WO2021219940A1 - Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa - Google Patents
Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa Download PDFInfo
- Publication number
- WO2021219940A1 WO2021219940A1 PCT/FI2021/050318 FI2021050318W WO2021219940A1 WO 2021219940 A1 WO2021219940 A1 WO 2021219940A1 FI 2021050318 W FI2021050318 W FI 2021050318W WO 2021219940 A1 WO2021219940 A1 WO 2021219940A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- conjugate
- dcn
- tcrk
- decorin
- agent
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4725—Proteoglycans, e.g. aggreccan
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1019—Tetrapeptides with the first amino acid being basic
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/06—Linear peptides containing only normal peptide links having 5 to 11 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the present invention relates generally to the field of molecular medicine. More specifically, the invention relates to a homing peptide-guided decorin conjugate for use in the treatment of epidermolysis bullosa, and to a corresponding method of treatment.
- transdermal drug delivery Being the largest organ of the human body, skin presents unique challenges for efficient drug delivery.
- the primary challenge related to local, i.e. transdermal drug delivery is the poor penetration of macromolecules into the skin. Diffusion through intercellular lipids provides the option of transdermal delivery, but is limited only for small lipophilic molecules. Therefore, systemically administered, yet skin-specific therapeutics would be a substantial therapeutic advance for the treatment of skin diseases, particularly those that affect the entire skin, such as epidermolysis bullosa, a group of rare genetic diseases that cause fragile, blistering skin.
- Recessive dystrophic epidermolysis bullosa is caused by mutations in COL7A1 gene that encodes type VII collagen (C7).
- Clinical manifestations include skin erosions and blistering, mutilating scarring, pseudosyndactyly and a high risk of developing aggressive and rapidly metastasizing cutaneous squamous cell carcinomas (cSCCs).
- cSCCs cutaneous squamous cell carcinomas
- Transforming growth factor b (TGFP) signaling has been demonstrated to play an essential role in the development of fibrosis and in the progression to malignancy in RDEB. Earlier, it has been demonstrated that TGFp signaling is activated as early as a week after birth in coI7al7- mice (Liao et al, 2018, Stem Cells 36: 1839-1850). Thus, an early intervention on the activation of TGFp signaling may be beneficial in reducing disease burden in RDEB. TGFp signaling has also been suggested to be a phenotypic modulator in monozygotic twins with identical COL7A1 mutations (Odorisio et al., 2014, Hum Mol Genet 23: 3907-3922).
- DCN proteoglycan decorin
- ECM extracellular matrix
- Dcn !- mice exhibit irregular collagen fibril formation and significantly reduced tensile strength in skin (Reed and Iozzo, 2002, Glycoconj J 19: 249-255).
- DCN has anti-fibrotic and anti-tumor functions by regulating activities of multiple growth factors, among them inhibitory action on TGFp Qarvinen and Prince, 2015, Biomed Res Int 2015: 654765; Jarvinen and Ruoslahti, 2019, Br J Pharmacol 176: 16-25).
- DCN binds and neutralizes connective tissue growth factor (CTGF/CCN2), which is a downstream mediator of TGFP's fibrotic signaling and has been proposed to be a therapeutic target in prevention of scarring (Vial et al. 2011, J Biol Chem 286: 24242-24252; Daniels et al. 2003, Am J Pathol 163: 2043-2052).
- CTGF/CCN2 connective tissue growth factor
- DCN has not reached the clinic as systemic therapy.
- a general limitation in systemic drug delivery is that only a small fraction of drug reaches its desired location and systemic side effects are encountered in other organs.
- a critical goal of modern drug development is to generate drugs to be target organ-specific, with minimal adverse effects in the other parts of the body. This goal could be achieved by developing drugs that recognize a specific epitope expressed in the affected organ.
- drugs can be converted to be target-specific by conjugation with an affinity ligand such as a vascular homing peptide that recognizes tissue- or target specific molecular features in the blood vessels in the given organ.
- vascular zip codes tissue or disease-specific molecular features in blood vessels
- affinity ligands such as vascular homing peptides.
- C-end Rule (CendR) sequence (Ruoslahti, 2017, J Clin Invest 127: 1622-1624; Teesalu et ah, 2009, Proc Natl Acad Sci U S A 106: 16157-16162; Sugahara et ah, 2009, Cancer Cell 16: 510-520; Sugahara et ah, 2010, Science 328: 1031-1035).
- the CendR-sequence binds to neuropilin-1 (NRP-1), activating extravasation and tissue penetration pathway that delivers the peptide along with its payload into the parenchyma of the tumor tissue (Ruoslahti, 2017, Adv Drug Deliv Rev 110-111: 3-12; Ruoslahti, 2017, J Clin Invest 127: 1622-1624; Teesalu et ah, 2009, PNAS 106(38):16157-16162).
- Peptides containing a cryptic CendR owe their target selectivity to combination of binding to a primary receptor with a tumor specific expression pattern, and to a proteolytic activation in the tumor to expose the CendR sequence in the target organ.
- NRP-1 is expressed by the endothelial cells in all tissues (Ruoslahti, 2017, Adv Drug Deliv Rev 110-111: 3-12), the extravasation and tissue penetration via NRP-1 are unlikely to be restricted to cancerous tissues but happen in other diseased or healthy tissues as well.
- CRK peptide contains a cryptic CendR-sequence, RKDK (SEQ ID NO: 1), it is the only peptide among the vascular homing CendR peptides that is not capable of penetrating cells and tissues (Jarvinen and Ruoslahti, 2007, Am J Pathol 171: 702-711; Agemy et ah, 2010, Blood 116: 2847-2856).
- WO 2008/136869 discloses the CRK peptide as a specific homing element for targeted delivery of decorin into skin wounds.
- the disclosed CRK-decorin fusions do not home to non-wounded skin.
- skin-specific therapeutics would be a substantial therapeutic advance for the treatment of skin diseases, such as epidermolysis bullosa.
- a homing peptide-guided decorin conjugate for use in the treatment of epidermolysis bullosa.
- the conjugate comprises a decorin segment and a homing peptide, wherein the C-terminal end of the homing peptide consists of the amino acid sequence RKDK (SEQ ID NO: 1) or CRKDK (SEQ ID NO: 2).
- the conjugate Owing to the homing peptide, the conjugate selectively homes to and penetrates skin and skin wounds in vivo.
- Figures 1A to 1C illustrate the structure of an exemplary recombinant DCN-tCRK protein and its binding to neuropilin-1.
- Figure 1A is a schematic representation of the structure of DCN-tCRK. Signal- and propeptide of the native DCN were replaced with a 6XHis-tag (1) for purification. The His-tag is followed by the amino terminus (11), core protein (111), and carboxyl terminus (IV) of mature DCN proteoglycan. tCRK peptide (V) was cloned on the carboxyl end of the protein.
- Figure IB shows in vitro binding of DCN- tCRK to neuropilin-1 (NRP-1) in vitro.
- DCN-tCRK left panel
- peptide controls right panel, positive peptide: RPARPAR (SEQ ID NO: 25) and negative peptide: RPARPARA (SEQ ID NO: 26)
- BSA bovine serum albumin
- WT and mutant NRP1 were labeled with FAM and added to the immobilized plate. The binding of the NRP1 was measured based on fluorescent intensity. Error bars represent SEM. Experiments were repeated with triplicate samples **p ⁇ 0.01, ***p ⁇ 0.001, ****p ⁇ 0.0001, Student’s unpaired t-test.
- Figure 1C shows the internalization of DCN-tCRK in the NRP-1 positive cells.
- FAM-labeled DCN-tCRK was incubated with PC3 and M21 cells positive and negative for NRP-1 expression respectively.
- DCN-tCRK was detected by anti-FAM immunostaining. Nuclei were counter stained with DAP1. Representative images from three independently studied experiment. Scale bar 20 gm.
- FIGS 2A to 2D illustrate recombinant protein production and characterization of an exemplary DCN-tCRK.
- Figure 2A shows an example of a purification chromatogram after the HisTrap HP column step on the Akta Start with one big peak, of which all peak fractions were used for further processing.
- Figure 2B Coomassie-stained reduced SDS-Page gel (upper panel) and Western blot (lower panel) of purified DCN-tCRK are shown alongside the DCN of prior art. On the SDS gel 2 and 1 gg of protein were loaded; for Western blot analysis 1 and 0.5 gg of protein were applied. Monomeric forms of the proteins, as well as forms including the GAG side chains are visible.
