: SA

WWG Wipo information: grant in national office

Ref document number: 522441314

Country of ref document: SA

WWG Wipo information: grant in national office

Ref document number: 202293315

Country of ref document: EA