- Figure 2D shows a differential scanning calorimetry (DSC) curve for the melting temperature of DCN-tCRK.
- DLS dynamic light scattering
- Figures 4A to 4D demonstrate that DCN-tCRK improves survival of coI7al - mice and homes to the skin.
- FIG. 4C shows immunohistochemical staining using anti-histidine antibody (anti-his) on both paw and dorsal skin of co!7al7- mice are presented. Nuclei were counterstained with DAP1. Scale bar: 20 gm.
- Figure 4D shows representative double-staining of anti-histidine tag and anti-NRP-1 and the merged image (with DAP1 counterstain) of the DCN-tCRK, DCN and untreated RDEB skin are presented. Scale bar: 25 gm
- D/HSA dextran/human serum albumin
- Figure 6 illustrates that DCN-tCRK normalizes fibrotic gene signature in RDEB.
- Figure 6A shows relative gene expression in a clustergram for the genes that had >1.5-fold increase in expression in the untreated RDEB skin as compared to the WT.
- Figure 6B shows volcano plots on log2 fold changes and -loglO p value of gene expression in the vehicle, DCN and DCN-tCRK treated col7al V- mouse skin relative to the WT.
- Figure 7 demonstrates that DCN-tCRK administration suppressed the development of fibrosis in co!7al7- mice.
- Figure 7A shows representative immunohistochemical staining of CTGF/CCN2 in WT and co!7al7- mice at one and two weeks of age with and without DCN-tCRK treatment. Scale bar 50 pm upper panel and 25 pm lower panel.
- Figure 7B shows picrosirius red staining of the paw skin from the WT and co!7al7- mice at one and two weeks of ages with and without DCN-tCRK treatment. Picrosirius red images were acquired using polarized light. Scale bar 25 pm.
- Figure 7C shows quantification of the picrosirius red mean intensity per field acquired with a 20 x objective.
- FIG. 7D shows representative pictures of collagen type 1 (COL1) expression in RDEB and WT skin at two weeks (COL1 first column), and double immunofluorescence staining of a-smooth muscle actin (aSMA second column) and blood vessels (CD31 third column) in WT and col7al7- mice at two weeks of age with and without DCN-tCRK treatment. Nuclei were counter-stained by DAP1. Merged image is shown in the fourth column. Scale bar 25 pm.
- Figure 8 shows the results of an in vitro Collagen lattice contraction assay.
- Upper representative images of human normal fibroblasts and RDEB patient-derived fibroblasts 48 hours after seeding in collagen gels, with and without addition of DCN and DCN-tCRK at a final concentration of 75 nM.
- Bottom contraction of collagen gels, calculated as percentage of contraction compared with the initial area.
- the present invention relates to a therapeutic use of a homing peptide-guided decorin conjugate. More specifically, the invention provides a homing peptide-guided decorin conjugate for use in the treatment of epidermolysis bullosa, as well as a method of treating epidermolysis bullosa in a subject in need thereof by administering an efficient amount of a homing peptide-guided decorin conjugate to said subject.
- Epidermolysis bullosa is a group of rare diseases that cause fragile, blistering skin.
- the blisters may appear in response to minor injury, even from heat, rubbing, scratching or adhesive tape. In severe cases, the blisters may occur inside the body, such as the lining of the mouth or the stomach.
- Epidermolysis bullosa exists in various forms, including acquired and congenital forms, the latter of which may be recessive or dominant.
- epidermolysis bullosa include acquired epidermolysis bullosa, junctional epidermolysis bullosa, epidermolysis bullosa simplex, Kindler syndrome, and dystrophic epidermolysis bullosa, including dominant dystrophic epidermolysis bullosa and recessive dystrophic epidermolysis bullosa, such as recessive dystrophic epidermolysis bullosa inversa. Any subtypes of said examples are also encompassed.
- the term "subject” refers to an animal subject, preferably to a mammalian subject, more preferably to a human subject.
- the term “patient” refers to a human subject.
- treatment refers to the administration of the conjugate or a pharmaceutical composition comprising the same to subject for purposes which may include ameliorating, lessening, inhibiting, or curing epidermolysis bullosa.
- the term “efficient amount” refers to an amount by which harmful effects of epidermolysis bullosa are, at a minimum, ameliorated.
- the term “decorin” refers to any isoform of a small leucine-rich chondroitin sulfate proteoglycan. It is a multifunctional proteoglycan that, for example, regulates collagen fibril formation, prevents tissue fibrosis, promotes tissue regeneration, and acts as an antagonist of TGF-b.
- decorin is human decorin comprising or consisting of an amino acid sequence of decorin isoform A, B, C, D or E, with or without N-terminal signal sequence and/or propeptide.
- the decorin comprises or consists of an amino acid sequence set forth in any one of SEQ ID Nos: 6-20. Conservative sequence variants and peptidomimetics of said decorin species are also included.
- the term "decorin segment" refers to a part of the present conjugate that comprises or consists of decorin.
- the decorin segment comprises or consists of an amino acid sequence that has at least about 99%, 98%, 97%, 96%, 95%, 90%, 80%, 70%, or 60% sequence identity with the amino acid sequence of SEQ ID NOs: 6-20, or any percentage in between, provided that the biological properties of decorin are not significantly altered.
- Such decorin variants may arise from addition, deletion and/or substitution of one or more amino acids. Means and methods for determining whether decorin has retained its biological properties are readily available in the art.
- the comparison of sequences and determination of identity percentage between two sequences can be accomplished using mathematical algorithms available in the art.
- homing peptide refers broadly to any peptide that selectively homes to, i.e. targets, specific cells or tissue in vivo in preference to other cells or tissues. Accordingly, homing peptides can be utilized as targeted delivery vehicles.
- the homing peptide-guided decorin conjugate for use in the present invention differs from the known decorin fusion protein disclosed in WO 2008/136869 at least in respect of the homing peptide employed.
- the prior art decorin fusion protein contains the known CRK peptide (CRKDKC; SEQ ID NO: 3), whereas the C-terminal end of the novel homing peptide utilized in the present invention consists of the amino acid sequence RKDK (SEQ ID NO: 1).
- the C-terminal end of the novel homing utilized in the present invention consists of CRKDK (SEQ ID NO: 2).
- truncation of the C-terminal cysteine of the known CRK peptide changes the homing specificity of the peptide.
- the truncated CKR denoted hereinafter as tCRK (RKDK, SEQ ID NO: 1; or CRKDK, SEQ ID NO: 2), confers the peptide the ability to home to and penetrate non-wounded skin while retaining its ability to home to skin wounds.
- the CRK peptide homes selectively to skin wounds only, whereas the tCRK peptide homes and penetrates selectively to both skin wounds and non-wounded skin.
- the truncation of the C-terminal cysteine of the CRK peptide exposes a cryptic CendR (C-end Rule) sequence R/KXXR/K (SEQ ID NO: 4), i.e. RKDK (SEQ ID NO: 1) in the present tCRK peptide.
- C-end Rule C-end Rule sequence
- R/KXXR/K SEQ ID NO: 4
- RKDK SEQ ID NO: 1
- the CRK peptide containing the cryptic CendR-motif is not capable of penetrating cells and tissues (Jarvinen and Ruoslahti, 2007, Am J Pathol 171: 702-711; Agemy et al., 2010, Blood 116: 2847-2856).
- the homing peptide employed in the present conjugate comprises a tCRK element at the C-terminal end of the homing peptide.
- C-terminal end refers to the end of an amino acid chain terminated by a free carboxyl group (-COOH).
- -COOH free carboxyl group
- N-terminal end also known as the amino-terminus, amine- terminus, N-terminus, or NH2-terminus refers to the start of an amino acid chain.
- the first amino acid of an amino acid chain contains a free amine group (-NH2).
- N-terminal end and “N-terminal” are interchangeable. Peptide sequences are written from N-terminus to C-terminus.
- tCRK element refers to a peptide having the amino acid sequence RKDK (SEQ ID NO: 1) or CRKDK (SEQ ID NO: 2) that selectively homes to skin and skin wounds in vivo, and can penetrate skin tissue.
- RKDK amino acid sequence
- CRKDK CRKDK
- the tCRK element is located at the C-terminal end of the homing peptide employed herein. More specifically, the tCRK element is located at the C-terminal extremity of the homing peptide and comprises the terminal carboxyl group.
- the C-terminal end of the homing peptide consists of the amino acid sequence RKDK (SEQ ID NO: 1) or CRKDK (SEQ ID NO: 2).
- the homing peptide comprising the tCRK element ends with the amino acid sequence RKDK (SEQ ID NO: 1) or CRKDK (SEQ ID NO: 2).
- the homing peptide employed in the present invention consists of SEQ ID NO: 1 or SEQ ID NO: 2. In some other embodiments, the homing peptide comprises SEQ ID NO:l or SEQ ID NO: 2. In the latter cases, the homing peptide comprises additional amino acids attached to the N-terminal end of the tCRK element. However, the C-terminal end of such longer homing peptides still consists of the tCRK element. In some embodiments, the homing peptide can comprise up to 100 amino acids. In some embodiments, the homing peptide can comprise up to 50 amino acids. In some embodiments, the homing peptide can comprise up to 20 amino acids. In some embodiments, the peptide homing can comprise up to 10 amino acids.
- the homing peptide may be part of a cyclic structure, and it may be cyclized, for example, via a disulfide bond, and then cleaved by a protease to expose the tCRK sequence as a CendR peptide in the C-terminus of the homing peptide.
- tCRK-guided decorin refers to any decorin conjugate, whose targeted delivery or homing is accomplished by the tCRK homing peptide according to any one of the embodiments disclosed herein.
- Non-limiting examples of such conjugates include those wherein the decorin segment comprises or consists of an amino acid sequence set forth in any one of SEQ ID NO: 6-20 and is attached from its C-terminal end to the N-terminal end of the tCRK element of SEQ ID NO: 1 or 2, with or without an intervening linker, such as that of SEQ ID NO: 23 or 24.
- Further examples include conjugates comprising or consisting of an amino acid sequence of SEQ ID NO: 21 or 22.
- Still further examples include sequence variants having at least about 99%, 98%, 97%, 96%, 95%, 90%, 80%, 70%, or 60% sequence identity to said sequences as well as their conservative sequence variants and peptidomimetics, with the proviso that the homing specificity and the penetration capability of the tCRK element, and the biological activity of decorin remains essentially unaltered.
- the tCRK-guided decorin conjugate may be provided for use in the form of a fusion protein but is not limited thereto. Accordingly, in some embodiments, the conjugate is a "fusion protein" comprising a decorin segment fused or linked to the N-terminal end of a homing peptide disclosed herein, preferably from the C-terminal end of the decorin segment, with or without one or more additional amino segments, such as peptide, oligopeptide, polypeptide or protein segments which may consist of or comprise natural or non-natural amino acids or peptidomimetics.
- Such one or more additional amino acid segments may be fused or linked to the N- terminal end of the decorin segment and/or fused or linked between the C-terminal end of the decorin segment and N-terminal end of the homing peptide.
- Said additional amino acid segments may have therapeutic activity, or they may be employed for diagnostic, imaging or visualization purposes, for example.
- peptide refers to a series of amino acid residues connected to one another typically by peptide (amide) bonds between the alpha-amino and carbonyl groups of the adjacent amino acids to form an amino acid sequence.
- peptides are defined as molecules that consist of between 2 and 100, e.g. between 2 and 50 amino acids.
- peptides may be subdivided into oligopeptides, which have few amino acids (e.g., 2 to 20), and polypeptides, which have many amino acids (e.g., 20 to 100, or 20 to 50). Proteins are essentially large peptides typically consisting of more than 50, or more than 100 amino acids.
- peptide as used herein encompasses any peptide-bonded series of natural (L-) and/or non-natural (D-) amino acid residues, and is interchangeable with “oligopeptides”, “polypeptides”, “proteins” and fragments thereof, unless clearly indicated otherwise. Peptidomimetic forms of the peptides are also encompassed.
- the fusion proteins for use in the present invention can have any suitable length, for example, up to 300, 350, 400, 500, 1000 or 2000 residues, or it may have any number of residues including or between said integers.
- residue refers to an amino acid or amino acid analog.
- the fusion proteins for use in the present invention may comprise small peptide tags that facilitate, for example, purification, isolation, and/or detection.
- suitable affinity tags for purification purposes include polyhistidine tags (His-tags), hemagglutinin tags (HA-tags), glutathione S- transferase tags (GST-tags), biotin tags, avidin tags and streptavidin tags.
- Suitable detection tags include, but are not limited to, fluorescent proteins, such as GFP.
- the fusion proteins for use in the present invention may be created by any appropriate means, methods or techniques available in the art, for example, by an automated peptide synthesizer, or produced by genetic engineering technologies.
- an expression vector comprising a polynucleotide encoding for decorin and the tCRK homing peptide may be prepared by genetic engineering, and then transfected into a host cell to express the fusion protein.
- suitable host cells include prokaryotic hosts such as bacteria (e.g. E. coli, bacilli), yeast (e.g. Pichia postoris, Saccharomyces cerevisae ), and fungi (e.g.
- Expression vectors may be transfected into host cells by a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell including, but not limited to, electroporation, nucleofection, sonoporation, magnetofection, heat shock, calcium-phosphate precipitation, DEAE- dextran transfection and the like.
- electroporation nucleofection, sonoporation, magnetofection, heat shock, calcium-phosphate precipitation, DEAE- dextran transfection and the like.
- a wide variety of expression vectors are readily available in the art, and those skilled in the art can easily select suitable ones depending on different variables, such as the host cell to be employed.
- the fusion proteins for use in the present invention can also be produced by in vitro protein expression, also known as in vitro translation, cell-free protein expression, cell-free translation, or cell- free protein synthesis.
- in vitro protein expression also known as in vitro translation, cell-free protein expression, cell-free translation, or cell- free protein synthesis.
- cell-free expression systems based on, for instance, bacterial, rabbit reticulocyte, CHO, or human lysates are commercially available in the art.
- In vitro protein expression may be performed either in batch reactions or in a dialysis mode.
- Fusion partners of the fusion protein for use in the present invention may be linked to each other directly or via a linker.
- the linker may be a peptide linker or a non-peptide linker. If the linker is a peptide linker, it may be composed of one or more amino acids.
- a non-limiting example of a peptide linker comprises or consists of an amino acid sequence set forth in SEQ ID NO: 23 or 24.
- the homing peptide might be coupled to decorin or any other therapeutic protein comprised in the present conjugate or composition via a system like SpyTag/SpyCatcher.
- the fusion proteins for use in the present invention may in some embodiments be produced using a nucleic acid molecule which encodes the fusion protein.
- nucleic acid molecules may be used not only for recombinant production of the fusion proteins they encode but also for gene therapy through means and methods available in the art.
- conservative sequence variant refers to amino acid sequence modifications, which do not significantly alter the biological properties of the protein or peptide in question.
- Conservative sequence variants include variants arising from one or more amino acid substitutions with similar amino acids well known in the art (e.g. amino acids of similar size or with similar charge properties).
- peptidomimetic refers to a peptide-like molecule designed to mimic a given protein or peptide without altering its activity, such as homing specificity.
- Non-limiting examples of peptidomimetics include chemically modified peptides, D-peptide peptidomimetics, peptide-like molecules comprising non- naturally occurring amino acids, peptoids and b-peptides. Also molecules that resemble peptides, but which are not connected via a natural peptide linkage are included in the term. Means and methods for producing peptidomimetics are readily available in the art.
- the tCRK-guided decorin conjugate for use in the treatment of epidermolysis bullosa may further comprise one or more covalently (directly or indirectly via a linker) or non-covalently linked additional moieties as desired, provided that the therapeutic activity of the conjugate is retained.
- an additional moiety may have therapeutic activity of its own, such as anti-inflammatory activity, anti-angiogenic activity, regenerative activity, pro- angiogenic activity, cytotoxic activity, pro-apoptotic activity, antimicrobial activity (e.g. anti-bacterial activity, anti-viral activity, anti-fungal activity or anti-protozoan activity), anti-fibrotic activity, anti-wrinkle activity, anti-itching activity, anti- or pro transmitter (such as histamine) activity or cytokine activity, or it may be a cytokine inhibitor (e.g. an antagonist, a soluble receptor, a cytokine-binding molecule, or a cytokine that blocks other cytokines), to mention some non-limiting examples of potential biological activities or therapeutic effects of therapeutic moieties.
- antimicrobial activity e.g. anti-bacterial activity, anti-viral activity, anti-fungal activity or anti-protozoan activity
- anti-fibrotic activity e.g. anti-wrinkle activity
- an additional moiety may be a small molecule, such as that selected from anti-histamine, antibiotics, retinoids, benzoyl peroxide, podophyllotoxin, cytotoxic drugs, and immune modulators such as corticosteroid derivatives, calcineurin inhibitors and imiquimod.
- an additional moiety may be a protein moiety, such as anti-fibrotic TGF-P3, any regenerative or anti inflammatory growth factor or cytokine such as interleukin- 10 (lL-10), any angiogenic growth factor such as vascular endothelial growth factor (VEGF), any anti-apoptotic protein such as bitl, any inflammation suppressing enzyme such as CD73, or any collagen such as type Vll collagen.
- a protein moiety such as anti-fibrotic TGF-P3, any regenerative or anti inflammatory growth factor or cytokine such as interleukin- 10 (lL-10), any angiogenic growth factor such as vascular endothelial growth factor (VEGF), any anti-apoptotic protein such as bitl, any inflammation suppressing enzyme such as CD73, or any collagen such as type Vll collagen.
- an additional moiety may be employed to facilitate detection of the tCRK-guided decorin conjugate.
- the conjugate may comprise a detectable agent.
- detectable agent refers to any molecule which can be detected, either directly or indirectly, preferably by a non-invasive and/or in vivo visualization technique.
- Non-limiting examples of detectable agents suitable for use in the disclosed conjugates include optical agents such as fluorescent agents including a variety of organic and/or inorganic small molecules and a variety of fluorescent proteins and derivatives thereof, phosphorescent agents, luminescent agents such as chemiluminescent agents, and chromogenic agents; radiolabels such as radionuclides that emit gamma rays, positrons, beta or alpha particles, or X-rays; non-radioactive isotopes such as cadolinium (Gd); ionic and non-ionic contrasting agents such as iodine-based contrasting agents; electromagnetic agents such as magnetic, ferromagnetic, paramagnetic, and/or superparamagnetic agents; upconverting nanoparticles (UCNP), resonance particles, quantum dots, and gold particles.
- optical agents such as fluorescent agents including a variety of organic and/or inorganic small molecules and a variety of fluorescent proteins and derivatives thereof, phosphorescent agents, luminescent agents such as chem
- detectable agents are available in the art. Those skilled in the art can readily select an appropriate imaging technique depending on the type and species of the detectable agent employed in the conjugate. Such techniques include, but are not limited to, radiological techniques, isotope techniques such as positron emission tomography, ultrasound imaging and magnetic resonance imaging (MRI).
- imaging technique include, but are not limited to, radiological techniques, isotope techniques such as positron emission tomography, ultrasound imaging and magnetic resonance imaging (MRI).
- a detectable agent may be attached to the decorin conjugate directly, for example, through a covalent bond, or indirectly, for example, via a binding agent, a linker, or a chelating agent such as diethylenetriaminepentaacetic acid (DTPA), 4,7,10- tetraazacyclododecane-N- ,N',N",N"'-tetraacetic acid (DOTA) and/or metallothionein.
- DTPA diethylenetriaminepentaacetic acid
- DOTA 4,7,10- tetraazacyclododecane-N- ,N',N",N"'-tetraacetic acid
- metallothionein metallothionein.
- the tCRK-guided decorin conjugate for use in the treatment of epidermolysis bullosa is provided in a pharmaceutical composition comprising the conjugate and a pharmaceutically or physiologically acceptable carrier to enable administration in vivo.
- the term "pharmaceutical composition” refers broadly to a preparation of one or more of active ingredients and physiologically suitable components such as carriers, adjuvants and/or excipients. The purpose of a pharmaceutical composition is to facilitate administration of a compound to a subject or organism.
- active ingredient refers broadly to a substance accountable for a biological effect including, but not limited to, anti-inflammatory effects, anti-angiogenic effects, regenerative effects, pro-angiogenic effects, cytotoxic effects, pro-apoptotic effects, antimicrobial effects (e.g.
- active ingredient refers particularly to the tCRK-guided decorin, although the composition and/or the conjugate may comprise further active agents as set forth above.
- the pharmaceutical composition may be formulated as desired, for example as a semisolid or solid preparation, solution, dispersion, or suspension, using means and methods readily available in the art, for example by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping, lyophilizing or similar processes.
- the terms “pharmaceutically acceptable' and “physiologically acceptable” are interchangeable and refer to a material that is suitable for administration to a subject or organism without undue adverse side effects such as toxicity, significant irritation and/or allergic responses. In other words, the benefit/risk ratio must be reasonable.
- the term "pharmaceutically acceptable carrier” refers to a carrier substance or diluent with which the active ingredient is combined to facilitate administration and that is physiologically acceptable to the recipient.
- Pharmaceutically acceptable carriers are readily available in the art and, depending on the intended route of administration, may be selected from the group consisting of, but not limited to, transdermal carriers, transmucosal carriers, enteral carriers, parenteral carriers, and carriers for extended release formulations.
- the selected carrier should not abrogate the biological activity and properties of the active ingredient but minimize any degradation thereof as wells as minimize adverse side effects in the recipient.
- excipient refers to a preferably inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
- excipients include stabilizers, preservatives, pH modifiers, fillers, thickeners, viscosity modifiers, lubricants, solubilizers, surfactants, sweeteners, taste masking agents, and the like.
- Useful stabilizing excipients include, but are not limited to, surfactants such as polysorbate 20, polysorbate 80 and poloxamer 407; polymers such as polyethylene glycols and povidones; carbohydrates such as sucrose, mannitol, glucose and lactose; sugar alcohols such as sorbitol, glycerol, propylene glycol and ethylene glycol; proteins such as albumin; amino acids such as glycine and glutamic acid; fatty acids such as ethanolamine; antioxidants such as ascorbic acid; chelating agents such as EDTA salts; and metal ions such as Ca, Ni, Mg and Mn.
- surfactants such as polysorbate 20, polysorbate 80 and poloxamer 407
- polymers such as polyethylene glycols and povidones
- carbohydrates such as sucrose, mannitol, glucose and lactose
- sugar alcohols such as sorbitol, glycerol, propylene glycol and ethylene glycol
- useful preservative agents without limitation, are benzyl alcohol, chlorbutanol, benzalkonium chloride and possibly parabens.
- useful buffering excipients are, without limitation, sodium and potassium phosphates, citrate, acetate and carbonate or glycine buffers depending on the targeted pH- range. The use of sodium chloride as a tonicity adjuster is also useful.
- Non-limiting examples of further excipient materials include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils and polyethylene glycols. As readily understood by those skilled in the art, a given excipient may serve more than one function.
- the pharmaceutical composition can be administered in a number of ways depending on whether local or systemic treatment is desired, and on the area to be treated. Administration can be for example parenteral, enteral or topical.
- Parenteral administration of the composition is generally applied by injection, for example intravenously, intraperitoneally, subcutaneously, or intramuscularly.
- Preparations for parenteral administration are typically sterile aqueous or non- aqueous solutions, suspensions or emulsions, but the preparation may also be provided in a concentrated form or in a form of a powder to be reconstituted on demand. Slow release or sustained release formulation are also contemplated.
- Means and methods for formulating preparations for parenteral administration are readily available in the art, and those skilled in the art can easily select appropriate physiologically suitable carriers, adjuvants and/or excipients depending on the desired specifics of the preparation.
- Non-limiting examples of aqueous carriers for parenteral and other pharmaceutical preparations include sterile water, water-alcohol solutions, saline, and buffered solutions at physiological pH.
- Parenteral vehicles include sodium chloride solution, Ringer's dextrose solution, dextrose plus sodium chloride solution, Ringer's solution containing lactose, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose solution, and the like.
- Non-limiting examples of non-aqueous carriers for parenteral and other pharmaceutical preparations include solvents such as propylene glycol, polyethylene glycol, vegetable oils such as olive oil, fish oils, and injectable organic esters such as ethyl oleate.
- cryoprotectants including, without limitation, polymers (e.g. povidones, polyethylene glycol, dextran), sugars (e.g. sucrose, glucose, lactose), amino acids (e.g. glycine, arginine, glutamic acid) and albumin.
- Enteral administration of the composition may be applied, for example, through oral administration or administration via a percutaneous endoscopic gastrostomy (PEG).
- Compositions for oral administration include, without limitation powders, granules, capsules, sachets, tablets and aqueous or non-aqueous solutions and suspensions.
- Means and methods for formulating preparations for enteral administration are readily available in the art, and those skilled in the art can easily select appropriate physiologically suitable carriers, adjuvants and/or excipients depending on the desired specifics of the preparation.
- Topical administration of the composition may be applied, for example, through transdermal administration, transmucosal administration, epicutaneous administration, intranasal administration, rectal administration, vaginal administration and administration by an inhalant.
- formulations for topical administration can include ointments, lotions, creams, gels, drops, suppositories, sprays, liquids, powders and slow release or sustained release formulations or solid objects.
- Means and methods for formulating preparations for topical administration are readily available in the art, and those skilled in the art can easily select appropriate physiologically suitable carriers, adjuvants and/or excipients depending on the desired specifics of the preparation.
- compositions can be administered as a pharmaceutically acceptable acid- or base- addition salt, formed by reaction with inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid, and organic acids such as formic acid, acetic acid, propionic acid, glycolic acid, lactic acid, pyruvic acid, oxalic acid, malonic acid, succinic acid, maleic acid, and fumaric acid, or by reaction with an inorganic base such as sodium hydroxide, ammonium hydroxide, potassium hydroxide, and organic bases such as mono-, di-, trialkyl and aryl amines and substituted ethanolamines.
- inorganic acids such as hydrochloric acid, hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid, sulfuric acid, and phosphoric acid
- organic acids such as formic acid, acetic acid, propionic acid, glycolic
- Amounts and regimens for administration of a conjugate or a pharmaceutical composition disclosed herein can be determined readily by those with ordinary skill in the clinical art of treating skin diseases and conditions, especially epidermolysis bullosa. Generally, dosing will vary depending on considerations such as: age, gender and general health of the subject to be treated; kind of concurrent treatment, if any; frequency of treatment and nature of the effect desired; severity and type of epidermolysis bullosa in question; and other variables to be adjusted by the individual physician.
- a desired dose can be administered in one or more applications to obtain the desired results.
- the pharmaceutical composition may be administered in a single daily dose, or the total daily dosage may be administered in divided doses of e.g. two, three or four times daily.
- the pharmaceutical composition may be provided, for example, in unit dosage forms or in extended release formulations.
- the construct was assembled by using the PIPE method (Klock and Lesley, 2009, Methods Mol Biol 498:91-103).
- NEB 5-alpha competent E. coli (high efficiency) cells were used (C2987H; New England Biolabs Ipswich, MA) according to the manufacturer’s instructions.
- plasmid purification Mini-Prep
- the protein sequence of a monomeric 6XHistag-DCN-tCRK fusion protein is: G H H H H H H H DEASG1GPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVP KDLPPDTTLLDLQNNK1TE1KDGDFKNLKNLHAL1LVNNK1SKVSP GAFTPLVKLERLYLSKNQLKELPEK Met PKTLQELRAHENE1TKVR KVTFNGLNQ Met 1V1ELGTNPLKSSG1ENGAFQG Met KKLSY1R1ADT N1TS1PQGLPPSLTELHLDGNK1SRVDAASLKGLNNLAKLGLSFNS1 SAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKY1QVVYLHNN N1SVVGSSDFCPPGHNTKKASYSGVSLFSNPVQYWE1QPSTFRCVY VRSA1QLGNYKGSEFCRKDK Stop (SEQ ID NO: 21).
- FIG.1A A schematic map of the DCN-tCRK fusion protein used in the experimental part is shown in Fig.1A.
- the DCN-tCRK fusion protein of Fig.1A is a non-limiting example of tCRK-guided decorin conjugates suitable for use in the present invention. Recombinant protein production
- the constructs in pEFIRES-P expression vector were transfected via lipofection (FuGene 6, Promega, Madison, WI) into HEK293F cells. Positive clones were selected in the culture medium composed of DMEM Hi-glucose (4.5 g/1) + 2 mM L-alanyl-L- glutamine, 100 lU/ml penicillin (all from Sigma Aldrich, St. Louis, MO), and 10% FBS (Gibco, Grand Island, NY), in the presence of 5-160 gg/ml puromycin (HyClone, Thermo Fisher Scientific). Established cell lines were maintained in the culture containing 10 gg/ml puromycin.
- the validated cells were then resuspended in serum-free OptiCHO medium (Gibco) supplemented with 2 mM L-alanyl-L-glutamine (Sigma) and cultured in square shaped glass bottles mounted on a rotating shaker at in 37 °C in a 5% CO2 atmosphere. After the cells reached a density of 1-2 x 10 6 cells/ml, they were cultured further for 4 d at 33 °C for recombinant protein expression and secretion to the culture media. The protein was purified from the culture media via two step HisTrap purification protocol on the Akta Start chromatography system (GE Healthcare, Kunststoff, Germany)
- Cell culture supernatants were filtered and degassed on ice through a 0.45 gm filter unit (Corning #430514, Corning, NY).
- the 6XHis-tagged proteins were purified by Ni- NTA- 1MAC via a two-step purification protocol using first a HisTrap Excel column followed by a HisTrap HP column on the Akta Start chromatography system (GE Healthcare, Kunststoff, Germany) according to the manufacturer’s instructions in a 4 °C cold cabinet. Buffers were prepared from the His Buffer Kit (GE Healthcare/VWR (11- 0034-00). All buffers were filtered and degassed.
- the HisTrap Excel column eluate was diluted in 20 mM sodium phosphate buffer (pH 7.4) with 0.5 M NaCl to a final imidazole concentration of 30 mM, and then further purified on a HisTrap HP column, with a 35 mM imidazole wash and a gradient elution up to 300 mM imidazole (Fig. 2A includes an example of such a purification chromatogram).
- the peak fractions were analyzed on a SDS NuPAGE 4-12 % gradient gel (Life Technologies/Thermo Fisher Scientific, Waltham, MA) and visualized via PageBlue Protein Staining Solution (Thermo Fisher Scientific, Waltham, MA).
- Recombinant protein was verified by SDS Page and Western blotting. BioRad’s wet tank Mini-PROTEAN Trans-Blot Cell system was used (according to the manufacturer’s instructions). A PVDF membrane was probed with a primary murine antibody against human decorin (MAB143, R&D Systems, Minneapolis, MN) according to the manufacturer’s protocol. A secondary horseradish peroxidase-coupled anti-mouse antibody from Cell Signaling Technology was used. Chemiluminescent blot images were captured via ImageQuant LAS 4000 mini (GE Healthcare).
- the hydrodynamic diameter was measured by Dynamic Light Scattering (DLS) using a Zetasizer Nano ZS instrument (Malvern Instruments Ltd, Worchestershire, UK).
- the DCN-tCRK protein sample was diluted 1:5 in TBS buffer.
- Three 10X10 s measurements were performed at 25 °C. Data were analyzed using the Zetasizer software v7.11 (Malvern Instruments Ltd.) via the protein analysis model (non-negative least squares analysis followed by L-cuve) and size distribution by volume.
- the unfolding temperature of DCN-tCRK was determined using the VP-Capillary DSC (differential scanning calorimetry) instrument (GE Healthcare, Microcal Inc./Malvern Instruments Ltd.) in TBS buffer (50 mM Tris-Cl, 150 mM NaCl, pH 7.5) with a protein concentration of 0.2 mg/ml. All solutions were degassed. Samples were heated from 20 °C to 130 °C at a scanning rate of 2 °C/min. Feedback mode was set to 'low' and the filter period was 5 s. The melting temperature Tm (transition midpoint) was calculated by a Non-2-state fitting model using Origin 7.0 DSC software suite (Microcal Inc.).
- Expressed recombinant DCN-tCRK protein was identified from the monomeric gel band using Eksigent 425 NanoLC coupled with Sciex high speed TripleTOFTM 5600+ mass spectrometer. After isolation of gel band and Coomassie stain removal protein was then subjected to reduction (TCEP, 25 mM), alkylation (iodoacetamide, 0.5 M), and trypsin digestion as described in detail in Vahatupa et. al., 2018. After trypsin digestion peptides were diluted to 14 m ⁇ of sample buffer (2 % acetonitrile, 0.1 % formic acid) and 1 m ⁇ of sample was injected to the triple TOF mass spectrometry. In vitro binding analyses
- the plates were washed 3 times with phosphate buffered saline (PBS) and blocked for 1 h at 37 °C with 300 m ⁇ of blocking solution (1XPBS, 1% BSA, 0.1% Tween-20). His-tagged neuropilin-1 blb2 domain (NRP-1 WT) and triple mutant NS346A-E348A-T349A neuropilin-1 blb2 domain (NRP-1 mutant) were expressed and purified at the Protein Production and Analysis Facility at the Sanford Burnham Prebys Medical Discovery Institute (La Jolla, CA) as described previously (Teesalu et al., 2009, PNAS 106:16157-16162).
- PBS phosphate buffered saline
- NRP-1 positive prostate carcinoma-3 (PC-3) cells gift from the Ruoslahti laboratory at Sanford-Burnham-Prebys Medical Discovery Institute, La Jolla, CA
- M21 cells gift from David Cheresh Lab at University of California San Diego, La Jolla, CA
- the cells were first cultured in growth medium composed of 10% fetal bovine serum (FBS) in DMEM high glucose medium supplemented with penicillin, and streptomycin (Gibco).
- FBS fetal bovine serum
- DMEM high glucose medium supplemented with penicillin, and streptomycin
- the medium was aspirated, the cells were washed twice with warm medium, and fresh medium was added along with 10 gg FAM-labeled DCN-tCRK recombinant protein.
- the labelling was done by directly coupling DCN-tCRK recombinant protein to Fluorescein using Lightning-Link Fluorescein kit (Expedon Ltd, UK) according to the manufacturer protocol.
- the cells were incubated at 37 °C for one hour; medium was aspirated, the cells were washed and fixed with -20 °C methanol.
- the cells were washed with PBS and blocked (PBS, 1% BSA, 1% FBS, 1% goat serum, 0.05% Tween-20) for 30 minutes at RT followed by primary anti-FITC (Invitrogen, CA, USA. Catalog # A-889) for one hour at RT.
- the cells were washed, and secondary antibodies Alexa Fluor 488 goat anti rabbit IgG (Invitrogen, USA) were applied for one hour at RT in the dark.
- the nuclei of cells were stained with DAPI.
- the coverslips were mounted on glass slides with Fluoromount-G (Electron Microscopy Sciences, PA, USA), imaged using confocal microscopy (Olympus FV1200MPE, Tokyo, Japan) and analyzed using the FV10- ASW4.2 viewer.
- mice (Janvier Labs, Le-Genest-Saint-Isle, France) were used in pharmacokinetics. The mice were fed with standard laboratory pellets and water ad libitum. All animal experiments with the Balb/cJRj mice were performed in accordance with protocols approved by the National Animal Ethics Committee of Finland (ESAVI/6422/04.10.07/2017).
- RDEB recessive dystrophic epidermolysis bullosa
- the col7al-/- RDEB mice were generated by breeding C57BL6/J col7al+/- mice with the genotype determined by polymerase chain reaction (PCR).
- C57BL6/J col7al+/- mice kindly provided by Dr. Jouni Uitto at Thomas Jefferson University, were developed by targeted ablation of the col7al gene through out-of-frame deletion. All animal studies with the coI7al7- RDEB were conducted using protocols approved by New York Medical College Institutional Animal Care & Use Committee (IACUC).
- IACUC New York Medical College Institutional Animal Care & Use Committee
- DCN-tCRK or DCN were diluted in Tris buffered saline (TBS) containing 0.05 % Tween-20.
- TBS Tris buffered saline
- the pharmacokinetics of DCN-tCRK and DCN were studied with 8 week old Balb/c male mice. 5 mg/kg either DCN-tCRK or DCN was injected in tail vein under isoflurane anesthesia. Blood samples from distinct tail vein were gathered at 15 min, 30 min, 60 min, 2 h, 4 h, and 16 h after injection. At 8 h or 24 h after the injection, the mice were sacrificed under medetomidine-ketamine anesthesia and blood samples were collected from the subclavian vein.
- the samples were mixed with 1 M ethylenediaminetetraacetic acid (EDTA), centrifuged 2000 g for 10 min at room temperature and the plasma was stored for analysis.
- the concentration of human origin decorin in the plasma samples was determined with Human Decorin DuoSet ELISA kit (#DY143, R&D Systems) according to instructions provided by the manufactured.
- a venous blood sample from an uninjected mouse was used in each plate to ensure the specificity of the primary antibody.
- the pregnant col7al + /- mice were housed individually and monitored daily before delivery. As intravenous injection in neonatal mice is technically challenging and often yields inconsistent results, the Inventors chose to inject within 24 hours of birth the first dose of DCN-tCRK and DCN (5 gg in 15 m ⁇ PBS, corresponding to ⁇ 5 mg/kg) into the liver of the coI7al V- mice, since liver is a primary site of hematopoiesis in fetal and neonatal mice and the human cells have been shown to rapidly enter the circulation after intrahepatic injection (Liao etal., 2015, Stem Cells 33:1807-1817; Liao etal., 2018, Steml Cells Transl Med 7:530-542).
- This first dose was followed by repeated intraperitoneal (z.p.) administration of the protein every other day till the mice reached 14 days of age (maximal 7 doses) and the dose was increased to 10 gg when the mice became a week old. The mice were monitored every day. All the experimental col7al /- mice were genotyped at the time of sample collection.
- Dorsal skin and paws were excised from selected mice, embedded in Tissue-Tec OCT Compound (Sakura Finetek, Torrance, CA) and stored at -80 °C freezer. 6 gm serial sections were cut for each specimen. Picrosirius Red staining and CTGF (#ab6992, Abeam, Cambridge, UK) immunohistochemical staining were performed at the Core Histology Lab of New York Medical College. For immunochemical staining of his tag, the sections were fixed in 4 % paraformaldehyde and blocked with M.O.M.
- the slides were then incubated with respective primary antibodies, including anti-CollA (#R1038, Acris, Rockville, MD), anti-aSMA (#14968, Cell signaling Technology, Danvers, MA), anti-6x-His tag (#R930-25, Thermofisher Scientific, Carlsbad, CA) and anti-NRP-1 (#AF566-SP, R&D Systems, Minneapolis, MN) followed by corresponding Alexa Fluor 488 secondary antibodies (Invitrogen, Carlsbad, CA).
- the slides were then mounted in Vectashield mounting medium containing DAP1 (Vector Laboratories, Burlingame, CA).
- Tissue biopsies were snap frozen in liquid nitrogen, ground with a precooled pestle, and homogenized with lysis buffer (1% Tween 20, protease inhibitor cocktail, DNase and RNase in PBS). After centrifugation at 12,000 g for 10 min at 4°C, the supernatant was collected and quantitated for total protein concentration with the Bio Rad DC protein assay (BioRad, Hercule, CA). Sera from col7al7- mice with and without DCN-tCRK or DCN administration were diluted 1:20 in sample diluent before applying to the assay.
- lysis buffer 1% Tween 20, protease inhibitor cocktail, DNase and RNase in PBS
- RT 2 Profiler PCR Array contains primers for 84 wound-healing genes and 5 housekeeping genes with genomic DNA, reverse-transcriptional and PCR positive controls in 96 well plate.
- Total RNA was isolated from whole front paw of WT, RDEB and DCN or DCN-tCRK injected col7al /- mice (3 mice in each group) at day 7. Quality and concentration of RNA was determined with NanoDrop 200C (ThermoScientific, Waltham, MA). RNA was treated with genomic DNA elimination mix (QIAGEN).
- RNA of each sample was applied for reverse transcription using RT 2 First Strand kit (QIAGEN).
- cDNA synthesis reaction was combined with 2 x RT 2 SYBR Green Master mix and 25 m ⁇ of this cocktail was dispensed in each well of 96-well plate.
- Q-PCR was run on QuantStudio5 Real-Time PCR instrument (Applied Biosystems, Foster City, CA). CT values were exported to an Excel file. Resulting raw data was analyzed using the PCR Array Data Analysis Template in the GeneGlobe Data Analysis Center (https://www.qiagen.com/us/geneglobe).
- a gene expression was calculated using the AAC T method.
- a fold-change gene expression threshold of 1.5 and a p-value threshold of 0.05 were used to analyzed data between WT pup and untreated/treated pups.
- Human normal fibroblasts and RDEB patient-derived fibroblasts were cultured in DMEM supplemented with 10% FBS, as previously described (Liao et al., 2018, Stem Cells 36:1839-1850).
- the collagen lattices were prepared by mixing the cell suspension with neutralized rat tail collage type I (Advance BioMatrix, Carlsbad, CA). The final concentration of collagen was 2.4 mg/ml with a cell density of 2.1 x 10 5 cells/ml. 500 m ⁇ of cells/collagen suspension was dispensed into a single well of 24- well plate and allowed to solidify for 30 min at room temperature.
- the Inventors engineered DCN-tCRK fusion protein by placing tCRK peptide at the C- terminus of DCN (Fig. 1A). Both DCN-tCRK and native DCN were expressed in mammalian cells and purified using chromatography (Fig. 2A). Both recombinant proteins migrated as sharp bands at about 55 kDa with a smear above the band in SDS gel electrophoresis and detected as DCN by Western blot analysis (Fig. 2B). The sharp band corresponds to the core protein, and the smear is caused by heterogeneity in the glycosaminoglycan sulfate chain (mostly chondroitin) attached to the DCN core.
- Table 1 The sequence of human DCN and the tCRK sequence in the C-terminus analyzed by mass spectrometry.
- the underlined letters indicate the peptides that were found to be specific to human DCN and the letters in italics indicate amino acids specific for the C-terminus including the tCRK sequence (CRKDK/RKDK), which is further indicated in bold.
- DCN-tCRK interacts with NRP-1 in vitro
- DCN-tCRK was immobilized on ELISA plates and tested its binding to wild type (WT) or mutant NRP-1, where the CendR-binding pocket was disabled by a triple mutation.
- WT wild type
- mutant NRP-1 mutant NRP-1
- DCN-tCRK effectively binds to WT NRP-1 at a significantly higher level than the control bovine serum albumin (BSA) (p ⁇ 0.01), whereas it showed no significant binding to the mutant NRP-1 (p > 0.05) (Fig. IB).
- BSA bovine serum albumin
- DCN-tCRK and DCN were injected intravenously in parallel in healthy Balb/c mice and their amount in peripheral blood at different time points within 24 hours of administration was quantitated by ELISA.
- the half-life of DCN-tCRK in blood was 30 minutes and was not significantly different from that of DCN (Fig. 3).
- the pharmacokinetic studies suggest that modification of DCN with small vascular homing peptide does not influence the pharmacokinetics of DCN.
- coI7al - mice an animal model of RDEB. These mice are generated by breeding of the heterozygous littermates, and coI7al V- mice can be identified at birth based on manifestation of hemorrhagic blistering in the skin.
- the newborn coI7al -/- mice were randomly divided to receive DCN, DCN-tCRK or PBS (negative control) intrahepatic administration. Repeated intraperitoneal administration was performed to the surviving mice within each group every other day after the first dose until day 14.
- the median life span of coI7al - mice was 2 days after PBS injection and it was significantly prolonged to 7 days after administration of DCN (p ⁇ 0.0001) (Fig.
- Immunohistochemical staining based on the expression of histidine-tag was also performed to analyze the anatomical distribution of DCN-tCRK or DCN in the RDEB skin.
- DCN-tCRK was detected in the dermis of both the paw and dorsal skin of the RDEB mice at one, two and three weeks (Fig. 4C).
- staining of the gastrointestinal (Gl) tract of the recipient RDEB mice did not reveal reactivity with anti-his antibody (data not shown), suggestive of a skin-specific targeting of DCN-tCRK.
- DCN-tCRK therapy suppresses the fibrotic responses in RDEB mice
- the relative fold changes (log2) of gene expression and the p values (-loglO) are also presented as volcano plots and the significantly (p ⁇ 0.05) dysregulated genes are marked in white in each plot (Fig. 6B).
- the significantly upregulated genes in the vehicle RDEB skin are involved in TGFp signaling (i.e., Tgfbl, Tgfbr3, Ctgf), WNT signaling ( Ctnnbl ), MAPK1/MAPK3 signaling ( Mapk3 ) and epidermal growth factor receptor signaling [Egfr], ECM remodeling ( Ctsg , Plaur), cell adhesion ( Itgb3 , ItgbS ) and inflammation [114, Cxcl3, Tnfa).
- TGFp signaling i.e., Tgfbl, Tgfbr3, Ctgf
- WNT signaling Ctnnbl
- MAPK1/MAPK3 signaling Mapk3
- Mapk3 epidermal growth factor receptor signaling
- DCN-tCRK-treated RDEB skin was markedly different from those of vehicle and DCN-treated RDEB skin and resembled that of WT skin (Fig. 6A). Although it showed individual variation in the expression of some genes, none of the genes in the array were significantly dysregulated in DCN-tCRK treated RDEB skin when compared to the WT (Fig. 6 and Table 2).
- N /A indicates average threshold cycle either not determined or greater than the defined cut-off.
- the genes that are significantly upregulated as compared to the WT are bolded and the genes that are significantly upregulated only in DCN-treated col7a P skin are underlined. Supporting the development of TGFpi-mediated fibrosis in untreated RDEB skin and its suppression by DCN-tCRK treatment, strong expression of CTGF/CCN2 was observed in vehicle-injected RDEB skin and the expression level was markedly diminished after treatment with DCN-tCRK (Fig. 7A).
- aSMA + cells in the WT as well as DCN-tCRK treated RDEB skin co-localized with blood vessels (CD31 staining), which indicates their identity as blood vessel smooth muscle cells and pericytes, whereas the aSMA + cells in the vehicle-treated RDEB skin were outside of the blood vessels, i.e. indicative of being myofibroblasts (Fig. 7D).
- DCN-tCRK the abilities of DCN and DCN-tCRK to suppress the collagen gel contraction in vitro were compared, using both normal and RDEB-derived fibroblasts.
- DCN-tCRK suppressed the collagen gel contraction in both normal (p ⁇ 0.05) and RDEB-derived (p ⁇ 0.01) fibroblasts (Fig. 8).
- DCN-tCRK recombinant protein was more effective than unmodified DCN in improving the survival of coI7al V- mice.
- the exact molecular mechanism is not known, but it is assumed, without being limited to any theory, that multiple different mechanisms could contribute to the improved survival.
- DCN is an anti-inflammatory and -fibrotic molecule. Consistent with the Inventors’ previous finding on the activation of TGFp signaling as early as a week after birth, the expression of more than half of the genes related to fibrosis formation were up-regulated in the untreated RDEB mouse skin at the one-week time point. Without being limited to any theory, the improved survival of RDEB mice by DCN-tCRK administration is likely related to the anti-fibrotic and anti inflammatory effects of the therapeutic protein.
- DCN can bind and downregulate EGFR and HGF receptor Met (to suppress expression of b-catenin).
- HGF receptor Met to suppress expression of b-catenin.
- the normalized expression of these genes in the coI7al V- mouse skin after administration of DCN-tCRK suggests multiple therapeutic functions of DCN-tCRK in RDEB.
- the up- regulation of pro-inflammatory genes in DCN treated RDEB skin may indicate therapeutic effect that was not sustained by the administration of native DCN.
- tCRK this peptide
- tCRK can serve as a vehicle for delivering decorin and other therapeutic molecules in the treatment of systemic dermal diseases, especially epidermolysis bullosa.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Dermatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Marine Sciences & Fisheries (AREA)
- Toxicology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL297703A IL297703A (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
| AU2021266157A AU2021266157A1 (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
| JP2022563981A JP7824885B2 (ja) | 2020-04-28 | 2021-04-28 | 表皮水疱症の治療で使用するためのホーミングペプチド誘導デコリン複合体 |
| CN202180031725.5A CN115605218B (zh) | 2020-04-28 | 2021-04-28 | 用于治疗大疱性表皮松解症的归巢肽引导的核心蛋白聚糖缀合物 |
| CA3180694A CA3180694A1 (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
| US17/997,428 US20230167162A1 (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
| EP21724346.8A EP4142771A1 (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
| BR112022021879A BR112022021879A2 (pt) | 2020-04-28 | 2021-04-28 | Conjugados de decorina guiados por peptídeos de homing para uso no tratamento de epidermólise bolhosa |
| KR1020227041682A KR20230005314A (ko) | 2020-04-28 | 2021-04-28 | 수포성 표피박리증의 치료에 사용하기 위한 귀소 펩티드 유도 데코린 접합체 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063016359P | 2020-04-28 | 2020-04-28 | |
| FI20205431 | 2020-04-28 | ||
| US63/016,359 | 2020-04-28 | ||
| FI20205431 | 2020-04-28 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021219940A1 true WO2021219940A1 (en) | 2021-11-04 |
Family
ID=75870661
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/FI2021/050318 Ceased WO2021219940A1 (en) | 2020-04-28 | 2021-04-28 | Homing peptide-guided decorin conjugates for use in treating epidermolysis bullosa |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20230167162A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4142771A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7824885B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230005314A (cg-RX-API-DMAC7.html) |
| CN (1) | CN115605218B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021266157A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022021879A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3180694A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL297703A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021219940A1 (cg-RX-API-DMAC7.html) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN118001404B (zh) * | 2024-02-06 | 2025-02-25 | 四川大学华西医院 | 抑制C17orf67基因表达试剂在制备治疗获得性大疱表皮松解症药物中的用途 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008136869A2 (en) | 2006-12-06 | 2008-11-13 | Burnham Institute For Medical Research | Methods and compositions related to targeting wounds, regenerating tissue, and tumors |
-
2021
- 2021-04-28 BR BR112022021879A patent/BR112022021879A2/pt unknown
- 2021-04-28 IL IL297703A patent/IL297703A/en unknown
- 2021-04-28 EP EP21724346.8A patent/EP4142771A1/en active Pending
- 2021-04-28 CA CA3180694A patent/CA3180694A1/en active Pending
- 2021-04-28 JP JP2022563981A patent/JP7824885B2/ja active Active
- 2021-04-28 KR KR1020227041682A patent/KR20230005314A/ko active Pending
- 2021-04-28 CN CN202180031725.5A patent/CN115605218B/zh active Active
- 2021-04-28 WO PCT/FI2021/050318 patent/WO2021219940A1/en not_active Ceased
- 2021-04-28 AU AU2021266157A patent/AU2021266157A1/en active Pending
- 2021-04-28 US US17/997,428 patent/US20230167162A1/en active Pending
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008136869A2 (en) | 2006-12-06 | 2008-11-13 | Burnham Institute For Medical Research | Methods and compositions related to targeting wounds, regenerating tissue, and tumors |
Non-Patent Citations (32)
| Title |
|---|
| ABDULLATIF ET AL., GRAEFES ARCH CLIN EXP OPHTHALMOL, vol. 256, 2018, pages 2473 - 2481 |
| AGEMY ET AL., BLOOD, vol. 116, 2010, pages 2847 - 2856 |
| CIANFARANI ET AL., MATRIX BIOL, vol. 81, 2019, pages 3 - 16 |
| CIANFARANI FRANCESCA ET AL: "Decorin counteracts disease progression in mice with recessive dystrophic epidermolysis bullosa", MATRIX BIOLOGY, vol. 81, 1 August 2019 (2019-08-01), NL, pages 3 - 16, XP055825277, ISSN: 0945-053X, DOI: 10.1016/j.matbio.2018.12.001 * |
| DANIELS ET AL., AM J PATHOL, vol. 163, 2003, pages 2043 - 2052 |
| HOBBS ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 252, 1998, pages 368 - 372 |
| JARVINEN ET AL., ACS BIOMATERIALS SCIENCE & ENGINEERING, vol. 3, 2017, pages 1273 - 1282 |
| JÄRVINEN TERO A.H. ET AL: "Systemically Administered, Target-Specific, Multi-Functional Therapeutic Recombinant Proteins in Regenerative Medicine", NANOMATERIALS, vol. 10, no. 2, 28 January 2020 (2020-01-28), pages 226, XP055825283, DOI: 10.3390/nano10020226 * |
| JARVINENPRINCE, BIOMED RES INT, vol. 2015, 2015, pages 654765 |
| JARVINENRUOSLAHTI, AM J PATHOL, vol. 171, 2007, pages 702 - 711 |
| JARVINENRUOSLAHTI, BR J PHARMACOL, vol. 176, 2019, pages 16 - 25 |
| KLOCKLESLEY, METHODS MOL BIOL, vol. 498, 2009, pages 91 - 103 |
| KRUSIUSRUOSLAHTI, PNAS, vol. 83, 1986, pages 7683 - 787 |
| LIAO ET AL., STEM CELL TRANSL MED, vol. 7, 2018, pages 530 - 542 |
| LIAO ET AL., STEM CELLS, vol. 33, 2015, pages 1807 - 1817 |
| LIAO ET AL., STEM CELLS, vol. 36, 2018, pages 1839 - 1850 |
| LIAO ET AL., STEML CELLS TRANSL MED, vol. 7, 2018, pages 530 - 542 |
| ODORISIO ET AL., HUM MOL GENET, vol. 23, 2014, pages 3907 - 3922 |
| PASQUALINIRUOSLAHTI, NATURE, vol. 380, no. 6572, 1996, pages 364 - 366 |
| PEMMARI TOINI ET AL: "Exposed CendR Domain in Homing Peptide Yields Skin-Targeted Therapeutic in Epidermolysis Bullosa", MOLECULAR THERAPY, vol. 28, no. 8, 28 April 2020 (2020-04-28), US, pages 1833 - 1845, XP055825237, ISSN: 1525-0016, DOI: 10.1016/j.ymthe.2020.05.017 * |
| REEDIOZZO, GLYCOCONJ J, vol. 19, 2002, pages 249 - 255 |
| RUOSLAHTI ET AL., J CELL BIOL, vol. 188, 2010, pages 759 - 768 |
| RUOSLAHTI, ADV DRUG DELIV REV, vol. 110-111, 2017, pages 3 - 12 |
| RUOSLAHTI, BIOCHEM SOC TRANS, vol. 32, 2004, pages 397 - 402 |
| RUOSLAHTI, J CLIN INVEST, vol. 127, 2017, pages 1622 - 1624 |
| SCOTT ET AL., J BIOL CHEM, vol. 278, 2003, pages 18353 |
| SCOTT ET AL., PNAS, vol. 101, 2004, pages 15633 - 15638 |
| SUGAHARA ET AL., CANCER CELL, vol. 16, 2009, pages 510 - 520 |
| SUGAHARA ET AL., SCIENCE, vol. 328, 2010, pages 1031 - 1035 |
| TEESALU ET AL., PNAS, vol. 106, no. 38, 2009, pages 16157 - 16162 |
| TEESALU ET AL., PROC NATL ACAD SCI U S A, vol. 106, 2009, pages 16157 - 16162 |
| VIAL ET AL., J BIOL CHEM, vol. 286, 2011, pages 24242 - 24252 |
Also Published As
| Publication number | Publication date |
|---|---|
| CN115605218A (zh) | 2023-01-13 |
| CA3180694A1 (en) | 2021-11-04 |
| BR112022021879A2 (pt) | 2022-12-20 |
| JP2023523719A (ja) | 2023-06-07 |
| AU2021266157A1 (en) | 2022-12-08 |
| CN115605218B (zh) | 2026-03-24 |
| JP7824885B2 (ja) | 2026-03-05 |
| EP4142771A1 (en) | 2023-03-08 |
| IL297703A (en) | 2022-12-01 |
| US20230167162A1 (en) | 2023-06-01 |
| KR20230005314A (ko) | 2023-01-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11224662B2 (en) | Methods and therapeutics comprising ligand-targeted ELPs | |
| JP6339231B2 (ja) | 線維症性疾患の処置のためのTrailレセプターアゴニスト | |
| EP3065765B1 (en) | Use of il-22 dimers in manufacture of medicaments for treating pancreatitis | |
| CN102378635A (zh) | 重组人白蛋白-人粒细胞集落刺激因子融合蛋白的新稳定制剂 | |
| US20190247317A1 (en) | Icam-1 targeting elps | |
| US9901620B2 (en) | Trail receptor agonists for treatment of fibrotic disease | |
| CN109789180A (zh) | Kif13b衍生的肽和抑制血管生成的方法 | |
| JP7824885B2 (ja) | 表皮水疱症の治療で使用するためのホーミングペプチド誘導デコリン複合体 | |
| CN109937045A (zh) | 局部缺血/再灌注损伤 | |
| CN114409733A (zh) | 靶向抑制mlkl乙酰化的多肽和/或其衍生物及其用途 | |
| Pemmari et al. | Domain in Homing Peptide Yields Skin-Targeted Therapeutic in Epidermolysis Bullosa | |
| JP2011529452A (ja) | 抗血管新生薬としての可溶性igf受容体 | |
| HK1236396A1 (en) | Trail receptor agonists for treatment of fibrotic diseases | |
| HK1223556B (zh) | Il-22二聚体在制备用於治疗胰腺炎的药物中的用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21724346 Country of ref document: EP Kind code of ref document: A1 |
|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 3180694 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022563981 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 297703 Country of ref document: IL |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022021879 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20227041682 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021724346 Country of ref document: EP Effective date: 20221128 |
|
| ENP | Entry into the national phase |
Ref document number: 2021266157 Country of ref document: AU Date of ref document: 20210428 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112022021879 Country of ref document: BR Kind code of ref document: A2 Effective date: 20221027 |